Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M012108.263ON52152127990.0
KAFR0B05520singletonON51048918610.0
NCAS0B038408.263ON49748818330.0
KAFR0B055308.263ON51449818210.0
Skud_12.1578.263ON59250018270.0
Smik_12.1488.263ON59252618270.0
YLR089C (ALT1)8.263ON59252618250.0
Suva_10.1738.263ON59248918250.0
TDEL0F039008.263ON55948918120.0
NDAI0B019908.263ON58849217930.0
SAKL0H17006g8.263ON53148817850.0
Skud_4.3728.263ON50749117720.0
Smik_4.3578.263ON50749517670.0
Suva_2.2718.263ON50749517640.0
NCAS0B050208.263ON56848917700.0
NDAI0J013608.263ON50148917610.0
YDR111C (ALT2)8.263ON50749517570.0
KLLA0F19162g8.263ON52848717570.0
ZYRO0C01628g8.263ON53449617500.0
KNAG0G020408.263ON59149517530.0
CAGL0L12254g8.263ON57449517190.0
KLTH0G13662g8.263ON51947816480.0
Kpol_392.58.263ON51248616470.0
KAFR0B027308.263ON53950616380.0
Ecym_43078.263ON53449516290.0
Kwal_56.237918.263ON51847816230.0
TBLA0E044408.263ON56248416240.0
Kpol_543.398.263ON49249216090.0
TBLA0G01630singletonON50049415920.0
TPHA0J007508.263ON52248815850.0
TBLA0F030608.263ON50050215680.0
AGR085W8.263ON52149515600.0
TPHA0A018008.263ON49849015270.0
Kwal_34.160181.472ON3791781454e-09
KLTH0G19646g1.472ON3791241171e-05
TPHA0O014501.321ON4431381108e-05
KLTH0B06270g2.102ON5251291108e-05
KLLA0F10021g3.511ON4973291101e-04
KLLA0F03509g2.252ON3871241091e-04
NDAI0B045502.102ON5651621091e-04
ADL249W2.252ON3871881062e-04
Suva_6.1361.321ON4441671072e-04
NCAS0G040501.472ON3841501062e-04
KLTH0G09614g2.252ON3891791062e-04
SAKL0E08492g2.252ON3841241044e-04
SAKL0D11528g1.472ON3831521044e-04
TPHA0F012602.252ON3921901027e-04
Kpol_480.11.472ON3801611000.001
TDEL0D019001.321ON443364970.003
Kpol_1035.231.321ON444136950.006
KNAG0B053201.321ON433160930.008
SAKL0H21824gna 1ON499288940.008
NCAS0A092001.321ON445332930.008
KNAG0G005501.472ON387161930.008
Kwal_23.48882.252ON389177930.010
SAKL0F02156g3.511ON498281930.010
KNAG0B006603.511ON496123930.010
Kpol_1039.222.252ON386189920.011
TBLA0B009902.102ON546129910.019
Ecym_62921.321ON43068900.021
Kwal_14.25741.321ON44354900.022
Kpol_278.23.511ON498333900.024
Skud_10.1561.321ON460135890.028
YJL060W (BNA3)1.321ON44465890.030
Smik_10.1801.321ON44461890.031
KLTH0H10648g1.321ON44354890.032
Kwal_47.17462na 1ON492125880.038
TBLA0B080808.204ON444179880.041
KLTH0E07678gna 1ON492238870.045
TDEL0C040902.252ON383147870.048
CAGL0G06028g2.102ON537161870.051
ZYRO0A01672g2.252ON386133860.065
CAGL0J05126g1.321ON433233860.066
KLLA0F01617g1.321ON444181860.071
SAKL0D06886g1.321ON44754860.073
NDAI0G057601.321ON448135840.10
AGR167Wna 1ON512243840.11
KAFR0J015802.252ON383117840.11
NCAS0A038308.204ON446248830.16
NCAS0B064402.252ON385128830.16
Suva_9.782.252ON386129820.17
TDEL0A016008.204ON475186810.24
TPHA0D033703.511ON497123810.27
KLTH0G19624gsingletonON46843810.30
KLTH0B00176g8.204ON44843800.33
KNAG0E018502.252ON384123790.39
KLTH0G02002g3.511ON496145790.41
AEL170C1.321ON458130790.44
YER152C8.204ON443127790.46
TDEL0B015908.477ON476148790.47
Ecym_32902.252ON386123780.50
KAFR0A017101.321ON435170780.56
CAGL0C01243g2.252ON383124780.58
Smik_5.3198.204ON443127780.61
Ecym_6319singletonON35443770.69
Skud_9.552.252ON385124770.69
Kwal_47.189823.511ON496198780.70
ZYRO0B11088g8.204ON45091770.70
Smik_9.532.252ON388127770.81
YIL116W (HIS5)2.252ON385126760.86
Suva_5.2818.204ON450127760.91
KNAG0G016808.204ON45233760.94
NDAI0C059608.204ON47890761.2
ZYRO0G20636g1.321ON453139751.2
SAKL0E12188g2.102ON530134741.7
CAGL0G01254g3.511ON504123741.7
KNAG0I015801.356ON58159742.1
KLLA0A04906gna 1ON480123732.2
NCAS0E006703.511ON497145732.3
Kpol_1032.398.204ON453116732.4
KAFR0D014203.511ON492129722.8
SAKL0A06468g6.137ON73245723.1
KAFR0B023808.204ON44332713.6
AFL016C6.137ON70484723.8
CAGL0I06578g8.204ON43633714.1
TDEL0D057903.511ON49776714.1
AGL178WsingletonON646130714.9
YGL202W (ARO8)3.511ON500150705.2
Kwal_8.5858.204ON44643705.2
AGR141C8.204ON43845696.4
Ecym_7228na 1ON488125696.8
Ecym_55428.204ON44648697.2
Smik_7.693.511ON500122689.7
Skud_5.2908.204ON44333689.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01210
         (521 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....  1082   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   721   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   710   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            706   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   708   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   708   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   707   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   707   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   702   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   695   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   692   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   687   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   685   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   684   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   686   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   682   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   681   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   681   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   678   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   679   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   666   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   639   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   639   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   635   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   632   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   629   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   630   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   624   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              617   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   615   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   608   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   605   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   592   0.0  
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    60   4e-09
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    50   1e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    47   8e-05
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    47   8e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    47   1e-04
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    47   1e-04
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    47   1e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    45   2e-04
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    46   2e-04
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    45   2e-04
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    45   2e-04
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    45   4e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    45   4e-04
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    44   7e-04
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    43   0.001
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    42   0.003
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    41   0.006
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    40   0.008
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    41   0.008
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    40   0.008
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       40   0.008
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    40   0.010
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    40   0.010
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    40   0.010
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    40   0.011
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    40   0.019
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    39   0.021
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    39   0.022
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    39   0.024
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    39   0.028
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    39   0.030
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    39   0.031
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    39   0.032
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    39   0.038
TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa] ...    39   0.041
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    38   0.045
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    38   0.048
CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {...    38   0.051
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    38   0.065
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    38   0.066
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    38   0.071
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    38   0.073
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    37   0.10 
AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-synte...    37   0.11 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    37   0.11 
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     37   0.16 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    37   0.16 
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    36   0.17 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    36   0.24 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    36   0.27 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    36   0.30 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    35   0.33 
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    35   0.39 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    35   0.41 
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    35   0.44 
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    35   0.46 
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    35   0.47 
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    35   0.50 
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    35   0.56 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.58 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    35   0.61 
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    34   0.69 
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    34   0.69 
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    35   0.70 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    34   0.70 
Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W (...    34   0.81 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    34   0.86 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    34   0.91 
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    34   0.94 
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    34   1.2  
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    33   1.2  
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    33   1.7  
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    33   1.7  
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    33   2.1  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   2.2  
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     33   2.3  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    33   2.4  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    32   2.8  
SAKL0A06468g Chr1 complement(580333..582531) [2199 bp, 732 aa] {...    32   3.1  
KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {O...    32   3.6  
AFL016C Chr6 complement(405116..407230) [2115 bp, 704 aa] {ON} S...    32   3.8  
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    32   4.1  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    32   4.1  
AGL178W Chr7 (363877..365817) [1941 bp, 646 aa] {ON} Non-synteni...    32   4.9  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    32   5.2  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   5.2  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    31   6.4  
Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar t...    31   6.8  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    31   7.2  
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    31   9.7  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    31   9.7  

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score = 1082 bits (2799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/521 (100%), Positives = 521/521 (100%)

Query: 1   MILSNEQKQMHWTTSSSKKRQHTGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAI 60
           MILSNEQKQMHWTTSSSKKRQHTGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAI
Sbjct: 1   MILSNEQKQMHWTTSSSKKRQHTGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAI 60

Query: 61  PMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQ 120
           PMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQ
Sbjct: 61  PMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQ 120

Query: 121 LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDI 180
           LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDI
Sbjct: 121 LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDI 180

Query: 181 FLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTK 240
           FLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTK
Sbjct: 181 FLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTK 240

Query: 241 AEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300
           AEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ
Sbjct: 241 AEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300

Query: 301 NNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFS 360
           NNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFS
Sbjct: 301 NNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFS 360

Query: 361 NEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLL 420
           NEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLL
Sbjct: 361 NEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLL 420

Query: 421 YDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVP 480
           YDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVP
Sbjct: 421 YDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVP 480

Query: 481 GSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521
           GSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD
Sbjct: 481 GSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  721 bits (1861), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/489 (69%), Positives = 408/489 (83%), Gaps = 4/489 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQ--QPDLLPFNAITVANIGNP 91
           FEPA K+   DLN+ II+AEYAVRG+I M+AEELE +L    QP   PF  I  ANIGNP
Sbjct: 24  FEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGNP 83

Query: 92  QQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSL 151
           QQLDQKPLTFSRQV+SIL+YP LL +++ L++ G YK+DA +RA +L  QIG SVGAYSL
Sbjct: 84  QQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAYSL 143

Query: 152 AQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQ 211
           AQGVYGIRE+ A FI++RD  E AS DDIFLTDGASKA TYL+  LC++  TGI+IPIPQ
Sbjct: 144 AQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPIPQ 203

Query: 212 YPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTG 271
           YPLYTASI ++N+ MLPYYLDEESGWSTK EEIE  VI++I+ G+ P  +VVINPGNPTG
Sbjct: 204 YPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNPTG 263

Query: 272 AVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNV 331
           AVLS D I +I+T+AAKYGIV++ADEVYQ+NI+ G +FHSMKK+LR LQ+ +P G+YDNV
Sbjct: 264 AVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYP-GKYDNV 321

Query: 332 QLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNP 391
           QLAS+HSTSKGVSGECGQRGGYME+VGFS+EVR ++LKLASI+ICSVVTGQALVDLM++P
Sbjct: 322 QLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVDP 381

Query: 392 PREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKA 451
           P  GD+SYE D  ER EIH+ +K R   LYDTF  LEGIECQ+PQGAMYLFP+L+L  +A
Sbjct: 382 PHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDRA 441

Query: 452 IEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETF 511
           IEEAK L ++ DEFYCH+LL+ TGICTVPGSGFGQ+EGTYHVRTTFL+PGT+WI DW+ F
Sbjct: 442 IEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKKF 501

Query: 512 HKAFYDKYR 520
           H+ F  +Y+
Sbjct: 502 HEKFMKEYQ 510

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/488 (67%), Positives = 405/488 (82%), Gaps = 1/488 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F+PA KL   D+N+N++DA++A+RG+I +KAE+L++QL++ P  LPF+ ITVANIGNPQ+
Sbjct: 11  FQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQE 70

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153
           L+QKPLTF+RQVVSILQYP LL+  + L     +  D+F RA  LL  IGGSVGAYS +Q
Sbjct: 71  LNQKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQ 130

Query: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213
           GVYGIR++ A++IT+RD GE + P+DIFLT GA+ AA+YLLS+LCR   TG++IPIPQYP
Sbjct: 131 GVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYP 190

Query: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273
           LYTA++ +  S M+PYYLDEES WST   EIE+ V+DSIK+G+ P VIVVINPGNPTGAV
Sbjct: 191 LYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAV 250

Query: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333
           LS   IA+I  IAAKYGIVVLADEVYQ NI+ GV+FHS KKVLR LQ+ +P G++DN+QL
Sbjct: 251 LSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYP-GKFDNIQL 309

Query: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393
           ASMHSTSKGV GECGQRGGYMELVGF++EVRQ++LKLA +++CSVVTGQA+VDLML PP+
Sbjct: 310 ASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPK 369

Query: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453
           +GD SYELD +ER+EI + M  R   LY  F KL+GIECQ+PQGAMYL+P L+LSKKAI 
Sbjct: 370 KGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIA 429

Query: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513
           +A+SL L PDEFYCH LLD TGICTVPGSGFGQK+GTYH+RTTFLAPG +WI  WE FHK
Sbjct: 430 KAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHK 489

Query: 514 AFYDKYRD 521
            FY+KY+D
Sbjct: 490 HFYEKYQD 497

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/498 (67%), Positives = 407/498 (81%), Gaps = 6/498 (1%)

Query: 25  DDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQL--SQQPDLLPFNA 82
           DD T+    F+PA+K+  DDLN+N++ +EYAVRG+IP +AEELE +L  +   D L F  
Sbjct: 21  DDDTIHN--FKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFEN 78

Query: 83  ITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQI 142
           I  ANIGNPQQLDQKPLTFSRQV+SILQYP LL+    LV++G +K DA +RA  LL  I
Sbjct: 79  IVHANIGNPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHI 138

Query: 143 GGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSS 202
           GGSVGAYS +QGVYGIRE+VA++IT RD GETASPDDIFLT+GASKAA+YLLS+LC+D +
Sbjct: 139 GGSVGAYSSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKN 198

Query: 203 TGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIV 262
           TG++IPIPQYPLYTA+IT+ ++ MLPYYL+EESGWST   EIE+ V+D+I   V P V+V
Sbjct: 199 TGVLIPIPQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMV 258

Query: 263 VINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRD 322
           VINPGNPTG+VLS D I  I+ I AKYGIV++ADEVYQ NI+ G +FHSMKKVLRSLQ+ 
Sbjct: 259 VINPGNPTGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQ 317

Query: 323 HPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQ 382
           +P G+YD VQLAS+HSTSKGVSGECGQRGGYMELVGF +E+RQ ILKLASIS+CSV+TGQ
Sbjct: 318 YP-GKYDAVQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQ 376

Query: 383 ALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLF 442
           ALVDLM+NPP++GD+SYELD  ERK IH  +K R   LY+ F +L+G+ECQ+PQGAMYLF
Sbjct: 377 ALVDLMVNPPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLF 436

Query: 443 PKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGT 502
           PKL   +  I EA +  + PDEFYCH LL+ TGICTVPGSGFGQKEGTYH+RTTFLAPG 
Sbjct: 437 PKLHFPQTLITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGN 496

Query: 503 QWIKDWETFHKAFYDKYR 520
           QW + W+ FH+ F+ KY+
Sbjct: 497 QWTEKWKLFHEEFFSKYQ 514

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/500 (67%), Positives = 406/500 (81%), Gaps = 8/500 (1%)

Query: 23  TGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNA 82
           TG+D       F PA +L  +D+N+N++ A+YAVRGAIPM+AEEL+ QL + P  LPF+ 
Sbjct: 100 TGNDD------FYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDK 153

Query: 83  ITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQ 141
           I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+  E+QLV S  +K DA KRA  L+E 
Sbjct: 154 IINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMED 213

Query: 142 IGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDS 201
           IGGSVGAYS +QGV GIR+SVA+FIT+RD+GE + P+DIFLT GAS A  YLLSI CR  
Sbjct: 214 IGGSVGAYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGP 273

Query: 202 STGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVI 261
            TG++IPIPQYPLYTA++ + NS  LPYYLDE+SGWST  EEIE  V ++I+  + P V+
Sbjct: 274 ETGVLIPIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVL 333

Query: 262 VVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQR 321
           VVINPGNPTGAVLS ++++QI  +AAKYG VV+ADEVYQ NI+ G KFHSMKK+LR+LQR
Sbjct: 334 VVINPGNPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQR 393

Query: 322 DHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTG 381
           +HP G++DNVQLAS+HSTSKGVSGECGQRGGYMEL GFS+E+RQVILKLASIS+C VVTG
Sbjct: 394 EHP-GKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTG 452

Query: 382 QALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYL 441
           QALVDLM+ PP EG++S+ELD  ER  IH  + TR   LYDTF  LEGIECQ+PQGAMYL
Sbjct: 453 QALVDLMVRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYL 512

Query: 442 FPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPG 501
           FPK+ L  KA++EA+ L L PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG
Sbjct: 513 FPKIDLPFKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPG 572

Query: 502 TQWIKDWETFHKAFYDKYRD 521
            +WIK WETFHK F+D+YRD
Sbjct: 573 LEWIKKWETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/526 (64%), Positives = 406/526 (77%), Gaps = 17/526 (3%)

