Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M01200singletonON29129112920.0
KNAG0M01120singletonON262943374e-37
KNAG0F03415singletonON253872798e-29
ZYRO0A08536g2.395ON528892556e-24
NDAI0H029002.395ON913852559e-24
CAGL0L06776g2.395ON828892522e-23
TDEL0G032702.395ON545892494e-23
SAKL0E04862g2.395ON581912442e-22
KAFR0B05930singletonON573872416e-22
YMR136W (GAT2)2.395ON560882328e-21
KNAG0A059402.395ON610812311e-20
KNAG0E021202.395ON347872271e-20
Skud_13.2972.395ON552882292e-20
Smik_13.3352.395ON565882274e-20
KAFR0B051302.395ON493942255e-20
ADR249W2.395ON625852231e-19
SAKL0A06842gna 1ON474892221e-19
CAGL0I00902g2.395ON567882212e-19
KLLA0F17116g2.395ON391812192e-19
Suva_13.3162.395ON563882212e-19
KAFR0F026802.395ON352872173e-19
Ecym_60602.395ON719862213e-19
Kpol_1046.62.395ON407882183e-19
TPHA0G021302.395ON678972195e-19
Kpol_1041.262.395ON467882132e-18
TPHA0G026402.395ON350852102e-18
KLTH0E09548g2.395ON503782043e-17
Kwal_47.178492.395ON473852034e-17
TBLA0B087902.395ON451882016e-17
Kwal_14.1746na 1ON437891981e-16
KLTH0H06314gna 1ON422731982e-16
NCAS0G03520singletonON257891896e-16
TBLA0B092402.395ON1278851922e-15
Kpol_385.3singletonON359621742e-13
NCAS0C04570singletonON176851654e-13
ZYRO0E01738gna 1ON454621601e-11
Ecym_3059na 1ON466811582e-11
TDEL0G03430na 1ON433621583e-11
NCAS0D012602.395ON331611563e-11
AAR174Wna 1ON460891583e-11
NDAI0H01740singletonON420931548e-11
NDAI0H01910singletonON419931521e-10
Smik_9.213na 2ON120801393e-10
KLLA0F09757gna 1ON252711455e-10
Skud_9.191na 2ON128711352e-09
YIR013C (GAT4)na 2ON121711342e-09
CAGL0D03608gsingletonON441631423e-09
Suva_9.224na 2ON119801333e-09
Skud_16.312na 3ON142671246e-08
TPHA0O01160singletonON203651269e-08
Suva_16.354na 3ON142721193e-07
Smik_16.268na 3ON138641193e-07
Skud_12.81na 4ON140641072e-05
TBLA0A07280singletonON171491072e-05
YLR013W (GAT3)na 4ON141351034e-05
Suva_10.93na 4ON142371018e-05
Smik_12.76na 4ON15737992e-04
KAFR0I01960singletonON6445870.002
ZYRO0F03520g8.55ON32739890.010
AFR513C8.55ON46838880.016
NCAS0F038403.539ON83145880.018
KNAG0H02780singletonON6528790.020
YER040W (GLN3)3.539ON73042870.020
SAKL0B01826g8.55ON68352870.025
CAGL0C02277g3.539ON82341870.027
TDEL0C008108.55ON34533850.030
Suva_5.1393.539ON72842860.032
Kpol_1011.148.55ON42849850.032
NDAI0G032508.55ON49733850.037
Smik_5.1643.539ON73342850.038
KAFR0J003203.539ON65739850.040
Kwal_47.179808.55ON72151850.040
Skud_5.1493.539ON73135850.041
KNAG0C014401.250ON46043840.046
KLLA0A01342g3.539ON78131840.048
SAKL0F01496g3.539ON80548840.052
Kpol_1058.278.55ON48437830.061
KLLA0F25300g8.55ON69233830.070
Ecym_25693.539ON84736830.075
Skud_6.508.55ON47033820.075
KNAG0E033708.55ON49939820.084
TPHA0B012501.250ON39438810.092
Smik_6.578.55ON52333810.11
Smik_16.214na 5ON17244790.11
NCAS0C039208.55ON45933810.11
Kpol_483.223.539ON77731810.12
KLTH0A03036g8.55ON72033810.13
YFL021W (GAT1)8.55ON51033800.13
Skud_16.261na 5ON18740780.14
Suva_11.2661.250ON27337790.14
SAKL0E12276gsingletonON16558770.15
Suva_16.297na 5ON17936780.15
YPL021W (ECM23)na 5ON18748780.15
NDAI0B061103.539ON104035800.16
Smik_11.2961.250ON26937790.17
Suva_6.378.55ON51533790.18
Skud_11.2691.250ON26837780.19
Kwal_27.126551.250ON56033790.19
Ecym_14568.55ON65733790.20
CAGL0K07634g8.55ON45934790.20
TDEL0D060703.539ON81139790.21
KLTH0E15488g1.250ON54133790.23
YKR034W (DAL80)1.250ON26937770.24
NDAI0B051601.250ON35935760.38
KNAG0D028303.539ON75538770.39
AFR237W3.539ON80735760.54
KAFR0A034101.250ON33639750.56
SAKL0D04928g1.250ON39233750.59
Kwal_47.191603.539ON67835750.68
Smik_10.1281.250ON55233750.71
Ecym_63651.250ON57333750.73
KLTH0G01320g3.539ON74435740.81
TPHA0A059303.539ON81231740.82
KAFR0C033808.55ON30246730.84
KLLA0F21296g1.250ON50439740.91
AFR069C1.250ON30833730.96
Kpol_1016.121.250ON50933730.98
YCR018C (SRD1)na 6ON22141720.99
TBLA0E004003.539ON96935731.1
ZYRO0E08910g3.539ON85331731.4
NCAS0B078101.250ON20033701.5
Smik_3.106na 6ON22141701.9
Suva_3.45na 6ON22240702.0
Kpol_1043.421.367ON98859702.9
Skud_3.86na 6ON22241683.3
TBLA0I033603.539ON106130693.4
TBLA0F012504.283ON45248667.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01200
         (291 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01200 Chr13 complement(218147..219022) [876 bp, 291 aa] {O...   502   0.0  
KNAG0M01120 Chr13 (200158..200946) [789 bp, 262 aa] {ON}              134