Query: 12  WTTSSSKKRQHTGDDS---------------TVSGLAFEPARKLGADDLNKNIIDAEYAV 56
           W  + + +R  +G  S                 S   F PA +L  DD+N+N++ A+YAV
Sbjct: 68  WIAAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLDDVNENVLKAKYAV 127

Query: 57  RGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLD 116
           RGAIPM+AEEL+ QL + P  LPFN I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+
Sbjct: 128 RGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLN 187

Query: 117 Y-EEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETA 175
             E+QLV S  +K DA KRA  L+E+IGGSVGAYS +QGV GIR SVA+FIT+RDEGE +
Sbjct: 188 QNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQGVEGIRRSVAEFITKRDEGEIS 247

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEES 235
            P+DIFLT GAS A  YLLSI CR   TG++IPIPQYPLYTA++ + NS  LPYYLDE S
Sbjct: 248 YPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDESS 307

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
           GWST  EEIE  V ++I+  +   V+VVINPGNPTGAVLS ++IAQI  +AAKYG VV+A
Sbjct: 308 GWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367

Query: 296 DEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYME 355
           DEVYQ NI+ G KFHSMKK+LR LQR+HP G++DNVQLAS+HSTSKGVSGECGQRGGYME
Sbjct: 368 DEVYQENIFPGTKFHSMKKILRHLQREHP-GKFDNVQLASLHSTSKGVSGECGQRGGYME 426

Query: 356 LVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKT 415
           L GFS+E+RQVILKLASIS+C VVTGQALVDLM+ PP EG++S+E D  ER  IH  + T
Sbjct: 427 LTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLEGEESFESDQAERNSIHEKLIT 486

Query: 416 RGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTG 475
           R   LY TF  LEGIECQ+PQGAMYLFPK+ L  +A++EA+ L L PDEFYC +LL++TG
Sbjct: 487 RAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQEARHLELTPDEFYCKKLLESTG 546

Query: 476 ICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521
           ICTVPGSGFGQ+ GTYH+RTTFLAPG +WIK WETFHK F+D YRD
Sbjct: 547 ICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKEFFDHYRD 592

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/526 (64%), Positives = 409/526 (77%), Gaps = 17/526 (3%)

Query: 12  WTTSSSKKRQHTGDDS---------------TVSGLAFEPARKLGADDLNKNIIDAEYAV 56
           W  + + +R  +G  S                 S   F PA +L  +D+N+N++ A+YAV
Sbjct: 68  WIVAQNHRRSLSGQSSLNDLRHLNRFPHHTLKTSNNEFYPAEQLTLEDVNENVLKAKYAV 127

Query: 57  RGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLD 116
           RGAIPM+AEEL+ QL + P  LPF+ I  ANIGNPQQL QKPLT+ RQV+S+LQYP LL+
Sbjct: 128 RGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLN 187

Query: 117 Y-EEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETA 175
             E+QLV S  +K DA KRA  L+E IGGSVGAYS +QGV GIR+SVA+FIT+RDEGE +
Sbjct: 188 QNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQGVEGIRKSVAEFITKRDEGEIS 247

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEES 235
            P+DIFLT GAS A  YLLSI CR   TG++IPIPQYPLYTA++ + NS  LPYYLDE S
Sbjct: 248 YPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYPLYTATLALNNSQALPYYLDENS 307

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
           GWST  EEIE  V ++I+  + P V+VVINPGNPTGAVLS ++IAQI  +AAKYG VV+A
Sbjct: 308 GWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIA 367

Query: 296 DEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYME 355
           DEVYQ NI+ G KFHSMKK+LR LQR+HP G++DNVQLAS+HSTSKGVSGECGQRGGYME
Sbjct: 368 DEVYQENIFPGTKFHSMKKILRHLQREHP-GKFDNVQLASLHSTSKGVSGECGQRGGYME 426

Query: 356 LVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKT 415
           L GFS+E+RQVILKLASIS+C VVTGQALVDLM+ PP EG++S+E D  ER  IH  + T
Sbjct: 427 LTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLIT 486

Query: 416 RGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTG 475
           R   LY+TF  LEGIECQ+PQGAMYLFPK+ L  KA++EA+ L L PDEFYC +LL++TG
Sbjct: 487 RAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTG 546

Query: 476 ICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521
           ICTVPGSGFGQ+ GTYH+RTTFLAPG +WIK WE+FHK F+D+YRD
Sbjct: 547 ICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEFFDQYRD 592

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/489 (68%), Positives = 398/489 (81%), Gaps = 2/489 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F PA +L  DD+N+N++ A YAVRGAIPM+AEEL+ QL + P  LPFN I  ANIGNPQQ
Sbjct: 105 FYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQ 164

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152
           L QKPLT+ RQV+S+LQYP LL++ EQ LV S  +K DA KRA  L++ IGGSVGAYS +
Sbjct: 165 LQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSS 224

Query: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212
           QGV GIR+SVADFIT+RD GETA P+DIFLT GAS A TYLLSI CR   TG++IPIPQY
Sbjct: 225 QGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQY 284

Query: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272
           PLYTA++ + NS  LPYYLDE SGWST  EEIE  V ++I+  + P V+VVINPGNPTGA
Sbjct: 285 PLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGA 344

Query: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332
           VLS ++IAQI  +AAKYG VV+ADEVYQ NI+ G +F+SMKKVLR LQRDHP G++DNVQ
Sbjct: 345 VLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHP-GKFDNVQ 403

Query: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392
           LAS+HSTSKGVSGECGQRGGYMEL GFS+E+RQVILKLASIS+C VVTGQALVDLM+ PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452
            EG++S+E D  ER  IH  + TR   LY+TF  LEGIECQ+PQGAMYLFPK+ +  KAI
Sbjct: 464 VEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAI 523

Query: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512
           +EA  L L PDEFYC +LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W+K WE FH
Sbjct: 524 QEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFH 583

Query: 513 KAFYDKYRD 521
           K F+D+YRD
Sbjct: 584 KEFFDQYRD 592

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/489 (67%), Positives = 399/489 (81%), Gaps = 2/489 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F PA  L   DLN+N++ A+YAVRG+IPM+AEEL+ QL + P  LPF+ I  ANIGNPQQ
Sbjct: 72  FYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQQ 131

Query: 94  LDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152
           L+QKPL+F RQV+SILQYP +L+  EE+L++ G +KRDA +RA  +L  +GGSVGAYS +
Sbjct: 132 LNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSSS 191

Query: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212
           QGVYGIR++VADFIT RD GE A P+DIFLT GAS A +YLLSILCR   TG++IPIPQY
Sbjct: 192 QGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQY 251

Query: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272
           PLYTA++ + NS +LPYYLDEESGWST   EIE  V +SI+ G+ P V+VVINPGNPTG+
Sbjct: 252 PLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTGS 311

Query: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332
           VLS + I +I  +AAKYGIVV+ADEVYQ NI+ G +FHSMKKVLR LQ++HP G YDNVQ
Sbjct: 312 VLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHP-GIYDNVQ 370

Query: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392
           L S+HSTSKGVSGECGQRGGYMEL GF++E+RQV+LKLASIS+C VVTGQALVDLM+ PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452
           + GD+SYE D +ER+ IH  +  R  LL+DTF  LEGIECQ+P+GAMYLFP++ L  KAI
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512
           + A+ L   PDEFYC +LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WIK WE FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 513 KAFYDKYRD 521
           K FYD+YRD
Sbjct: 551 KKFYDQYRD 559

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/492 (66%), Positives = 396/492 (80%), Gaps = 2/492 (0%)

Query: 31  GLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGN 90
           G  F PA +L   DLN+N++ A+YAVRG+IPM+AEEL++QL   P  LPF+ I  ANIGN
Sbjct: 98  GKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGN 157

Query: 91  PQQLDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGSVGAY 149
           PQQL QKPL+F RQV+SILQYP +L   EQ L+ +  YKRDA  RA +LL +IGGSVGAY
Sbjct: 158 PQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAY 217

Query: 150 SLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPI 209
           S +QGVYGIR++VA+FIT RD GE A P+DIFLT    +   YLLSILC+   TG++IPI
Sbjct: 218 SASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPI 277

Query: 210 PQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNP 269
           PQYPLYTA++ + NS  LPYYLDE+SGWST  +EIE+ V D+++R + P V+VVINPGNP
Sbjct: 278 PQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNP 337

Query: 270 TGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYD 329
           TGAVL+ ++I  I  IAAKYGIVV+ADEVYQ NI  GVKF+SMKKVLR LQ+ HP G++D
Sbjct: 338 TGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHP-GKFD 396

Query: 330 NVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLML 389
           NVQLAS+HSTSKGVSGECGQRGGYMEL+GF++EVR+VILKLASIS+C VVTGQALVDLM+
Sbjct: 397 NVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMV 456

Query: 390 NPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSK 449
           +PP++GD SYE D  ER+ I + +  R   LY+TF  LEGIECQ+PQGAMYLFPKL L  
Sbjct: 457 SPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPF 516

Query: 450 KAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWE 509
           KA++EA+ L + PDEFYC  LLD TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WIK WE
Sbjct: 517 KAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWE 576

Query: 510 TFHKAFYDKYRD 521
            FHK FYD YRD
Sbjct: 577 AFHKEFYDNYRD 588

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  692 bits (1785), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 396/488 (81%), Gaps = 1/488 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F+PA KL  +DLN+N++ A+YAVRG IP KAEEL+ QL++ P  LPF+ I  ANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153
           LDQKPLTF RQV+S+LQ P +L+   +   S  YK DA  RAA LL  IGGSVGAYS +Q
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQ 164

Query: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213
           GVYG R++VADFIT+RD GE A  +DIFLT GAS A +Y+LSILCR   TG++IPIPQYP
Sbjct: 165 GVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYP 224

Query: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273
           LYTAS+ + NS  LPYYLDEES WST  EEIE+ V +SI +GV P+ +VVINPGNPTGA+
Sbjct: 225 LYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAI 284

Query: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333
           LS ++I +I  +AAKYGIVV+ADEVYQ N++ G +FHSM+KVL+ LQR H +G++DN+QL
Sbjct: 285 LSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKH-HGKFDNIQL 343

Query: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393
           AS+HSTSKGVSGECGQRGGYMEL+GFS++VRQV LKLASIS+C VVTGQALVDLM+ PP+
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453
            GD SYE D +ER EIH+ +  R  +LY+TF +LEGIECQ+PQGAMYLFP+L LS KA++
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513
           +A+ L L PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFLAPGT WIK WE FHK
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 514 AFYDKYRD 521
            FY++YRD
Sbjct: 524 KFYNEYRD 531

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/491 (64%), Positives = 405/491 (82%), Gaps = 2/491 (0%)

Query: 32  LAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNP 91
           L F+PA K+   DLN ++  AEYAVRG+IP +A+EL+ +L + P LLPF+ I  ANIGNP
Sbjct: 18  LDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNP 77

Query: 92  QQLDQKPLTFSRQVVSILQYPPLLDYE-EQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYS 150
           QQLDQKPLTF+RQV+SIL+YP +L  + E+L +   + +DA KRA  LL+ IGGSVGAYS
Sbjct: 78  QQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYS 137

Query: 151 LAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIP 210
            +QGV GIR++VADFIT RD GE A+P+DI+LT GAS AAT LLS+LC+D+ TG++IPIP
Sbjct: 138 HSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIP 197

Query: 211 QYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPT 270
           QYPLYTAS +++N+ +LPYYLDEE  WST+++EIE+ V D++++G+ P V++VINPGNPT
Sbjct: 198 QYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPT 257

Query: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330
           GAVL+ +TIA+I  IAAKYGI V++DEVYQ N++   KFHSMKKVLR LQ  +P G++DN
Sbjct: 258 GAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYP-GKFDN 316

Query: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390
           VQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSVVTGQA+VDLM+N
Sbjct: 317 VQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVN 376

Query: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450
           PP+ GD+SYE D +ER +I N M+TR  LLY+TF  LEGIECQ PQGAMYLFP+L+L  K
Sbjct: 377 PPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDK 436

Query: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510
           A  E++ LG++PDEFYC  LL++TGICTVPGSGFGQK GTYHVRTTFLAPGTQWI++W+ 
Sbjct: 437 AFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKN 496

Query: 511 FHKAFYDKYRD 521
           FH++F+++YRD
Sbjct: 497 FHQSFFNEYRD 507

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 409/495 (82%), Gaps = 2/495 (0%)

Query: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87
           T   L F+PA K+   DLN  +  AEYAVRGAIP +A+EL+ +L ++P +LPF+ I  AN
Sbjct: 14  TTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINAN 73

Query: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           IGNPQQLDQKPLTF+RQV+SIL+YP +L    ++L +   +++DA  RA  LLE IGGS+
Sbjct: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSI 133

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV GIR+SVA+FIT+RD+GE A+P++I+LT GAS AAT LLS+LC+D  TG++
Sbjct: 134 GAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLL 193

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           IPIPQYPLYTAS +++N+ +LPYYLDE S WSTK++EIE+ V D++++G+ P V++VINP
Sbjct: 194 IPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINP 253

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGAVLS DTIA+I  IAAKYGI +++DEVYQ N++ GVKFHSMKKVLR LQR +P G
Sbjct: 254 GNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYP-G 312

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
           ++DNVQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSVVTGQA+VD
Sbjct: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVD 372

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM+ PP+ GD+SY+ D  ER +I + M TR  LL++TF +LEGIECQ+PQGAMYLFP+L+
Sbjct: 373 LMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLV 432

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L +KA+ E++ LG++PDEFYC  LL++TGICTVPGSGFGQ+ GTYHVRTTFLAPGTQWI+
Sbjct: 433 LPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQ 492

Query: 507 DWETFHKAFYDKYRD 521
           DW+ FH+ F++KYRD
Sbjct: 493 DWKHFHQDFFNKYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 403/495 (81%), Gaps = 2/495 (0%)

Query: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87
           T   L F+PA KL   DLN ++  AEYAVRGAIP +AEEL+ +L +  + LPFN+I  AN
Sbjct: 14  TTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINAN 73

Query: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDYE-EQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           IGNPQQLDQKPLTF+RQV+SIL+YP +L  + ++L +   + +DA KRA  LL+ IGGSV
Sbjct: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSV 133

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV GIR++VADFIT RD GE A P+DI+LT GAS AAT LLS+LC+DS TG++
Sbjct: 134 GAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLL 193

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           +PIPQYPLYTAS ++YN+ +LPYYLDEE+ WST+++EIE+ V+D++K+G+ P V+VVINP
Sbjct: 194 LPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINP 253

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGAVL+ +TIA+I  IAAKYGI +++DEVYQ NI+  VKFHSMKK+LR LQ  HP G
Sbjct: 254 GNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHP-G 312

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
           ++DNVQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSV TGQA++D
Sbjct: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIID 372

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM+ PP+ GD+SY+ D +ER +I+N M TR  LLY+TF +LEGI+CQ+PQGAMYLFPKL 
Sbjct: 373 LMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLF 432

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L +KA+ E++ L ++PD  YC  LL++TGICTVPGSGFGQK GTYHVRTTFL PGTQWI+
Sbjct: 433 LPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQ 492

Query: 507 DWETFHKAFYDKYRD 521
           DW  FH+ F++KYRD
Sbjct: 493 DWRQFHQDFFNKYRD 507

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 396/489 (80%), Gaps = 2/489 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F PA +L   +LN N++ A+YAVRGAIPM+AEEL+IQL + P  LPF+ I  ANIGNPQQ
Sbjct: 81  FLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQQ 140

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEE-QLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLA 152
           L+QKPL+F RQV+S+LQYP +L  +E +LV SG +K+DA +RA  LL +IGG+VGAYS +
Sbjct: 141 LNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSAS 200

Query: 153 QGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQY 212
           QGVYGIR++VA+FIT+RD GE A P+DIFLT GAS A  YLLSILC+   TG++IPIPQY
Sbjct: 201 QGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQY 260

Query: 213 PLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272
           PLYTAS+ + NS  LPYYLDE+SGWST  +EIE+ V+ +  + + P V+VVINPGNPTGA
Sbjct: 261 PLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTGA 320

Query: 273 VLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQ 332
           VLS  +I  I  IAAKYGIVV+ADEVYQ N++  VKFHSMKKVLR+LQ+ HP G YD VQ
Sbjct: 321 VLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHP-GVYDMVQ 379

Query: 333 LASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPP 392
           LAS+HSTSKGVSGECGQRGGYMEL GF++EVR VILKLASIS+C VVTGQALVDLM++PP
Sbjct: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439

Query: 393 REGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAI 452
           ++GD+S+E D  ERK I + + TR   LY  F  LEGIECQ+PQGAMYLFP+L L  KA+
Sbjct: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499

Query: 453 EEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFH 512
           ++A+ L + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI+ W+ FH
Sbjct: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559

Query: 513 KAFYDKYRD 521
           + FY+ YRD
Sbjct: 560 QDFYNTYRD 568

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/489 (64%), Positives = 395/489 (80%), Gaps = 4/489 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           FEPA KL   DLN N+I AE+AVRG IPMKA+EL+ QL++ P  LPFN ITVANIGNPQ+
Sbjct: 13  FEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQE 72

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLV--TSGAYKRDAFKRAAVLLEQIGGSVGAYSL 151
           L QKPLTF+RQVVSILQYP LL+   +L   T   Y  D+F RA  LL +IGGSVGAYS 
Sbjct: 73  LHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAYSA 132

Query: 152 AQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQ 211
           +QGVYGIR+++A++IT+RD GE+ASP+DIF+T GA+ A++YLLSIL     TG+++PIPQ
Sbjct: 133 SQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPIPQ 192

Query: 212 YPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVI-DSIKRGVTPRVIVVINPGNPT 270
           YPLYTA + ++N+ MLPYYL+EESGWS    EIE+ +  +++ +G+ P+V+V+INPGNPT
Sbjct: 193 YPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGNPT 252

Query: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330
           G++LS D++ +I  IAAKYGIV++ADEVYQ N++ G KFHS KKVLRSLQ+  P  +Y+N
Sbjct: 253 GSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPT-QYNN 311

Query: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390
           VQLAS+HSTSKG+ GECGQRGGYME++GF+N+VR +ILKLA I +C VVTGQA++DLM+ 
Sbjct: 312 VQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMIL 371

Query: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450
           PP++GD SY+LD  ER++IHN+M  R   LYD F  +EGI+CQ+PQGAMYLFP+LLLS K
Sbjct: 372 PPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLSTK 431

Query: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510
            I+EAK   ++PDEFYCH LL+ TGICTVPGSGFGQK  TYH+RTTFLAPG QWI  WE 
Sbjct: 432 VIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWEK 491

Query: 511 FHKAFYDKY 519
           FHKAF  +Y
Sbjct: 492 FHKAFLKRY 500

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 404/495 (81%), Gaps = 2/495 (0%)

Query: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87
           T   L F+PA K+   DLN  +  AEYAVRGAIP +A+EL+ +L + P++LPF+ I  AN
Sbjct: 14  TAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINAN 73

Query: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           IGNPQQLDQKPLTF+RQV++IL+YP +L     +L +   + RDA +RA  LL  IGGS+
Sbjct: 74  IGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSI 133

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV GIR++VADFITRRD GE A+P+DI+LT GAS AAT LLS+LC+DS TG++
Sbjct: 134 GAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLL 193

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           IPIPQYPLYTAS +++N+ +LPYYLDEES WST ++EIE+ V D++K+ + P V++VINP
Sbjct: 194 IPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINP 253

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGAVLS +TIA+I  IAAKYGI +++DEVYQ NI+  VKFHSMKKVLR LQ  +P G
Sbjct: 254 GNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYP-G 312

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
           ++DNVQLAS+HS SKG   ECGQRGGYME++GFS E+R  + KL SISICSVVTGQA+VD
Sbjct: 313 KFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVD 372

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM+ PP+ GD+SYE D  ER +I + M+TR  LLY+TF++LEGIECQ+PQGAMYLFP+L+
Sbjct: 373 LMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLV 432

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L KKA+ E++ LG++PDEFYC  LL++TGICTVPGSGFGQ+ GTYHVRTTFLAPGT+WI+
Sbjct: 433 LPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQ 492

Query: 507 DWETFHKAFYDKYRD 521
           DW+ FH+ F+ KYR+
Sbjct: 493 DWKEFHQDFFSKYRN 507

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/487 (64%), Positives = 403/487 (82%), Gaps = 2/487 (0%)

Query: 35  EPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQL 94
           +PA KL  DD+N+N++ A+YAVRG IPM+AEEL  QL + P  LPF+ I  ANIGNPQQL
Sbjct: 44  KPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQQL 103

Query: 95  DQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQG 154
           DQKPLTF R+V+S+LQ+P LL+  ++ + +  YK D+ KRA  LL ++GGSVGAYS +QG
Sbjct: 104 DQKPLTFYREVLSLLQHPELLEEADEALQT-LYKTDSIKRAKRLLSEVGGSVGAYSQSQG 162

Query: 155 VYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPL 214
           V GIRE+VADFIT+RD+GE + P+DI+LT GAS A +Y+LSILC+  +TG++IPIPQYPL
Sbjct: 163 VQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYPL 222

Query: 215 YTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVL 274
           YTAS+ + NS  LPYYL EE  WST  EEIEQ V+D+I++G+ P  +VVINPGNPTGA+L
Sbjct: 223 YTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAIL 282

Query: 275 SFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLA 334
           S  +I +I  +AAKYGIVV+ADEVYQ N++KG KF+SMKKVLR+LQ+ + +G+YDN+QLA
Sbjct: 283 SEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTY-HGQYDNIQLA 341

Query: 335 SMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPRE 394
           S+HSTSKGVSGECGQRGGYMELVGF++++RQV LKLASIS+C VVTGQALVDLM++PP+ 
Sbjct: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401

Query: 395 GDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEE 454
           GD+SYE D +ER++IH+ +  R   L++TF +LEGIEC++PQGAMYL+PKL L  K I+E
Sbjct: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461

Query: 455 AKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKA 514
           A+ L ++PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFL PGT+W++ WE FHKA
Sbjct: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521

Query: 515 FYDKYRD 521
           F+DKYRD
Sbjct: 522 FFDKYRD 528

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/496 (65%), Positives = 394/496 (79%), Gaps = 3/496 (0%)

Query: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86
           S V G  + PA KLG  ++N+N++ A+YAVRGAIPM A EL  +L + P  LPF+ I  A
Sbjct: 41  SNVLGAVY-PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSA 99

Query: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQ-LVTSGAYKRDAFKRAAVLLEQIGGS 145
           NIGNPQ L QKPLTF RQV+S+LQYP LL+  EQ L+ S  Y++DA  RA  LL  IG S
Sbjct: 100 NIGNPQHLKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSS 159

Query: 146 VGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGI 205
           VGAYS +QG+ GIRE+VA FIT RD GE A  +DIFLT GAS A +YLLSILC+   TG+
Sbjct: 160 VGAYSTSQGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGV 219

Query: 206 MIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVIN 265
           +IPIPQYPLYTAS+ + NS  LPYYLDE+SGWST   EIE  V ++I++ + P V+VVIN
Sbjct: 220 LIPIPQYPLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVIN 279

Query: 266 PGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPN 325
           PGNPTGAVLS + I+QI  IAAKYGIVV+ADEVYQ N++ G +FHSMKK+LR LQ+ +P 
Sbjct: 280 PGNPTGAVLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNP- 338

Query: 326 GEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALV 385
           G +DNVQLAS+HSTSKGVSGECGQRGGYME+ GF+N++RQVILKLASIS+C VVTGQALV
Sbjct: 339 GVFDNVQLASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALV 398

Query: 386 DLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKL 445
           DLM++PP+ GD+SYELD +ERK IH  +  R   L+ TF  LEGIECQ+P+GAMYLFP+L
Sbjct: 399 DLMVSPPKPGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRL 458

Query: 446 LLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWI 505
           LL  KAI+ A+  G+ PD FYC +LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI
Sbjct: 459 LLPFKAIQSAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWI 518

Query: 506 KDWETFHKAFYDKYRD 521
           + WE FHKAFY++YRD
Sbjct: 519 ERWENFHKAFYEEYRD 534

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/495 (65%), Positives = 396/495 (80%), Gaps = 4/495 (0%)

Query: 30  SGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIG 89
           S   F PA ++   DLN+N++ A+YAVRG+IPM+AE+L+ QL + P  LPF+ I  ANIG
Sbjct: 98  SHYKFTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIG 157

Query: 90  NPQQLDQKPLTFSRQVVSILQYPPLLDY--EEQLVTSGAYKRDAFKRAAVLLEQIGGSVG 147
           NPQQL+QKPL+F RQV+S+LQ+P LL+   E     +  YK DA +RA  LLE IGGSVG
Sbjct: 158 NPQQLNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVG 217

Query: 148 AYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMI 207
           AYS +QGV GIR++VADFITRRD  E A P+DIFLT GAS A +YLLSI C+   TG++I
Sbjct: 218 AYSTSQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLI 277

Query: 208 PIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG 267
           PIPQYPLYTA++ + NS  LPYYLDE+SGWST  +EI+  V+D+I R + P V+VVINPG
Sbjct: 278 PIPQYPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPG 337

Query: 268 NPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIY-KGVKFHSMKKVLRSLQRDHPNG 326
           NPTGAVLS   IA+I  IAAKYGIVV+ADEVYQ NI+ + VKFHSMKKVLR LQ++HP G
Sbjct: 338 NPTGAVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHP-G 396

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
           ++D VQLAS+HSTSKGVSGECGQRGG+MEL GFS+E+RQVILKLASIS+C VVTGQALVD
Sbjct: 397 KFDEVQLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVD 456

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM++PP+EG++SYELD  ER  IH+ +  R   L++TF +LEGI+CQ+PQGAMYLFP+L 
Sbjct: 457 LMVHPPQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLN 516

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L  KA+++A+ + +  DEFYC  LL+ TGICTVPGSGFGQ  GTYH+RTTFLAPGT+WI 
Sbjct: 517 LPFKAVQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWID 576

Query: 507 DWETFHKAFYDKYRD 521
            WE FHK FY+KYRD
Sbjct: 577 LWEKFHKEFYNKYRD 591

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/495 (64%), Positives = 390/495 (78%), Gaps = 8/495 (1%)

Query: 30  SGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIG 89
           + L F PA +    D+N+ +++A+YAVRGAIPM+AEEL+ QL + P  LPFN I  ANIG
Sbjct: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144

Query: 90  NPQQLDQKPLTFSRQVVSILQYP---PLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           NPQQL QKPL+F RQV+S+LQYP   P L+   Q +     K+DA  RA  LL+ IGGSV
Sbjct: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMI----KQDAIDRAKRLLDDIGGSV 200

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV GIR++VADFIT RD+G  A P+DIFLT GAS A  YLLSI CR   TG++
Sbjct: 201 GAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVL 260

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           IPIPQYPLYTA++ + NS  LPYYL+EE+GWST  EE+E  ++DSI+  + P V+VVINP
Sbjct: 261 IPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINP 320

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGAVLS + I QI T+AAKYGI+V+ADEVYQ N+++ VKFHSMKKVLR LQ   P G
Sbjct: 321 GNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQP-G 379

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
            YDNVQLAS+HSTSKGVSGECGQRGGYMELVGF++++RQV+LKLASIS+C VVTGQALVD
Sbjct: 380 LYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVD 439

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM+ PP++G++SYE D  ER+ IH  +  R  LL+D F KL+GI CQ+PQGAMYLFPKL 
Sbjct: 440 LMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLE 499

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L  KAI+EA    + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI+
Sbjct: 500 LPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIE 559

Query: 507 DWETFHKAFYDKYRD 521
           DW  FH+ FY+K+++
Sbjct: 560 DWVDFHQEFYNKFKN 574

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/478 (63%), Positives = 377/478 (78%), Gaps = 2/478 (0%)

Query: 44  DLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSR 103
           D+N+ +++A+YAVRG IP++AEEL  +L ++P  LPFN I  ANIGNPQQLDQKPLTF R
Sbjct: 44  DVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGSLPFNKIINANIGNPQQLDQKPLTFYR 103

Query: 104 QVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVA 163
           QV+S+LQ P L++          +K DA +RA  +L+Q+GGSVGAYS +QGV G R+SVA
Sbjct: 104 QVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAGFRQSVA 163

Query: 164 DFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYN 223
           +FI  RD GE AS +DIFLT GAS A + +LS+ C  S  G +IPIPQYPLYTA++ + +
Sbjct: 164 EFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTATLALND 222

Query: 224 SVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQIL 283
           +  LPYYLDE SGWS   E++EQ V D+I++GV P  +VVINPGNPTGA+LS + I +IL
Sbjct: 223 AHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPEAIEKIL 282

Query: 284 TIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGV 343
           T+AAKY +VV+ADEVYQ N +    F SMKKVLR LQ+  P G+YDNVQLAS+HSTSKGV
Sbjct: 283 TVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEP-GKYDNVQLASLHSTSKGV 341

Query: 344 SGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDV 403
           SGECGQRGGYMELVGFS EV+QV LKLASIS+C VVTGQALVDLM+ PP++GD SYELD 
Sbjct: 342 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDASYELDR 401

Query: 404 RERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPD 463
           +ER  IHN++  +  LLY+TFQ LEG+ CQ+PQGAMYLFPKL LS+KAI +A+SLG+ PD
Sbjct: 402 QERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESLGMAPD 461

Query: 464 EFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521
           E+YC  LL+ TGICTVPGSGF Q  GTYH+RTTFLAPGT+W+  W+ FH+ F D++RD
Sbjct: 462 EYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDEHRD 519

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  639 bits (1647), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/486 (60%), Positives = 386/486 (79%), Gaps = 8/486 (1%)

Query: 36  PARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLD 95
           PA+KL  DDLNKN++ A+YAVRG+IP++AEEL++ L +    LPF+ +  ANIGNPQQL 
Sbjct: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANIGNPQQLK 93

Query: 96  QKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGV 155
           QKPLTF RQV+SILQYP LL+       S  +K+DA +RA  LL++IG SVG+YS +QG+
Sbjct: 94  QKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147

Query: 156 YGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLY 215
             IR++VA+FIT+RD+GE ++P+DIFLT GAS A  YLLSILC++  +G++IPIPQYPLY
Sbjct: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPLY 207

Query: 216 TASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLS 275
           TA++ + N+  LPYYLDE  GWST   EIE+ + DS+ +G+ P  +V+INPGNPTG++LS
Sbjct: 208 TATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267

Query: 276 FDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLAS 335
            +++ +I+ +AA +GIV++ADEVYQ N++   KFHSMKKVLR+LQ+  P GEYD VQLAS
Sbjct: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP-GEYDTVQLAS 326

Query: 336 MHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREG 395
           +HSTSKGVSGECGQRGGYMEL GF+ E++QVILKL SIS+C VVTGQALVDLM++PP++G
Sbjct: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386

Query: 396 DDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEA 455
           D+SYE D  ER  I N++  R  LL++ F  +EG+ CQ+P+GAMYLFPK+ L  K ++++
Sbjct: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446

Query: 456 KSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAF 515
           + L + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI  W  FH  F
Sbjct: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506

Query: 516 YDKYRD 521
           YDKYRD
Sbjct: 507 YDKYRD 512

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/506 (62%), Positives = 392/506 (77%), Gaps = 10/506 (1%)

Query: 15  SSSKKRQHTGDDSTVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQ 74
           S+ K R+H         L F+PA +L   DLN+N++ A+YAVRG IP +AEEL+ QL+++
Sbjct: 41  SNPKPRKHN--------LNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEK 92

Query: 75  PDLLPFNAITVANIGNPQQLDQKPLTFSRQVVSILQYPPLLD-YEEQLVTSGAYKRDAFK 133
           P+ LPF+ I  ANIGNPQQL Q+PL+F RQV+S+LQYP LL   E +  +S  YK+DA  
Sbjct: 93  PNSLPFDKIINANIGNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAIL 152

Query: 134 RAAVLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYL 193
           RA  +L+ IGGSVGAYS +QGVYGIR +VA+FIT RD GE A P+DIFLT GAS A  YL
Sbjct: 153 RAKKILKDIGGSVGAYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYL 212

Query: 194 LSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIK 253
           LSILC+   TG++IPIPQYPLYTA++ + NS  LPY+LDE +GWS    EIE  +  +++
Sbjct: 213 LSILCKGEKTGVLIPIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQ 272

Query: 254 RGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMK 313
             + P V+VVINPGNPTGAVLS + I  IL IAAKYGIVV+ADEVYQ NI+ G+KFHS+K
Sbjct: 273 DNIKPDVLVVINPGNPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVK 332

Query: 314 KVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASI 373
            VLR LQR+ P G++DNVQLAS+HSTSKGVSGECGQRGGYME++GF++EVRQVILKLASI
Sbjct: 333 GVLRRLQREIP-GKFDNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASI 391

Query: 374 SICSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQ 433
           S+C VVTGQALVDLM++PP+ G++S+ LD  +RK IH+ +  R  LL+ TF  L+GIECQ
Sbjct: 392 SLCPVVTGQALVDLMVSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQ 451

Query: 434 EPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHV 493
           +P GAMYLFPKL L  +AI+EA+ L L PDEFYC  LL+ TGICTVPGSGFGQ  GTYH+
Sbjct: 452 KPNGAMYLFPKLNLPYRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHL 511

Query: 494 RTTFLAPGTQWIKDWETFHKAFYDKY 519
           RTTFLAPG +WI  W+ FH  F +KY
Sbjct: 512 RTTFLAPGIEWIDSWKQFHIEFMEKY 537

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/495 (59%), Positives = 389/495 (78%), Gaps = 3/495 (0%)

Query: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86
           S  S + FEP   L  +DLN N+++A+YAVRG IP +A ELE QLS+ PD LPF  I  A
Sbjct: 43  SGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYA 102

Query: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           NIGNPQQL QKPL+FSR+V+S+L+ P LL    + V +  YK DA +RA  ++  +  S+
Sbjct: 103 NIGNPQQLGQKPLSFSREVLSLLESPNLLQMPME-VLNLIYKPDAVRRAKRMMRDLQTSI 161

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV G R++VA++++ RD GE AS +DIFLT GAS  A+ ++ +LC+   +G++
Sbjct: 162 GAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVL 220

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           IPIPQYPLYTA+IT+ N+V LPYYLDEESGWS   +++E+ +I+SI++GV P  +VVINP
Sbjct: 221 IPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINP 280

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGA+L  +++ +I  IAAKY IVV+ADEVYQ N+++G+KF+SMKKVLRSLQR +   
Sbjct: 281 GNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKE- 339

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
            + NVQL S+HSTSKG+SGECGQRGGYMELVGFS+++R+VILK+ASI +CS V GQALVD
Sbjct: 340 LFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVD 399

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LML+ P+ GD+SYE D+ ER  I N ++ R   L++TF  LEG+EC++PQG+MYLFP+L+
Sbjct: 400 LMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLV 459

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L +KAI+ A+SL +QPDEFYC  LL++TGICTVPGSGFGQ   T H+RTTFL PGT+WI+
Sbjct: 460 LPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIE 519

Query: 507 DWETFHKAFYDKYRD 521
            WE FHK+FYDKYRD
Sbjct: 520 SWELFHKSFYDKYRD 534

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/478 (62%), Positives = 372/478 (77%), Gaps = 2/478 (0%)

Query: 44  DLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQKPLTFSR 103
           D+N+ +++A+YAVRG IP++AEEL+ +L ++P  LPF+ I  ANIGNPQQLDQKPLTF R
Sbjct: 43  DINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKPLTFYR 102

Query: 104 QVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYGIRESVA 163
           QV+++LQ P L+           +K DA +RA  +L+Q+GGSVGAYS +QGV G RESVA
Sbjct: 103 QVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGFRESVA 162

Query: 164 DFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYN 223
           +FI  RD GE AS  DIFLT GAS A +Y+LS+ C     G +IPIPQYPLYTAS+ + N
Sbjct: 163 EFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTASLALNN 221

Query: 224 SVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQIL 283
           S  LPYYLDEESGWS   E+IE+ V DSIK+G+ P  +VVINPGNPTGA+L+ DTI  ++
Sbjct: 222 SHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDTIENVI 281

Query: 284 TIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGV 343
            +AAKY +V++ADEVYQ N +   +F SMKKVLR LQ+  P G+YDNVQLAS+HSTSKGV
Sbjct: 282 KVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP-GKYDNVQLASLHSTSKGV 340

Query: 344 SGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSYELDV 403
           SGECGQRGGYMELVGFS EV+QV LKLASIS+C VVTGQAL+DLM+ PP++GD SYE D 
Sbjct: 341 SGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASYEQDR 400

Query: 404 RERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSLGLQPD 463
           +ER +IH+ +  R  LLY  FQ +EG+ CQEPQGAMYLFPKL LS KAI +A+S GL PD
Sbjct: 401 QERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAGLAPD 460

Query: 464 EFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFYDKYRD 521
           E+YC  LL+ TGICTVPGSGFGQ  GT+H+RTTFLAPGT+WI  W+ FH+ F + +RD
Sbjct: 461 EYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDHRD 518

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/484 (60%), Positives = 373/484 (77%), Gaps = 2/484 (0%)

Query: 37  ARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLDQ 96
           A +L  +DLN N++ A+YAVRGAIP  A++L+IQL + P  LPF ++  +NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 97  KPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVY 156
           KPL+F RQV+SIL+YP LLD+E  LV S  Y  D+ +RA  LL  IG S+GAYS +QGV+
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIG-SIGAYSNSQGVH 199

Query: 157 GIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT 216
           GIR++VADFIT RD+GE A PDDIFLT GAS A + +LSILC+   TG++IPIPQYPLYT
Sbjct: 200 GIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLYT 259

Query: 217 ASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSF 276
           A++T+ ++  LPYYLDE +GWST   EI +   DS++ G+ P  +VVINPGNPTG+VL+ 
Sbjct: 260 ATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLTV 319

Query: 277 DTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASM 336
           + I  +  +AAKYG+VV+ADEVYQ+NI+ G +FHSMKK+LR LQ++ PN +YDN+QLAS+
Sbjct: 320 EAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPN-KYDNIQLASL 378

Query: 337 HSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGD 396
           HS SKG+ GECG RGGY E +GF+ EV+QVI KL+SIS+CS V GQALVDLM  PP++G+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 397 DSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAK 456
            SYELD  ER+ I  N K R   LY+ F  LEG+ CQ+PQGAMY+FP + L   AI+ A+
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 457 SLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAFY 516
           +L + PDEFYC  LL  TGICTVPGSGFGQ+ GTYHVRTTFLAPG +W+K WE FH  F+
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 517 DKYR 520
           +KYR
Sbjct: 559 EKYR 562

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/492 (60%), Positives = 373/492 (75%), Gaps = 5/492 (1%)

Query: 32  LAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNP 91
           ++F PA KL  +DLN++ + A+YAVRG+IPM+AE+L  Q+   P  LPF+ I  ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 92  QQLDQKPLTFSRQVVSILQYPPLLD---YEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGA 148
           QQ+ QKPLTF RQV+SIL+YP +L+     E+LV  G Y+RD  +RA  +L+ IGGSVGA
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGA 120

Query: 149 YSLAQGVYGIRESVADFITRRDE-GETASPDDIFLTDGASKAATYLLSILCRDSSTGIMI 207
           YS +QGV G R++VADFI +RD   + ASP+DIFLT GAS A  YLLSILC     G++I
Sbjct: 121 YSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLI 180

Query: 208 PIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG 267
           PIPQYPLYTA++T+ NS  +PYYL E + WST  +EIE  + +S+  GV P  IV+INPG
Sbjct: 181 PIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPG 240

Query: 268 NPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGE 327
           NPTGA+LS   +A I+ I+AKYGI ++ADEVYQ NI+ G +FHSM+KVL +LQ + P G 
Sbjct: 241 NPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFP-GT 299

Query: 328 YDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDL 387
           YDNVQLAS+HSTSKG  GECGQRGGYMEL+GF +EV  ++LKLASISICSVVTGQAL+DL
Sbjct: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359

Query: 388 MLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLL 447
           +  PP+ GD SY+LD  ER +I  ++  R   LY  F  LEG+ECQ PQGAMYLFPKL+L
Sbjct: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419

Query: 448 SKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKD 507
             KAIE+A  L + PDE+YC  LLD TGICTVPGSGFGQ  GTYH+RTTFL PGT+WI+ 
Sbjct: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479

Query: 508 WETFHKAFYDKY 519
           W  FH+ FY+++
Sbjct: 480 WREFHQQFYERF 491

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  617 bits (1592), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/494 (58%), Positives = 372/494 (75%), Gaps = 10/494 (2%)

Query: 36  PARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLD 95
           PA K   +D++++I+D EYA+RG IP +A+EL+ QL+  P+ LPF  I  ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 96  QKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGV 155
           Q+PLTF RQV+S+++YP L++ +  LV +  Y  DA KRA  +L  IGGSVGAYS +QG+
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 156 YGIRESVADFITRRDEGETASPD---------DIFLTDGASKAATYLLSILCRDSSTGIM 206
             IR++VA  I +RD  E    D         +IFLTDGA+ A +Y+L +  +D + G++
Sbjct: 128 LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           +PIPQYPLYTA++T+ NS +LPYYL+E+  WST  EEIE  + D+I R + P  +V+INP
Sbjct: 188 LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTGA+LS ++I QI+ IAAKYGIV++ADEVYQNNIY+  KFHS KK+L SL+  +P  
Sbjct: 248 GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK- 306

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
           +YDNVQLAS+HS SKGV+GECGQRGGY EL+GFS+E++++ILKLASI ICSVVTGQ LVD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM  PP +GD SY+LD RER  I +N+  +   LYD F +L GI CQ+PQGAMYLFP+L 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L+   I EAK   L+PDEFYC +LL+ TGICTVPGSGFGQKEGTYHVRTTFL  G +WIK
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 507 DWETFHKAFYDKYR 520
            WE FH  F ++Y+
Sbjct: 487 LWEKFHLEFMNQYK 500

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/488 (60%), Positives = 376/488 (77%), Gaps = 1/488 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F+PA KL  +DLN+N++ A+YAVRG IP +AE L+ QL   P  LPF  +  ANIGNPQQ
Sbjct: 36  FKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANIGNPQQ 95

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQ 153
           L+QKPLTF RQV+S+LQYP +LD      T   YK+DA +RA  +L  IG SVG+YS +Q
Sbjct: 96  LNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGSYSSSQ 155

Query: 154 GVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYP 213
           GV+G+R++VA++I+RRD GE A  +DIFLT GAS A +YLL+ILC+   +G++IPIPQYP
Sbjct: 156 GVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIPIPQYP 215

Query: 214 LYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAV 273
           LYTA++ + N+  LPYYL+E SGWST  EEIE  V ++I+  + PRV+VVINPGNPTGA+
Sbjct: 216 LYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGNPTGAI 275

Query: 274 LSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQL 333
           LS ++I +I  +AA +GIVV+ADEVYQ NI+ G +FHSMKKVLR LQR  P G+Y+NVQL
Sbjct: 276 LSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVP-GKYENVQL 334

Query: 334 ASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPR 393
           AS+HSTSKGVSGECGQRGGYMEL GFS E++  ILKL SIS+C VVTGQALVDLM  PP+
Sbjct: 335 ASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMTCPPK 394

Query: 394 EGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIE 453
           +G+ SYE D  ER  IH+ +  R   L+  F ++EG+ CQ+PQG+MYLFPK+ +  KA+E
Sbjct: 395 KGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPHKALE 454

Query: 454 EAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHK 513
           +A+ L + PDE YC  LL+ TGICTVPGSGFGQK GT+H+RTTFLAPGT WI  W  FH+
Sbjct: 455 KAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWREFHQ 514

Query: 514 AFYDKYRD 521
            F +KYRD
Sbjct: 515 IFCNKYRD 522

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/502 (58%), Positives = 381/502 (75%), Gaps = 12/502 (2%)

Query: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87
           T++   F PA K   +D+N++I+ AEYA+RG IP +AEEL+IQL +    LPF  I  AN
Sbjct: 2   TMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYAN 61

Query: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVG 147
           IGNPQQLDQ+PLTF RQV+S++Q+P LL  ++ L+    Y +D+ +RA  LL  IGGSVG
Sbjct: 62  IGNPQQLDQQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVG 121

Query: 148 AYSLAQGVYGIRESVADFITRRDE---------GETASPDDIFLTDGASKAATYLLSILC 198
           AYS +QGV  IR++VA FI +RD           ETAS  ++FLT GAS A  ++L +  
Sbjct: 122 AYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETAS--NVFLTAGASTAVDHILPLFA 179

Query: 199 RDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTP 258
           +D S G+++PIPQYPLYTA++T+  S +LPYYL+E + WST  ++IEQ VID+IK+ + P
Sbjct: 180 KDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKP 239

Query: 259 RVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRS 318
             +VVINPGNPTGA+L+ D+I  I+ IAA+YGIV++ADEVYQ N+Y+  +FHS KKVL  
Sbjct: 240 TTLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSE 299

Query: 319 LQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSV 378
           L++++P+ +YDNVQLAS+HS SKGV+GECGQRGGYME+ GFSN+V++V+LK+ASISICSV
Sbjct: 300 LRKNYPS-KYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSV 358

Query: 379 VTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGA 438
           VTGQ LVDLM+NPP+ GD+SYELD  ER  IH+N+  +   LYD F +L GI CQ+PQGA
Sbjct: 359 VTGQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGA 418

Query: 439 MYLFPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFL 498
           MYLFP+L LS+ AI  A  L L+PDEFYC +LL+ TGICTVPGSGFGQ  GTYH+RTTFL
Sbjct: 419 MYLFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFL 478

Query: 499 APGTQWIKDWETFHKAFYDKYR 520
            PG +WI  WE FH  F +KY+
Sbjct: 479 PPGIEWINSWEKFHLEFMEKYK 500

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/495 (60%), Positives = 371/495 (74%), Gaps = 3/495 (0%)

Query: 27  STVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVA 86
           S   G  F PA  +   D+N+N++ A+YAVRG IP +AEELE +L + P  LPF+ I  A
Sbjct: 30  SVKDGSRFVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQA 89

Query: 87  NIGNPQQLDQKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146
           NIGNPQQL QKPLTF RQV+S++Q P LL+   + +   A+K D   RA  +L+  GGSV
Sbjct: 90  NIGNPQQLGQKPLTFYRQVISLMQNPQLLEMPAEWLQQ-AFKADVVVRARRMLQDAGGSV 148

Query: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206
           GAYS +QGV G R +VA FI RRD G  A+PD+++LT GAS A + LLS  C+   TG++
Sbjct: 149 GAYSASQGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVL 207

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266
           IPIPQYPLYTA+IT  N+V LPYYL+E  GWST  +E+E+ ++DS KR + P+ +VVINP
Sbjct: 208 IPIPQYPLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINP 267

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           GNPTG+VLS   +  ILT+AAKYGIVV+ADEVYQ+N++   KFHSM+KVL++LQ   P  
Sbjct: 268 GNPTGSVLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPT- 326

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386
            Y NVQLAS+HS SKG+SGECGQRGGYMEL+GF  E+R+V +KLASIS+C VVTGQALVD
Sbjct: 327 LYKNVQLASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVD 386

Query: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446
           LM+ PP +GD SYE   +E + I++ ++ R  LL+ TF  LEGIEC  PQGA+YLFPKL 
Sbjct: 387 LMVGPPSQGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLH 446

Query: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506
           L +KAIE A+ LG+  DE YC  LLD TGICTVPG+GFGQ  GTYHVRTTFL PGT+WI+
Sbjct: 447 LPQKAIEAAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIE 506

Query: 507 DWETFHKAFYDKYRD 521
            W+ FHK FYDKYRD
Sbjct: 507 SWKDFHKKFYDKYRD 521

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 363/490 (74%), Gaps = 4/490 (0%)

Query: 34  FEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQ 93
           F P  K+   DLN  II  +YAVRG IP +AEEL++QL + P  LPFN I  ANIGNPQQ
Sbjct: 9   FTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQQ 68

Query: 94  LDQKPLTFSRQVVSILQYPPLLDYEEQLVTS---GAYKRDAFKRAAVLLEQIGGSVGAYS 150
           L QKPL+F R+V+SILQYP +L+ E +L T      Y++D  +RA  LL +IGGSVGAYS
Sbjct: 69  LGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAYS 128

Query: 151 LAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIP 210
           L+QGV GI+++VAD+IT+RD GE A P+DIFLT GAS A +++L + C   +TG++IPIP
Sbjct: 129 LSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPIP 188

Query: 211 QYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPT 270
           QYPLYTA+IT+  +  + YYL+EE  WS    E+E  + +SIK G+ P  IV+INPGNPT
Sbjct: 189 QYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNPT 248

Query: 271 GAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDN 330
           G++L+   IA I+ I+AKYG++++ADEVYQ N++ G +FHS+KKVLR LQR +  G Y+ 
Sbjct: 249 GSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKY-LGFYET 307

Query: 331 VQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLN 390
           VQLAS+HSTSKG+ GECGQRGGYMEL+G +++VR  ++KL SISICSVVTGQAL+D++++
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 391 PPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKK 450
           PPR GD+SYE+D  ER  I N++ +R   L+  F  LEG+EC  PQGAMYLFPK +  +K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 451 AIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWET 510
            I+ A+ L  + D  YC  LL+ TGICTVPGSGFGQK  TYH+RTTFL PG  WI  W  
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 511 FHKAFYDKYR 520
           FH  F ++YR
Sbjct: 488 FHTEFCERYR 497

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 49/178 (27%), Positives = 85/178 (47%), Gaps = 16/178 (8%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIP 208
           Y   QG + +R+ +A+  +  D   T S +++ LT+GA  AA +L            +  
Sbjct: 55  YGAIQGSHALRKLIAEMYSNEDV--TLSEENVILTNGAI-AANFLTHYTLAGKGDHFICI 111

Query: 209 IPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGN 268
            P Y   ++   M+ + +   +L +E+ +     E+E+ +  + K       IV+  P N
Sbjct: 112 SPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMIKPNTK------CIVLNTPNN 165

Query: 269 PTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
           P  +V+  +T+ +I  +A K+GIVV  DEVY         FHS +K  +SL +   NG
Sbjct: 166 PLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEKP-KSLCQLSANG 216

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 66/124 (53%), Gaps = 7/124 (5%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEES 235
           + D++ +T+GA   A +L+          I+   P Y   ++  +M+ + +   +L+ E 
Sbjct: 80  TADNVLITNGAI-GANFLVHYTAAGPGDHIICVDPTYQQLSSVPSMFGADVELLHLEAED 138

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
           G++   ++++ +V     R  T + IV+ NP NP G+V+S + + +I+  A +  I ++ 
Sbjct: 139 GYTPNIQKLKSKV-----RANT-KYIVLNNPNNPLGSVISTEKMTEIIDYAERNEIFIVC 192

Query: 296 DEVY 299
           DEVY
Sbjct: 193 DEVY 196

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 65/138 (47%), Gaps = 17/138 (12%)

Query: 174 TASPDDIFLTDGASKAA-TYLLSILCRDSSTGIMIP-----IPQYPLYTASITMYNSVML 227
           T  P+++ +T GA++     L+ IL ++    +  P     IP   L    + +Y  +  
Sbjct: 111 TLKPENVLVTTGANEGILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKV-VYVPINP 169

Query: 228 PYYLDEE----SGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQIL 283
           P  LD+     + W+   E+ E  + +  K       I++  P NP G V + + + +I 
Sbjct: 170 PKDLDKRVTKGTEWTLDFEQFENVITNKTK------AIIINTPHNPIGKVFTREELKRIG 223

Query: 284 TIAAKYGIVVLADEVYQN 301
            I  K+ +++++DEVY N
Sbjct: 224 DICVKHNVIIISDEVYDN 241

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 47.0 bits (110), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+ L +G+S A   ++  LC DSS  +++    +    A IT      +P  LD  +   
Sbjct: 155 DVTLANGSSDATFKIIETLC-DSSVTVLVEEFTFSPTLAIITAAGGTTVPLKLDITADPD 213

Query: 239 TKAEEIE--QQVIDSIKRGVT-----PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYG 290
            +   +E    ++D+  +G       P+++  I  G NPTG  LSF+   QI  +A K+ 
Sbjct: 214 VQGINVEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEKHD 273

Query: 291 IVVLADEVY 299
            +++ D+ Y
Sbjct: 274 FIIIEDDPY 282

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 81/329 (24%), Positives = 144/329 (43%), Gaps = 44/329 (13%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSV---MLPYYLDEES 235
           D+  T G + A   +L I C    T   I   Q+  +++SI+   +    + P  LDE  
Sbjct: 134 DVLATIGNTGAWESVLRIFCNRGDT---ILAEQF-AFSSSISAAEAQGVNVFPIPLDEHG 189

Query: 236 GWSTKAEEIEQQVIDSIKRGVT-PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVV 293
              +K E I    +D+   G   P+++  +  G NPTG+ LSFD   +I  IA K+  ++
Sbjct: 190 IIPSKLETI----LDNWTEGAAKPKLLYTVPTGQNPTGSSLSFDRKEEIYRIAQKHDFII 245

Query: 294 LADEVY------------QNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSK 341
           + DE Y             N + K    H  K+ +++L++   + + +  ++  + S SK
Sbjct: 246 IEDEPYYFLQMEKYEKDPANRVVKSYADH--KEFIQNLEKSFVSIDTEG-RVLRLDSLSK 302

Query: 342 GVSGECGQRGGYMELVGFSNEVRQVILKLASISI-CSVVTGQALVDLMLNPPREGDDSYE 400
            ++   G R G+  +VG + ++   IL L  ++I       Q+++   +N  R G + Y 
Sbjct: 303 VLA--PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGFTQSIIAGTMN--RWGQEGY- 354

Query: 401 LD--VRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEAKSL 458
           LD  +  R E           LY    +++ I+   P   M+    +  SK   E A   
Sbjct: 355 LDWLIGLRHEYTKKRDCCIDALYKYLPQVDYIKINPPIAGMFFTVNIDASKHP-EFATKY 413

Query: 459 GLQPDEFYCHRLLD---TTGICTVPGSGF 484
           G  P++     + D    +G+  VPG+ F
Sbjct: 414 GSDPEKVE-KAIFDRSIASGVLVVPGNWF 441

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 65/124 (52%), Gaps = 8/124 (6%)

Query: 178 DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEES 235
           D++ L  G+ ++   L+   C  +   I+I    Y +YT  + +     V +P  L EE 
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
            +       E++++++++   + +++ + +PGNPTG  +  + I +IL+   + G+VV+ 
Sbjct: 148 KFQID----EEKILETLQNDPSIKLVFITSPGNPTGTFIDVNRIEKILS-QWQTGLVVV- 201

Query: 296 DEVY 299
           DE Y
Sbjct: 202 DEAY 205

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/162 (24%), Positives = 79/162 (48%), Gaps = 14/162 (8%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPD--DIFLTDGASKAATYLLSILCRDSSTGIM 206
           YS  QG+  + + +  FIT+ +     +    DI L +G+S +   +   LC +S+T +M
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLCDESTTVLM 196

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIE--QQVIDS------IKRGVTP 258
                 P+  +++    +  +P  L+    +  +  +IE  + ++D+       K    P
Sbjct: 197 EEFTFVPV-ISNVMATGAKCIPLKLN--LNYEDQGIDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 259 RVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           +++  I+ G NP G  LS +   +I TIA ++ +++L D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/188 (26%), Positives = 81/188 (43%), Gaps = 25/188 (13%)

Query: 169 RDEG-ETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLY--TASITMYNSV 225
           R+EG    +  +I L  G+ ++   ++   C      +M+  P Y +Y   A I     V
Sbjct: 78  REEGLAPLTAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYV 137

Query: 226 MLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTI 285
            +P    + S    +   +EQ  +D      + +V+ + +PGNPTGA +    + ++L  
Sbjct: 138 EVPLISSDNSFQIDEDRILEQLNLDK-----SIKVVFITSPGNPTGACIEVGRVEKLLR- 191

Query: 286 AAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSG 345
               GIVV+ DE Y       + F + K  L  L   HPN       L  + + SK  SG
Sbjct: 192 NWTAGIVVV-DEAY-------IDFSADKPSLSPLVNKHPN-------LVVLQTLSKA-SG 235

Query: 346 ECGQRGGY 353
             G R G+
Sbjct: 236 LAGIRLGF 243

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 78/167 (46%), Gaps = 20/167 (11%)

Query: 146 VGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAA-TYLLSILCRDSSTG 204
           V  YS  +G   +  S+ D  T     E  + +++ +T GA++   + L+ +L  +S   
Sbjct: 85  VNQYSPTRGRPSLINSLIDLYTPIYNKELKA-ENVVVTTGANEGILSCLMGLL--NSGDE 141

Query: 205 IMIPIPQYPLYTASITM------YNSVMLPYYLDEESG----WSTKAEEIEQQVIDSIKR 254
           +++  P +  Y  +I +      Y  +  P  LD+ +     W+   E+ E+ +    K 
Sbjct: 142 VIVFEPFFDQYIPNIELCGGKVVYVPINPPKELDQRNTRGEEWTIDFEQFEKAITSKTK- 200

Query: 255 GVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
                 +++  P NP G V + D +  +  I  K+ +V+++DEVY++
Sbjct: 201 -----AVIINTPNNPIGKVFTHDELTTLGNICVKHNVVIISDEVYEH 242

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/150 (23%), Positives = 71/150 (47%), Gaps = 31/150 (20%)

Query: 172 GETASPDDIFLTDGASKAATYLL---------SILCRDSSTGIMIPIPQYPLYTASITMY 222
           G   + D++ +T+GA  AA +L+          ++C D +   +  +P+  ++ A +++ 
Sbjct: 73  GPEFNKDNVLVTNGAI-AANFLIYYTLVGPGDHVICVDPTYAQLYSVPK--MFGAEVSLL 129

Query: 223 NSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQI 282
                   L +E G+    E +++ +  + K      +I++ NP NP G+ +S +T+  I
Sbjct: 130 K-------LQKEDGFIPNIETLKKMIKSNTK------LIIINNPNNPLGSAISTETLNDI 176

Query: 283 LTIAAKYGIVVLADEVYQNNIYKGVKFHSM 312
             +  +  I +  DEVY+        FHSM
Sbjct: 177 CQLCEENNIYLHCDEVYK------PIFHSM 200

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 24/179 (13%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDE 233
           S D++ L  G+ ++   L+   C      I+I  P Y +Y+  A I     + +P  +++
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 234 ESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVV 293
            S           +VI++++     ++  V +PGNPTGA++   +I +IL+   + GIV 
Sbjct: 146 NSFQMNT-----DKVIETLQGDSNIKIAFVTSPGNPTGALIDIASIEKILS-QWQSGIVA 199

Query: 294 LADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGG 352
           + DE Y       + F S       L   +PN       LA + + SK   G  G R G
Sbjct: 200 I-DEAY-------IDFCSTGGSAAPLVNKYPN-------LAVLQTLSKSF-GLAGVRLG 242

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 62/124 (50%), Gaps = 9/124 (7%)

Query: 178 DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEES 235
           ++I L  G+ ++   L+ + C  S   IMI  P Y +Y+  A I     V +P   ++ S
Sbjct: 88  ENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAEDNS 147

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
                +     +V++++ +  T ++I + +PGNPT A++    I ++L      G +V+ 
Sbjct: 148 FQMDTS-----KVLETLAQDPTIKLIFITSPGNPTAALIDTAEIEKVLN--NWTGGLVVV 200

Query: 296 DEVY 299
           DE Y
Sbjct: 201 DEAY 204

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 73/152 (48%), Gaps = 9/152 (5%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIP 208
           Y   +G   +R  VA   +  D+      D++ +T+GA   A +L+S         ++  
Sbjct: 55  YGAIKGSDELRSLVASLYS--DKEVKLDKDNVLITNGAI-GANFLVSYTLAGPGDHVICV 111

Query: 209 IPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGN 268
            P Y   ++   M+ + +    L+ E+ +     +++     S+ +G T + IV+ NP N
Sbjct: 112 DPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLK-----SMIKGNT-KCIVLNNPNN 165

Query: 269 PTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300
           P G+V+   T+ +I  +A K  I V+ DEVY+
Sbjct: 166 PLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 89/190 (46%), Gaps = 27/190 (14%)

Query: 168 RRDEGETAS-PD----DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASIT 220
           R  +  TA+ PD    ++ L  G+ +    L+   C+ +   IM+  P Y +Y+  A+I 
Sbjct: 70  RNSKDNTANVPDLSHKNLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANIN 129

Query: 221 MYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIA 280
             + V  P  +++ S          ++ ++++K+    R++ + +PGNPTG +++   I 
Sbjct: 130 DVDVVNCPLIVEDNSFQMDV-----KRTLETLKKDDLIRLLFITSPGNPTGKIIAIKDII 184

Query: 281 QILTIAAKYGIVVLAD-----EVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLAS 335
            +L    K G+VV+ +       Y N   K  ++ S+ K++          +Y N+ +  
Sbjct: 185 YVLE-HWKNGLVVVDEAYVDFSTYFNEETKKTEYFSVAKLV---------TKYPNLTVLQ 234

Query: 336 MHSTSKGVSG 345
             S S G++G
Sbjct: 235 TLSKSFGLAG 244

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 74/161 (45%), Gaps = 28/161 (17%)

Query: 148 AYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKA---ATYLL-----SILCR 199
           +Y   +G   +R S+A        G   + DDI LT+GA  A   A Y L      ++C 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGANFLAFYTLVGAGDHVICV 108

Query: 200 DSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPR 259
           + +   +  +P+  ++ A + +         L +E  +    + ++  + ++ K      
Sbjct: 109 EPTYSQLYSVPE--MFGAEVDLLT-------LKKEDDFLPNLQTLKSMIKNNTK------ 153

Query: 260 VIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300
           +I++ NP NP G+V+  D + QI  +  +  I + +DEVY+
Sbjct: 154 LIIINNPNNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR 194

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 81/364 (22%), Positives = 149/364 (40%), Gaps = 59/364 (16%)

Query: 146 VGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAA-TYLLSILCRDSSTG 204
           V  YS  +G   + ES+    +     E  + +++ +T GA++   + L+ IL       
Sbjct: 84  VNQYSPTRGRVSLLESLIKLYSPLYNAELKA-ENVTVTTGANEGILSCLMGILNPGDEVI 142

Query: 205 IMIP-----IPQYPLYTASITMYNSVMLPYYLDEE----SGWSTKAEEIEQQVIDSIKRG 255
           +  P     IP   L    + +Y  +  P  +D+     + W+   E+    + D  K  
Sbjct: 143 VFEPFFDQYIPNIELLGGKV-VYVPINPPKDMDQRVVKGTEWTVDYEQFANAITDKTK-- 199

Query: 256 VTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKV 315
                +++  P NP G V + + + +I  I  K  +V+++DEVY+ ++Y    F  +  +
Sbjct: 200 ----AVIINTPHNPIGKVFTREELTRIGEICVKKNVVIISDEVYE-HLYFTDSFTRIATL 254

Query: 316 LRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISI 375
                    + E   + L S+ S  K  +   G R G++  V  + E+   + K A   I
Sbjct: 255 ---------SPEIGQLTL-SVGSAGKSFAA-TGWRVGWV--VSLNPELLSYVSK-AHTRI 300

Query: 376 CSVVTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQ---KLEGIEC 432
           C   +   L + + N     +D+ E++  E      NM+      YD F    K  G+  
Sbjct: 301 C-FASPSPLQEAVAN---SINDALEINYFE------NMRQEYKHKYDIFTSVFKELGLPY 350

Query: 433 QEPQGAMYLFPKLLLSKKAIEEAKSLGLQPDEF--------YCHRLLDTTGICTVPGSGF 484
            EP+G  ++   +  SK  I E  S    P+E           + L++  G+  +P + F
Sbjct: 351 TEPEGTYFIL--VDFSKVKIPEGYSY---PEEIANKAKDFRIAYWLINELGVVAIPPTEF 405

Query: 485 GQKE 488
             KE
Sbjct: 406 YIKE 409

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 67/136 (49%), Gaps = 17/136 (12%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTG--IMIPIPQYPLYTASITM------YNSVML 227
           +P+++ +T GA++    +LS L    + G  +++  P +  Y  +I +      Y  +  
Sbjct: 114 TPENVLVTTGANEG---ILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP 170

Query: 228 PYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRV-IVVIN-PGNPTGAVLSFDTIAQILTI 285
           P  LD      TK  E      D   R +TP+   V+IN P NP G V + + + ++  I
Sbjct: 171 PKELDNRV---TKGTEWTVD-FDEFTRAITPKTKAVIINTPHNPIGKVFTREELTKLGNI 226

Query: 286 AAKYGIVVLADEVYQN 301
             +  ++++ADEVY++
Sbjct: 227 CVENNVIIIADEVYEH 242

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 78/160 (48%), Gaps = 12/160 (7%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAA-TYLLSILCRDSSTGIMI 207
           YS  +G   + +++AD  T    G+  S D+I +  GA++A  + L+ +L +     +  
Sbjct: 77  YSPTRGRPNLIKALADLYTPL-YGQQLSADNITVHTGANEAIFSCLMGLLNKGDEVIVFE 135

Query: 208 PIPQYPLYTASITM------YNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVI 261
           P   +  Y ++I +      Y  +  P  LD+     T+ E I+  +++      T + +
Sbjct: 136 PF--FDQYISNIELAGGVVRYVPINPPRELDDRVTRGTEWE-IDWDILEKTINSRT-KCV 191

Query: 262 VVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           ++  P NP G V + + + ++  I     IV+++DEVY++
Sbjct: 192 IINTPHNPIGKVFTREELLRLGKICVDNNIVIISDEVYEH 231

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 119/288 (41%), Gaps = 40/288 (13%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVML---PYYLDEES 235
           DI  T G+++A    L I C    T ++    +   Y++S+   ++  L   P  +D + 
Sbjct: 133 DIITTTGSTQAWDASLRIFCNKGDTVLL----EEFTYSSSVEAADAQGLNCIPVPMDNQG 188

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVL 294
               K EE+     D       P+++  I  G NPTG  LS      I  +A KY I+++
Sbjct: 189 IIPEKLEEMLSNWTDRYPGIPMPKLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIV 248

Query: 295 ADEVY------------------QNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASM 336
            D+ Y                  Q+ + + +K  +  + ++SL R   + + D  ++  +
Sbjct: 249 EDDPYYFLQMGTYVSPDKRETDEQDIVTQELK-QNHGEFVKSLSRSFLDLDRDG-RVVRL 306

Query: 337 HSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVV-TGQALVDLMLNPPREG 395
            S SK  +  C  R G+  +VG S  +      L  +SI S     Q+++  +LN  R G
Sbjct: 307 DSMSKTFAPGC--RLGW--IVG-SKHLLDNYWNLHEVSIQSTCGFAQSILGGLLN--RWG 359

Query: 396 DDSYELDVRERKEIHNNMKTRGYLLYDTFQKL--EGIECQEPQGAMYL 441
            D Y   + E +  H     R + L   ++ L  E +    P   M+ 
Sbjct: 360 QDGYTNWLIELR--HEYTLKRNWCLDSCYRHLPQELVTLSPPSAGMFF 405

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 66/332 (19%), Positives = 139/332 (41%), Gaps = 46/332 (13%)

Query: 172 GETASPDDIFLTDGASKAATYLLSILCRDSSTG--IMIPIPQYPLYTASITM------YN 223
           G     +++ +T GA++    +LS L    + G  +++  P +  Y ++I +      Y 
Sbjct: 111 GSELKQENVTITTGANEG---ILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYV 167

Query: 224 SVMLPYYLD----EESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTI 279
            +  P  LD    E + W+   E+ +  +    K       +++  P NP G V + + +
Sbjct: 168 PINPPKELDQRVTEGTEWTVDMEQFKNAITSKTK------AVIINTPHNPIGKVFTREEL 221

Query: 280 AQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHST 339
            QI  I  +  +++++DEVY+ ++Y   +F  +  +   +            QL     +
Sbjct: 222 LQIGNICVEKNVIIISDEVYE-HLYFTDEFTRIATLSPEIG-----------QLTLTVGS 269

Query: 340 SKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREGDDSY 399
           +       G R G++  +  ++E+ Q + K A   IC   +   L +   N   +  +S 
Sbjct: 270 AGKTFAATGWRIGWV--ISLNSELLQYVSK-AHTRIC-FASPSPLQEACANSINDALESN 325

Query: 400 ELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYL---FPKLLLSKKAIEEAK 456
             + + R+E     K    +    F++L G+   +P+G  ++   F K+ + +      +
Sbjct: 326 YFE-KMRQEYIQKFK----IFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKE 379

Query: 457 SLGLQPDEFYCHRLLDTTGICTVPGSGFGQKE 488
            L    D    H L++  G+  +P + F  KE
Sbjct: 380 ILNKGKDFRISHWLINELGVVAIPPTEFYIKE 411

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 69/161 (42%), Gaps = 26/161 (16%)

Query: 142 IGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDS 201
           I GS    +L  G+YG++                S D++ +T+GA   A +LL       
Sbjct: 59  IKGSKDLRTLIAGLYGVQ---------------FSADNVLVTNGAI-GANFLLYYTLVGK 102

Query: 202 STGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGV--TPR 259
              ++   P Y    +   M+ + +    L E+  +           +D++K+ +    +
Sbjct: 103 GDHVICVHPTYSQLYSVPKMFGAEVTLLELSEKDSFLPN--------LDTLKKAIKSNTK 154

Query: 260 VIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300
           +I++ NP NP G V+S + +  I  +  +  + +  DEVY+
Sbjct: 155 LIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR 195

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 82/177 (46%), Gaps = 24/177 (13%)

Query: 178 DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEES 235
           +++ L  G+ +    L+   C      I+I  P Y +Y+    I     V +P  + E++
Sbjct: 88  ENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVV-EDN 146

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
            +    E    +VI++++   + +++ + +PGNPTGA++  + I ++L+   + G VV+ 
Sbjct: 147 SFQMDTE----KVIETLQNDPSIKLVFITSPGNPTGALIKPENIEKLLS-QWQSGFVVV- 200

Query: 296 DEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGG 352
           DE Y       + F +    +  L   +PN       LA + + SK   G  G R G
Sbjct: 201 DEAY-------IDFCTTGGSVAPLVNKYPN-------LAVLQTLSKSF-GLAGIRLG 242

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 120/281 (42%), Gaps = 35/281 (12%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSV-----MLPYYLDE 233
           D+  T G + A    L + C    T +         Y+ S ++Y +      + P  LDE
Sbjct: 135 DVLATAGNTNAWESTLRVFCNRGDTILA------EAYSFSSSLYAAEAQGVNVFPVPLDE 188

Query: 234 ESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIV 292
              +    E++E  + +       P+++  I  G NPTG+ LS D  A+I  IA K+  +
Sbjct: 189 ---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKAKIYRIAQKHNFI 245

Query: 293 VLADEVY---QNNIY-------KGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKG 342
           ++ DE Y   Q   Y       +   + S  + ++SL +   + + D  ++  + S SK 
Sbjct: 246 IIEDEPYYFLQMEPYVKDASAREKKTYSSHDEFIQSLAKSFISLDTDG-RVVRLDSFSKV 304

Query: 343 VSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVT-GQALVDLMLNPPREGDDSY-E 400
           ++   G R G+  +VG S ++ +  L+L  ++I +     Q+LV   LN  R G D Y +
Sbjct: 305 LA--PGTRLGW--IVG-SKKILEPYLRLHEMTIQAPSGFTQSLVAGTLN--RWGQDGYVD 357

Query: 401 LDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYL 441
             +  R E  +        LY    K   I+   P   M+ 
Sbjct: 358 WLIGLRHEYTHKRDVAIDALYKYLPKGSFIKINPPIAGMFF 398

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 7/123 (5%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+  T G + A    L + C D    I+     +    A+      +  P  +DE     
Sbjct: 132 DVVATTGNTNAWESTLRVFC-DKGDVILAEAHSFSSCLAAAQAQGIITFPIPIDEHGIIP 190

Query: 239 TKAEEIEQQVIDSIKRGV-TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
            K E    Q++D+   G   P+++  I  G NPTG+ LS D   +I  +A K+  +++ D
Sbjct: 191 EKLE----QILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIED 246

Query: 297 EVY 299
           E Y
Sbjct: 247 EPY 249

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 84/189 (44%), Gaps = 21/189 (11%)

Query: 162 VADFITRRDEGETASP---DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT-- 216
           +A F  R D+     P   D++ L  G+ +    L+   CR     I+   P Y +Y+  
Sbjct: 66  LAGFRNRLDKTPGIEPLTEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVC 125

Query: 217 ASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSF 276
           A+I     V  P  + E++ +     E    V+ ++K     +++ + +PGNPTG +++ 
Sbjct: 126 ANINDVEIVECPL-ITEDNSFQMNVPE----VLSTLKNDPKIKLLFITSPGNPTGKLVNK 180

Query: 277 DTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASM 336
             I  IL      G+VV+ DE Y +        +SM K++          +Y N+ +   
Sbjct: 181 KDIEFILENWTN-GLVVV-DEAYIDFADAEGTTYSMAKLVT---------KYPNLTVLQT 229

Query: 337 HSTSKGVSG 345
            S S G++G
Sbjct: 230 LSKSFGLAG 238

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 63/129 (48%), Gaps = 9/129 (6%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+ L +G+S +   L   L  D +T +++    +    ++IT   +  +P  L+  S  S
Sbjct: 141 DLLLANGSSDSMFKLFDTLT-DETTTVLVEEFTFSPVLSNITATGASCVPLQLNFTSNPS 199

Query: 239 TKAEEIE--QQVIDSIKRGV-----TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYG 290
            +   +   Q ++++ + G       P ++  I+ G NPTG  +S +  A+I  +A KY 
Sbjct: 200 NQGINVTYLQHLLENWQSGPYKHLNRPSILYTISTGQNPTGLTISMENRARIYKLAQKYN 259

Query: 291 IVVLADEVY 299
            +++ D+ Y
Sbjct: 260 FLIVEDDPY 268

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 233 EESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIV 292
           E + W    E +     D  K      ++++ NP NP G V + D + ++ T+    G  
Sbjct: 163 EANDWILDRETLRAAFTDKTK------LMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 293 VLADEVYQ 300
           ++ADEVY+
Sbjct: 217 IIADEVYE 224

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 34/54 (62%), Gaps = 2/54 (3%)

Query: 250 DSIKRGVTPRV--IVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           D ++  +TP+   +++  P NP G V + + + +I  I  K+ +V+++DEVY++
Sbjct: 188 DELEAAITPKTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISDEVYEH 241

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 80/333 (24%), Positives = 125/333 (37%), Gaps = 49/333 (14%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           DI LT G +      L + C      I+     +    AS         P  +DE     
Sbjct: 132 DIILTTGNTNGWESTLRVFCNKGDV-ILAEAHSFSSSLASAEAQGITTFPIPIDEHGIIP 190

Query: 239 TKAEEIEQQVIDSIKRGV-TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
            K EEI    +D+   G   P+++  I  G NPTG  L+ +   +I  IA K+  +++ D
Sbjct: 191 EKLEEI----LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIED 246

Query: 297 EVYQNNIYKGVKFHSMKKVLRSLQ-----RDHPNGEYDNVQLASMHSTSKGVSGEC---- 347
           E Y         F  M + +  L      +D P   +D   L S+  T   V  E     
Sbjct: 247 EPYY--------FLQMGEYIADLDERKKVQDVPKPTHDQF-LGSLAKTFLSVDTEGRVIR 297

Query: 348 ----------GQRGGYMELVGFSNEVRQVILKLASISICSVVT-GQALVDLMLNPPREGD 396
                     G R G+  L G S ++ Q  + L  +++ +     Q+LV+ +L   R G 
Sbjct: 298 MDSFSKVLAPGSRLGW--LTG-SKKLLQPYISLHEMTVQAASGFTQSLVNGLLQ--RWGQ 352

Query: 397 DSY-ELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEA 455
           D Y +  +  R E           LY+   K E  +   P   M+    +  S     E 
Sbjct: 353 DGYIDWLIGLRHEYTLKRDNAIDALYEYAPKHEAFKINPPIAGMFFTINIDASIHPEFET 412

Query: 456 KSLGLQPD----EFYCHRLLDTTGICTVPGSGF 484
           K    Q +    E Y +  +  +G+  VPG+ F
Sbjct: 413 K---FQSNPAMVEQYIYDKVVRSGVLVVPGAWF 442

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/135 (21%), Positives = 65/135 (48%), Gaps = 19/135 (14%)

Query: 178 DDIFLTDGASKAA-TYLLSILCRDSSTGIMIPIPQYPLYTASITM------YNSVMLPYY 230
           +++ +T GA++   + L+ +L  +S   +++  P +  Y  +I +      Y  +  P  
Sbjct: 132 ENVTVTTGANEGILSCLMGLL--NSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 231 LDEESG----WSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIA 286
           LD+ +     W+   E+ E  +    K       +++  P NP G V + + +  +  I 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITSKTK------AVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 287 AKYGIVVLADEVYQN 301
            K+ +V+++DEVY++
Sbjct: 244 VKHNVVIISDEVYEH 258

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 34/65 (52%), Gaps = 6/65 (9%)

Query: 237 WSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
           W+   E+ E+ +    K       +++  P NP G V + + +  +  I  K+ +V+++D
Sbjct: 184 WTIDFEQFEKAITSKTK------AVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISD 237

Query: 297 EVYQN 301
           EVY++
Sbjct: 238 EVYEH 242

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 38.9 bits (89), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%), Gaps = 4/61 (6%)

Query: 245 EQQVID--SIKRGVTPRVIVVI--NPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ 300
           E+  ID    ++ +TP+   VI   P NP G V + + +  +  I  K+ +++++DEVY+
Sbjct: 182 EEWTIDFEQFEKAITPKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVIIISDEVYE 241

Query: 301 N 301
           +
Sbjct: 242 H 242

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 38.9 bits (89), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 250 DSIKRGVTPRV--IVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           D ++  +TP+   +++  P NP G V + + + QI  I  +  +V+++DEVY++
Sbjct: 188 DELRAAITPKTKALILNTPHNPVGKVFTREELLQIGQICVENNVVIISDEVYEH 241

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 8/125 (6%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVML---PYYLDEES 235
           DI  T G+++     L I C    T   + + +Y  Y++S+   ++  L   P  LD E 
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDT---VLLEEY-TYSSSVEAADAQGLNCIPMPLDGEG 187

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVL 294
               K EE+     D       P+++  I  G NPTG  LS      I  +A KY ++++
Sbjct: 188 IIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIII 247

Query: 295 ADEVY 299
            DE Y
Sbjct: 248 EDEPY 252

>TBLA0B08080 Chr2 complement(1935332..1936666) [1335 bp, 444 aa]
           {ON} Anc_8.204 YER152C
          Length = 444

 Score = 38.5 bits (88), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 78/179 (43%), Gaps = 30/179 (16%)

Query: 148 AYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDS--STGI 205
            Y   +G   +R+ V + I +      + P+ I LT GAS     +L+IL + +   TG 
Sbjct: 50  TYGSDEGALWVRQEVCNMINQIGSDINSKPEYINLTSGASYG---ILNILLQTTLPHTGY 106

Query: 206 ----MIPIPQYPL---------YTASITM-----YNSVMLPYYLDEESGWSTKAEEIEQQ 247
                I  P Y L         + + +T      Y S+ L Y  ++   +  +  ++ Q 
Sbjct: 107 TKQAFIVSPTYFLINDCFIDAGFGSKMTAIKEKGYTSIDLEYLKEKLEYFEQEIPDVPQN 166

Query: 248 VID------SIKRGVTPRVIVVI-NPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
             D      ++++ +   V   I    NP+G    ++T  Q++ IA KY ++++ D+VY
Sbjct: 167 STDIIQNKNNLQKKIYKYVFYCIPTFSNPSGITWDYETRIQLIKIAKKYDMLIICDDVY 225

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 97/238 (40%), Gaps = 29/238 (12%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVML---PYYLDEES 235
           DI  T G+++     L I C    T ++    +   Y++S+   ++  L   P  LD E 
Sbjct: 132 DIITTTGSTQGWDASLRIFCNKGDTVLL----EDYTYSSSVEAADAQGLNCVPMPLDGEG 187

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVL 294
              +K EE+             P+++  I  G NPTG  LS +    I  +A +Y I+++
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIII 247

Query: 295 ADEVY---QNNIYKG---------VKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKG 342
            D+ Y   Q + Y               S    + SL R     + D  ++  + S SK 
Sbjct: 248 EDDPYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDG-RVVRLESVSKT 306

Query: 343 VSGECGQRGGYMELVGFSNEVRQVILKLASISICSVV-TGQALVDLMLNPPREGDDSY 399
            +  C  R G+  LVG S  +      L  +SI S     Q ++  +LN  R G D Y
Sbjct: 307 FAPGC--RMGW--LVG-SKHLLDNYWNLHEVSIQSTCGFAQTILSGILN--RWGQDGY 357

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 36/147 (24%), Positives = 69/147 (46%), Gaps = 12/147 (8%)

Query: 158 IRESVADFITRRDEGETASP---DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPL 214
            + ++A++  R    +  +P   +++ L  G+ ++   ++   C      IM   P Y +
Sbjct: 62  FKTAMANYRNRTSSFKDITPLTAENLCLGVGSDESIDAIIRATCVPGKEKIMAMPPTYGM 121

Query: 215 YT--ASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGA 272
           Y+  AS+     V  P    + S +    E     V+D++K+    +++ + +PGNPTGA
Sbjct: 122 YSVCASVNDVEIVKCPLVTSDNS-FQVDTE----AVLDTLKKDPLIKLVFITSPGNPTGA 176

Query: 273 VLSFDTIAQILTIAAKYGIVVLADEVY 299
            +    I +IL      GI+V+ DE Y
Sbjct: 177 KIETSRIEKILQ-NWDQGILVV-DEAY 201

>CAGL0G06028g Chr7 complement(579261..580874) [1614 bp, 537 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137w ARO9 aromatic amino acid aminotransferase II
          Length = 537

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 71/161 (44%), Gaps = 12/161 (7%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPD--DIFLTDGASKAATYLLSILCRDSSTGIM 206
           Y+   G+  IR + A ++  +      S D  D+ L+ G+  +        C + ST +M
Sbjct: 125 YNEVPGLPQIR-NFAKYLVNKINKPAYSADQWDVLLSSGSCDSMFKFFECFCDEKSTVLM 183

Query: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIE--QQVIDSIKRGV-----TPR 259
                 P+  + +    +  +P  ++     ST+  +++   Q++D+   G       PR
Sbjct: 184 EEFTFTPV-ISHVKATGAECIPLKMNLTKDPSTQGIDVDYLTQLLDNWSSGPYKHLNKPR 242

Query: 260 VIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           ++  I  G NPTG  +  +   +I  +A K+  ++L D+ Y
Sbjct: 243 ILYTICTGQNPTGVTIPMENRRKIYELAHKHNFLILEDDPY 283

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 169 RDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVM 226
           +D  +  + +++ L  G+ ++   ++   C  +   I++  P Y +Y+  A I     V 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 227 LPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIA 286
            P    + S  +   E     VI + +   + ++I + +PGNPTGA +    I +IL   
Sbjct: 138 CPLITSDNSFQANTDE-----VIKTAQNDPSIKLIFITSPGNPTGAKVETSRIEKILQNW 192

Query: 287 AKYGIVVLADEVY 299
            + G+VV+ DE Y
Sbjct: 193 DR-GMVVV-DEAY 203

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 37.7 bits (86), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 46/233 (19%), Positives = 99/233 (42%), Gaps = 25/233 (10%)

Query: 259 RVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRS 318
           + +++  P NP G V +   + ++  +  ++  VV++DEVY+ ++Y    F  +  +   
Sbjct: 189 KAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVVISDEVYE-HLYFTESFPRIANI--- 244

Query: 319 LQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSV 378
                 N +  N+ L ++ S  K  +   G R G+  ++  ++++   + K A   IC  
Sbjct: 245 ------NEDIANLTL-TVGSAGKSFAA-TGWRIGW--IISKNDQLLNYVSK-AHTRICFA 293

Query: 379 VTGQALVDLMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGA 438
                     L     G   + L +    ++    + +  +L   F KL G+   +P+G 
Sbjct: 294 SPSP------LQEACAGSIEHALKIDYFPKMREEYRKKFEILTTAFDKL-GLNYTQPEGT 346

Query: 439 MYL---FPKLLLSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKE 488
            ++   F K+ + +  +   + L    D    + L++  GI  +P + F  KE
Sbjct: 347 YFILVDFSKVKIPEDYVYPEELLEKAKDFRISYWLINEIGIVAIPPTEFYIKE 399

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 37.7 bits (86), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 81/181 (44%), Gaps = 19/181 (10%)

Query: 149 YSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIP 208
           YS  +G   + +S+ DF +     ET +  ++ +T GA++     L  L       I+  
Sbjct: 88  YSPTRGRPSLLKSLTDFYSP-IYNETLNESNVTITTGANEGILASLVGLLNPGDEVIVFE 146

Query: 209 IPQYPLYTASITM------YNSVMLPYYLDEE----SGWSTKAEEIEQQVIDSIKRGVTP 258
            P +  Y ++I +      Y  ++ P  L E     + W    + + + + +  K     
Sbjct: 147 -PFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDFDILNKTINERTK----- 200

Query: 259 RVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRS 318
             I++  P NP G V + + + Q+  I  K  I +++DEVY+ ++Y G +F  +  + + 
Sbjct: 201 -CIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYE-HLYFGDEFTRIATISKE 258

Query: 319 L 319
           +
Sbjct: 259 I 259

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 37.7 bits (86), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 33/54 (61%), Gaps = 2/54 (3%)

Query: 250 DSIKRGVTPRV--IVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           D ++  +TP+   +++  P NP G V + + + +I  I  +  +V+++DEVY++
Sbjct: 192 DELRAAITPKTKALILNTPHNPIGKVFTREELLEIGNICVENNVVIISDEVYEH 245

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 67/135 (49%), Gaps = 9/135 (6%)

Query: 172 GETASPDDIFLTDGASKAATYLLSILCRDSSTG--IMIPIPQYPLYTASITMYNSVMLPY 229
           G+    ++I +T GA++    +LS L    + G  +++  P +  Y ++I +    ++  
Sbjct: 114 GKELKQENITITTGANEG---ILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKVVYV 170

Query: 230 YLDEESGWSTKAEEIEQQVID--SIKRGVTPRV--IVVINPGNPTGAVLSFDTIAQILTI 285
            ++       +  E  +  ID    +  +TP+   ++V +P NP G V + + + ++  I
Sbjct: 171 PINPPKDLDQRITEGTEWTIDFEQFRNAITPKTKAVIVNSPHNPIGKVFTKEELTKLGEI 230

Query: 286 AAKYGIVVLADEVYQ 300
             +  +++++DEVY+
Sbjct: 231 CVENNVIIISDEVYE 245

>AGR167W Chr7 (1059790..1061328) [1539 bp, 512 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGL202W (ARO8)
          Length = 512

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 58/243 (23%), Positives = 105/243 (43%), Gaps = 34/243 (13%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNS---VMLPYYLDEES 235
           D+ +T G+++A    + + C +  + +M        Y++S+    +     +   +D E 
Sbjct: 127 DVLVTAGSTQAWDATMRLFCNEGDSVVMEAF----TYSSSVEAAEAQGLYCVGMEVDSEG 182

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVL 294
               +  E+  +          PRV+  I  G NP G+ L     AQI  +A +Y ++++
Sbjct: 183 IVPERLAELLAEWDTQHAGHARPRVLYTIPTGQNPMGSTLVDARKAQIYRLAQQYDMLIV 242

Query: 295 ADEVY---QNNIY-----KGVK-FHSMKKVLR--------SLQRDHPNGEYDNVQLASMH 337
            D+ Y   Q + Y     +G++ +   +  LR        SL R   + + D  ++  + 
Sbjct: 243 EDDPYYFLQMDAYDAAGPRGIEAYEGARAALRADHARFASSLSRSFLDWDTDG-RVVRLE 301

Query: 338 STSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVT-GQALVDLMLNPPREGD 396
           STSK  +  C  R G+  +VG    + Q    L  +S+ S     QA++  MLN  R G 
Sbjct: 302 STSKVFAPGC--RTGW--IVGARALLDQ-YWYLQEVSVQSTCGFAQAILSGMLN--RWGQ 354

Query: 397 DSY 399
           D Y
Sbjct: 355 DRY 357

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 58/117 (49%), Gaps = 9/117 (7%)

Query: 185 GASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEESGWSTKAE 242
           G+ ++   ++   C  S   I++  P Y +Y+  A+I   + V  P  + E++ +   A 
Sbjct: 94  GSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPL-ITEDNSFQIDAT 152

Query: 243 EIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           EI    ++ +      +++ + +PGNPTGA +  D I  +L      G+V++ DE Y
Sbjct: 153 EI----LNILANDPLIKLVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVIV-DEAY 203

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 109/248 (43%), Gaps = 50/248 (20%)

Query: 238 STKAEEIEQQVIDSIKR---GVTPRVI------VVINPGNPTGAVLSFDTIAQILTIAAK 288
           S   EE E++ I  I+R   GV  + I       V    NP+G   S  T  +++ +A +
Sbjct: 160 SFAEEEDEKESISCIQRDKIGVENKKIYRFVMYCVPTFSNPSGNTYSLKTKLKLIELARR 219

Query: 289 YGIVVLADEVYQNNIYK---GVKFHSMKKVLRSLQRD---HPNGEYDNVQLASMHSTSKG 342
           Y +++++D+VY    Y+    V  H  K+ +  L R+   HP   + N    S  + SK 
Sbjct: 220 YDMLIISDDVYDLLDYEQFLDVLPHVPKRFVH-LDRETSTHPENSFGNT--LSNATFSKI 276

Query: 343 VSGECGQRGGYMELVGFSNE-VRQVILKLASIS------ICSVVTGQALVDLMLNPPREG 395
           ++   G R GY E +  SN+ V Q+    A+ S      + S++ G  L + +++     
Sbjct: 277 IAP--GLRFGYTESI--SNKLVLQLSRGGANTSGGTPSQLNSMIVGTMLKNGLVD----- 327

Query: 396 DDSYELDVRERKEIHN---NMKTRGYLLYDTFQKL--EGIECQEPQGAMYLFPKLLLSKK 450
                      K +HN     K R  ++Y++ ++      +CQ  +G  + +  L L   
Sbjct: 328 -----------KVLHNLRQTYKERSVVMYESIKRWLPRKTQCQLQKGGYFTWITLPLGYD 376

Query: 451 AIEEAKSL 458
           A+E  K L
Sbjct: 377 AVEIGKML 384

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/128 (23%), Positives = 64/128 (50%), Gaps = 9/128 (7%)

Query: 174 TASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYL 231
           T + +++ L  G+ ++   ++   C  +   I++  P Y +Y+  A+I     V  P  +
Sbjct: 84  TLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCANINDIEVVECPL-I 142

Query: 232 DEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGI 291
            E++ +   ++    +V+D +K     +++ + +PGNPTG  +    I ++L      G+
Sbjct: 143 YEDNSFQLNSD----KVLDILKNDPLIKLVFITSPGNPTGVKIETKRIEKVLQ-NWDNGL 197

Query: 292 VVLADEVY 299
           VV+ DE Y
Sbjct: 198 VVV-DEAY 204

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/129 (24%), Positives = 62/129 (48%), Gaps = 9/129 (6%)

Query: 173 ETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYY 230
           ++ + D++ L  G+ ++   ++   C      I++  P Y +Y+  A+I     V  P  
Sbjct: 83  KSLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLV 142

Query: 231 LDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYG 290
           + + S +    E     V+  ++     +++ V +PGNPTGA +    I Q+L    + G
Sbjct: 143 VSDNS-FQMDVE----AVLTILENDPLIKLVFVTSPGNPTGAKIKTSLIEQVLQ-NWQNG 196

Query: 291 IVVLADEVY 299
           +VV+ DE Y
Sbjct: 197 LVVV-DEAY 204

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 48/186 (25%), Positives = 81/186 (43%), Gaps = 38/186 (20%)

Query: 149 YSLAQGVYGIRESVADFIT------RRDEGETASPDDIFLTDGASKAATYLLSILCRDS- 201
           Y   +G   +RE++  F         RD+   + P+ + L+ GAS     +LSIL + + 
Sbjct: 51  YGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYG---VLSILLQATL 107

Query: 202 -STG----IMIPIPQYPL---------YTASITMYNS--------VMLPYYLDEESGWST 239
             TG      I  P Y L         + + IT  +          +L   L E     T
Sbjct: 108 AHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKFT 167

Query: 240 KAEEIEQ-QVIDSIKRGVTPRV---IVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVV 293
           + E+ E+ Q I    + V  ++   ++   P   NPTG   S +T  +++ IA KY +++
Sbjct: 168 EEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLI 227

Query: 294 LADEVY 299
           +AD+VY
Sbjct: 228 IADDVY 233

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 50/123 (40%), Gaps = 7/123 (5%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D  LT G +      L I C      I+     +    AS      +  P  +D +    
Sbjct: 132 DSILTTGNTNGWESTLRIFCNKGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDSDGIIP 190

Query: 239 TKAEEIEQQVIDSIKRGV-TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
            K E I    +D+   G   P+++  I  G NPTG+ LS +    I  IA K+  +++ D
Sbjct: 191 EKLESI----LDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIED 246

Query: 297 EVY 299
           E Y
Sbjct: 247 EPY 249

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 259 RVIVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           R ++ + P   NPTGA+ S  +  ++L +A KY I++++D+VY
Sbjct: 187 RYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 29/43 (67%), Gaps = 2/43 (4%)

Query: 259 RVIVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           R ++ + P   NPTGA+ S  +  ++L +A KY I++++D+VY
Sbjct: 188 RYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 61/123 (49%), Gaps = 9/123 (7%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEESG 236
           +I L  G+ ++   ++   C  +   I++  P Y +Y+  A I     V  P  + E++ 
Sbjct: 89  NICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPL-ITEDNS 147

Query: 237 WSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
           +   ++    +V+D +      +++ + +PGNPTGA +    I ++L    + G+VV+ D
Sbjct: 148 FQMDSD----KVLDILNNDQEIKLLFITSPGNPTGAQIETARIEKVLQNWDR-GLVVV-D 201

Query: 297 EVY 299
           E Y
Sbjct: 202 EAY 204

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 71/145 (48%), Gaps = 18/145 (12%)

Query: 258 PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY---QNNIY-------KG 306
           P+++  I  G NPTG+ LS D   +I  IA K+  +++ DE Y   Q + Y       K 
Sbjct: 210 PKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPYYFLQMDAYEKDPSKRKA 269

Query: 307 VKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQV 366
           ++F S  + + SL +   + + +  ++  M S SK +    G R G+  LVG S  + + 
Sbjct: 270 IEFASHDEFVNSLAKSFISLDTEG-RVIRMDSFSKVLG--PGTRLGW--LVG-SKRILRA 323

Query: 367 ILKLASISICSVVT-GQALVDLMLN 390
             +L  ++I +     QA+V   LN
Sbjct: 324 YTQLHEMTIQNPSGFSQAIVSGTLN 348

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 35.0 bits (79), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 64/130 (49%), Gaps = 5/130 (3%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEES 235
           + +++ +T GA++     L+ L       I+   P +  Y  +I +   V+    +   +
Sbjct: 128 AAENVQVTTGANEGIFACLAGLVNPGDEVIVFE-PFFDQYIPNIELLGGVVRYVPIRPPA 186

Query: 236 GWSTKAEEIEQQVID--SIKRGVT--PRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGI 291
             S +  E  + VID   +++ +    + +++ +P NP G V + + + ++  I  + GI
Sbjct: 187 ELSKRVTEGTEWVIDYDMLRQTINEKTKAVIINSPHNPIGKVFTREELLKLGNICVEKGI 246

Query: 292 VVLADEVYQN 301
            +++DEVY++
Sbjct: 247 YIISDEVYEH 256

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 35.0 bits (79), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDH--- 323
            NP+G   S +T  +++ IA KY ++++ D+VY    Y           LR +  D    
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVYDILDYTTPSDELPSPPLRMVHIDRSTA 254

Query: 324 PNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASIS------ICS 377
           P+GE       S  + SK ++   G R GY E +  +N  RQ+    A++S      + S
Sbjct: 255 PSGEDSFGNTVSNATFSKLIAP--GLRFGYHESIN-ANLARQLSKGGANVSGGTPSQLNS 311

Query: 378 VVTGQAL 384
           ++ G+ L
Sbjct: 312 MIVGEML 318

>TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {ON}
           Anc_8.477 YDR247W
          Length = 476

 Score = 35.0 bits (79), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 67/148 (45%), Gaps = 16/148 (10%)

Query: 232 DEESGWSTKAEEIEQQVI---DSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAK 288
           D    + T+   + ++++   D + R VT   I+ +NP N          +A I +    
Sbjct: 275 DNTFSYFTRDSNVLKKILPISDQLYRLVTR--ILQLNPYNRIDIRTLMSEVANITSFTND 332

Query: 289 YG----IVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGE---YDNVQLASMHSTSK 341
            G    +  L++E+Y N    G K  S+K++LRS   D    E   YD+   +S+ ST  
Sbjct: 333 NGPLSTVPKLSEELY-NTFIIGDKGMSLKEILRSYHDDEDADERQSYDSYPSSSITSTP- 390

Query: 342 GVSGECGQRGGYMELVGFSNEVRQVILK 369
             + E      Y E   +S++V +V+LK
Sbjct: 391 --TDENTTPAAYAETTPYSSDVDEVVLK 416

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 34.7 bits (78), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEESG 236
           +I L  G+ +    L+   C   +  +++  P Y +Y+  A I     V  P  + E++ 
Sbjct: 89  NICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPL-ITEDNS 147

Query: 237 WSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
           +    +     V++++    + +++ +  PGNPTGA +S   I  +L   +  GIVV+ D
Sbjct: 148 FDMDLD----NVLETLSNDDSIKLLFITTPGNPTGASISTQKIEMLLNNWSA-GIVVV-D 201

Query: 297 EVY 299
           E Y
Sbjct: 202 EAY 204

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 34.7 bits (78), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 43/170 (25%), Positives = 78/170 (45%), Gaps = 18/170 (10%)

Query: 146 VGAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTG- 204
           V  YS  +G   + +S+  F T     +  + +    T GA++A   + SIL    + G 
Sbjct: 76  VNQYSPTRGRLSLIDSLVKFYTPFYNTKLEAANFSVFT-GANEA---IFSILIGLLNPGD 131

Query: 205 -IMIPIPQYPLYTASITM------YNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVT 257
            +++  P +  Y  +I +      Y  +  P  LD      TK EE  Q   DS++  + 
Sbjct: 132 EVIVFEPFFDQYIPNIELSGGKVVYVPITPPKNLDTRV---TKGEEW-QIDWDSLQAAMN 187

Query: 258 PRV--IVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYK 305
            +   I++  P NP G V +   + ++  I  K  +V+++DEVY++  +K
Sbjct: 188 SKTKAIIINTPHNPIGKVFTEPELRRLGDICVKNNVVIISDEVYEHLYFK 237

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 34.7 bits (78), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 57/124 (45%), Gaps = 9/124 (7%)

Query: 178 DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEES 235
           D++ L  G+ ++   ++   C      I+   P Y +Y+  A+I     +  P   ++ S
Sbjct: 87  DNLCLGVGSDESIDAVIRACCVPGKEKILTLPPTYSMYSVCANINDVEVLECPLIYEDNS 146

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
                 +   Q+VI  +      +++ + +PGNPTGA +  + I +IL   +  G  V+ 
Sbjct: 147 -----FQPDSQKVISILSSDPLIKLVFLTSPGNPTGAKIDSNIIIKIL--ESWDGGFVVV 199

Query: 296 DEVY 299
           DE Y
Sbjct: 200 DEAY 203

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 59/127 (46%), Gaps = 12/127 (9%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDH--- 323
            NP+G   S +T  +++ IA KY ++V++D+VY    Y           LR +  D    
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLVISDDVYDILDYTTPSNELASPPLRMVHIDRSTA 254

Query: 324 PNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASIS------ICS 377
           P G+       S  + SK ++   G R GY E +  SN  RQ+    A++S      + S
Sbjct: 255 PLGQASFGNTISNATFSKLIAP--GLRFGYHESIN-SNLARQLSKGGANVSGGTPSQLNS 311

Query: 378 VVTGQAL 384
           ++ G+ L
Sbjct: 312 MIVGELL 318

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 12/43 (27%), Positives = 27/43 (62%)

Query: 259 RVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           + +++ +P NPTG V + + +  +  I  +  + +++DEVY+N
Sbjct: 184 KAVIINSPHNPTGKVFTREELLTLGNICVEKNVYIISDEVYEN 226

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 34.3 bits (77), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 9/124 (7%)

Query: 178 DDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDEES 235
           D++ L  G+ ++   ++   C      I++  P Y +Y+  A+I     V  P  + + S
Sbjct: 88  DNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSDNS 147

Query: 236 GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLA 295
                 +   +  +  +K     ++I V +PGNPTGA +    I +IL    + G+VV+ 
Sbjct: 148 -----FQMDTEAALTILKNDPLIKLIFVTSPGNPTGAKIKTCLIEKILQ-NWENGLVVV- 200

Query: 296 DEVY 299
           DE Y
Sbjct: 201 DEAY 204

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 34.7 bits (78), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 53/198 (26%), Positives = 88/198 (44%), Gaps = 23/198 (11%)

Query: 258 PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY---QNNIY-------KG 306
           P+++  I  G NPTG+ LS D   +I  IA K+ ++++ DE Y   Q + Y       K 
Sbjct: 210 PKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPYYFLQMDAYQKDVSQRKE 269

Query: 307 VKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQV 366
             F S +  + SL +   + + +  ++  + S SK +    G R G+  +VG S ++ Q 
Sbjct: 270 THFASQEDFVNSLAKSFISLDTEG-RVLRLDSFSKVLG--PGTRLGW--IVG-SKKILQK 323

Query: 367 ILKLASISICSVVT-GQALVDLMLNPPREGDDSYELD--VRERKEIHNNMKTRGYLLYDT 423
             +L  ++I +     QA+V   LN  R G D + LD  V  R+E +         LY  
Sbjct: 324 YTQLHEMTIQNPSGFSQAIVAGTLN--RWGQDGF-LDWLVGLRREYNEKRDVAIDALYKY 380

Query: 424 FQKLEGIECQEPQGAMYL 441
             +        P   M+ 
Sbjct: 381 LPETPAFTINPPIAGMFF 398

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326
            NP+G   + +T  +++ IA KY +++LAD+VY    Y+     S + + R +  D    
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVYDMLDYEQNVDKSPQPIKRFVHLDRETN 263

Query: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELV 357
           E  N    ++ + +       G R GY E +
Sbjct: 264 EDPNSFGNTISNATFSKLIAPGLRFGYHESI 294

>Smik_9.53 Chr9 (120672..121838) [1167 bp, 388 aa] {ON} YIL116W
           (REAL)
          Length = 388

 Score = 34.3 bits (77), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDE 233
           S D++ L  G+ ++   ++   C      I++  P Y +Y+  A+I     V  P  + +
Sbjct: 86  SADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDVEVVQCPLTVSD 145

Query: 234 ES-GWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIV 292
            S   +T+A      V+  +      +++   +PGNPTGA +    I ++L      GIV
Sbjct: 146 NSFQMNTEA------VLTILNNDPLIKIMFATSPGNPTGAKIKTCLIEEVLQ-KWDNGIV 198

Query: 293 VLADEVY 299
           V+ DE Y
Sbjct: 199 VV-DEAY 204

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 33.9 bits (76), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 59/126 (46%), Gaps = 9/126 (7%)

Query: 176 SPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYT--ASITMYNSVMLPYYLDE 233
           + D++ L  G+ ++   ++   C      I++  P Y +Y+  A+I     V  P  + +
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 234 ESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVV 293
            S      +   + V+  +K     +++ V +PGNPTGA +    I ++L      G+VV
Sbjct: 146 GS-----FQMDTEAVLTILKNDSLIKLMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVV 199

Query: 294 LADEVY 299
           + DE Y
Sbjct: 200 V-DEAY 204

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 33.9 bits (76), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 12/127 (9%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPN- 325
            NP+G   S +T  +++ IA KY ++V+ D+VY    Y           LR +  D    
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVYDILDYTSAADQLPSPPLRMVHLDRATA 261

Query: 326 --GEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASIS------ICS 377
             GE       S  + SK ++   G R GY E +  +N  RQ+    A++S      + S
Sbjct: 262 APGEDSFGNTVSNATFSKLIAP--GLRFGYHETIN-ANLARQLSKGGANVSGGTPSQLNS 318

Query: 378 VVTGQAL 384
           ++ G+ L
Sbjct: 319 MIVGELL 325

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
            NP+G   S +T  ++L +A KY ++++AD+VY
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 43/90 (47%), Gaps = 5/90 (5%)

Query: 242 EEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQN 301
           E I +   +S+K+     +  V +  NP+G   S  T  +++ +A  Y I+++ D+VY+ 
Sbjct: 200 ECIRRPNANSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYEF 259

Query: 302 NIYK-----GVKFHSMKKVLRSLQRDHPNG 326
             YK      V       + R + RD P+G
Sbjct: 260 LNYKVNPATSVIPKRFVDIEREMWRDLPDG 289

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 61/139 (43%), Gaps = 17/139 (12%)

Query: 172 GETASPDDIFLTDGASKAA-TYLLSILCRDSSTGIMIP-----IPQYPLYTASITMYNSV 225
           G+    +++ +T GA++   + L+ IL       +  P     IP   L    + +Y  +
Sbjct: 117 GQELKDENVTITTGANEGILSSLMGILNPGDEVIVFEPFFDQYIPNIELLGGKV-VYVPI 175

Query: 226 MLPYYLD----EESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQ 281
             P  +D    E   W+   EE+ +      K       +++  P NP G V + + + +
Sbjct: 176 NPPKDMDQRIVEGKDWTIDYEELAKAFTSKTK------ALILNTPHNPIGKVFTKEELTK 229

Query: 282 ILTIAAKYGIVVLADEVYQ 300
           I  +  +  +V+++DEVY+
Sbjct: 230 IGNLCVENNVVIISDEVYE 248

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 58/134 (43%), Gaps = 19/134 (14%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSV-----MLPYYLD- 232
           D+ L +G+S +   +   LC +  T +M        +T S T++N       ++P  ++ 
Sbjct: 161 DVLLANGSSDSLFKIFETLCDEGVTVLM------EEFTFSPTIFNVTASGGKVVPIKVEI 214

Query: 233 ----EESGWSTK--AEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTI 285
               E  G   +   + +E   +   K    PRV+  I  G NPTG  LS +    I  +
Sbjct: 215 THDPETQGIDVQYLCDLLENWEVGPYKHLSKPRVLYTIATGQNPTGMTLSPEKRKAIYEL 274

Query: 286 AAKYGIVVLADEVY 299
           A  +  +++ D+ Y
Sbjct: 275 AETHNFIIVEDDPY 288

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+  T G + A    L + C      I+     +    AS      +  P  +D      
Sbjct: 132 DVVATTGNTNAWESTLRVFCNRGDV-ILAEAHSFSSSLASAEAQGIITFPVPIDAHGIIP 190

Query: 239 TKAEEIEQQVIDSIKRGV-TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
            K E +    +D+   G   P+++  I  G NPTG+ L+ +   +I  IA K+  +++ D
Sbjct: 191 EKLEAL----LDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIED 246

Query: 297 EVY 299
           E Y
Sbjct: 247 EPY 249

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 27/59 (45%), Gaps = 5/59 (8%)

Query: 299 YQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSK----GVSGECGQRGGY 353
           Y +N Y+    +      R   RD+P G YDN +  + H T+     G  GE  + GGY
Sbjct: 359 YHDNYYQNNSGYGANNYGRPQDRDYPGGNYDNTRSRNTHDTNNYPRYGKEGED-KEGGY 416

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/123 (22%), Positives = 57/123 (46%), Gaps = 5/123 (4%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITM-YNSVMLPYYLDEESGW 237
           D+  T G+++A    L + C    T +M          A++    N V +   +D++   
Sbjct: 128 DLITTAGSTQAWDACLRLFCNRGETVLMEEYTYSSSLEAAVAQGLNCVAMK--MDKDGIK 185

Query: 238 STKAEEIEQQVIDSIKRGVTPRVIVVI-NPGNPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
             K  E+ +   D   +G  P+++  I N  NPTG  L  +   +++ +A++Y  +++ D
Sbjct: 186 VDKLSEMLRD-WDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIED 244

Query: 297 EVY 299
           + Y
Sbjct: 245 DPY 247

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 57/145 (39%), Gaps = 15/145 (10%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+  T G + A    L + C      I+     +    A+         P  +D++    
Sbjct: 133 DVVATAGNTNAWESTLRVFCNRGDV-ILAEAHSFSSCLAAAQAQGITTFPVPIDDKGIIP 191

Query: 239 TKAEEIEQQVIDSIKRGV-TPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLAD 296
            K E I    +D+   G   P+++  I  G NPTG  L+ +   +I  IA K+  +++ D
Sbjct: 192 AKLEAI----LDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIED 247

Query: 297 EVYQNNIYKGVKFHSMKKVLRSLQR 321
             Y         F  M K  R LQ+
Sbjct: 248 APYY--------FLQMDKYERDLQK 264

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 51/116 (43%), Gaps = 8/116 (6%)

Query: 249 IDSIKRGVTPRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQ------NN 302
           I  +K+     + V+    NP+G   + +T  +++ +A KY ++++ D+VY       NN
Sbjct: 186 ISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDDVYDLLNYSINN 245

Query: 303 IYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVG 358
                +  +  K    + R+  N E       S  S SK ++   G R GY E + 
Sbjct: 246 DPDKFELPTPIKRFVHIDRETNNDESSYGNTVSNASFSKIIA--PGLRFGYHESIN 299

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 18/129 (13%)

Query: 258 PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY----------QNNIYKG 306
           P+++  I  G NPTG+ L  +  +Q+  IA K+  +++ DE Y            ++ K 
Sbjct: 207 PKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPYYFLQMEDYVKDPSLRKE 266

Query: 307 VKFHSMKKVLRSLQRDHPNGEYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQV 366
           VK  S  + L SL +   + + D  ++  M S SK ++   G R G++     SN++ + 
Sbjct: 267 VKL-SHDEFLASLDQTFLSIDTDG-RVIRMDSFSKVLA--PGSRLGWITC---SNQIMKA 319

Query: 367 ILKLASISI 375
            L L  +S+
Sbjct: 320 YLALYEMSM 328

>SAKL0A06468g Chr1 complement(580333..582531) [2199 bp, 732 aa] {ON}
           similar to uniprot|P53134 Saccharomyces cerevisiae
           YGL114W Putative member of the oligopeptide transporter
           (OPT) family of membrane transporters
          Length = 732

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 137 VLLEQIGGSVGAYSLAQGVYGIRESVADFITRRDEGETASPDDIF 181
           V ++ I  +VG   LA G  G+  ++  F+T ++ GET  P++ F
Sbjct: 86  VYVQSIAVAVGTGPLAYGFVGVIPAIEKFLTWQESGETRRPEEPF 130

>KAFR0B02380 Chr2 complement(463678..465009) [1332 bp, 443 aa] {ON}
           Anc_8.204 YER152C
          Length = 443

 Score = 32.0 bits (71), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 21/32 (65%)

Query: 268 NPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           NP+G   S  T  ++L +A KY I+++ D+VY
Sbjct: 200 NPSGHTYSLTTKLRLLELARKYDILIITDDVY 231

>AFL016C Chr6 complement(405116..407230) [2115 bp, 704 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL114W
          Length = 704

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 33/84 (39%), Gaps = 24/84 (28%)

Query: 98  PLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGVYG 157
           PL F+       +YPP  D E                  V ++ I  +VG   LA G  G
Sbjct: 65  PLLFA-------EYPPFSDVEN-----------------VYVQSIAVAVGTGPLAYGFVG 100

Query: 158 IRESVADFITRRDEGETASPDDIF 181
           +  ++  F+TR + G    P D F
Sbjct: 101 VLPAIEKFMTREESGGLRDPGDPF 124

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 22/33 (66%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
            NP+G   S +T  +++ IA +Y ++++ D+VY
Sbjct: 193 ANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 225 VMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQIL 283
           ++ P  +D +     K E+I  +      R   P+++  I  G NPTG  L+ D   +I 
Sbjct: 176 IVFPIPIDADGIIPEKLEKILDEWTPGAPR---PKLLYTIPTGQNPTGTSLADDRKKEIY 232

Query: 284 TIAAKYGIVVLADEVY 299
            IA K+  +++ DE Y
Sbjct: 233 RIAQKHDFLIIEDEPY 248

>AGL178W Chr7 (363877..365817) [1941 bp, 646 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR109W-B, YIL082W-A
           and YIL080W
          Length = 646

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 56/130 (43%), Gaps = 16/130 (12%)

Query: 198 CRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVT 257
           C   +   +  I  Y  +  +  M    +L Y   +   W     E +++  D +KR + 
Sbjct: 466 CVKDAQRFLSMINYYRRFIPNFAMLVKPILQYACRKTIWW-----EDQEKAFDKVKRLLR 520

Query: 258 PRVIVVINPGNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLR 317
              ++V     P     S+    ++ T A+KYG+  + +EV  N+    V + S  K+L+
Sbjct: 521 TGPVLV-----PYKEGASY----RLTTEASKYGVAAVLEEVAGNDTIGVVGYFS--KLLK 569

Query: 318 SLQRDHPNGE 327
             QR +P GE
Sbjct: 570 GAQRHYPEGE 579

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 61/150 (40%), Gaps = 11/150 (7%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+  T G + A    L + C      I++    +    AS      +  P  +D +    
Sbjct: 134 DVLATAGNTNAWESTLRVFCNRGDV-ILVEAHSFSSSLASAEAQGVITFPVPIDADGIIP 192

Query: 239 TKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADE 297
            K  ++ +       +   P+++  I  G NPTG  ++      I  IA KY  +++ DE
Sbjct: 193 EKLAKVMENWTPGAPK---PKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 298 VY---QNNIY-KGVKFHSMKKVLRSLQRDH 323
            Y   Q N Y K +K    +K   S ++DH
Sbjct: 250 PYYFLQMNPYIKDLK--EREKAQSSPKQDH 277

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 28/43 (65%), Gaps = 2/43 (4%)

Query: 259 RVIVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           R ++ + P   NP+GA  S +   ++L +A +Y I++++D+VY
Sbjct: 189 RYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 31.2 bits (69), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 30/45 (66%), Gaps = 2/45 (4%)

Query: 257 TPRVIVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
           T R ++ + P   NP+G+  S +T  +++ +A +Y +++++D++Y
Sbjct: 178 TYRYVMYLIPTYSNPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>Ecym_7228 Chr7 (473169..474635) [1467 bp, 488 aa] {ON} similar to
           Ashbya gossypii AGR167W
          Length = 488

 Score = 31.2 bits (69), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 8/125 (6%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+ +T G+++A    L + C    + ++    +   Y++S+    +  +     E  G  
Sbjct: 129 DVLITAGSTQAWDASLRLFCNPGDSVLL----ESWTYSSSVEAAEAQGMYCVGVEIDGHG 184

Query: 239 TKAEEIEQ--QVIDSIKRGVT-PRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVL 294
              E++E   Q  D +  G + P+++ VI  G NP G  L+ +    I  I  KY +V++
Sbjct: 185 VVPEKLEWLLQNWDDLHPGRSLPKLLYVIPTGQNPMGVTLADERKPLIYNIIQKYDMVLI 244

Query: 295 ADEVY 299
            D+ Y
Sbjct: 245 EDDPY 249

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 29/48 (60%), Gaps = 2/48 (4%)

Query: 259 RVIVVINP--GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIY 304
           R ++ + P   NP+G   S  T  +++ +A KY I++++D+VY   +Y
Sbjct: 188 RYVMYLVPTFSNPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVY 235

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 179 DIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLYTASITMYNSVMLPYYLDEESGWS 238
           D+F T G + A    L + C      I+     +    AS      +  P  +D +    
Sbjct: 134 DVFATAGNTNAWESTLRLFCNRGDV-ILAEAHSFSSSLASAEAQGVITFPVPIDADG--- 189

Query: 239 TKAEEIEQQVIDSIKRGVTPRVIVVINPG-NPTGAVLSFDTIAQILTIAAKYGIVVLADE 297
              E++ + + +       P+++  I  G NPTG  ++      I  IA K+  +++ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 298 VY 299
            Y
Sbjct: 250 PY 251

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 30.8 bits (68), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 22/33 (66%)

Query: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVY 299
            NP+G   S +T  +++ IA +Y ++V+ D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,909,163
Number of extensions: 2347583
Number of successful extensions: 5979
Number of sequences better than 10.0: 132
Number of HSP's gapped: 6013
Number of HSP's successfully gapped: 132
Length of query: 521
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 407
Effective length of database: 40,409,475
Effective search space: 16446656325
Effective search space used: 16446656325
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)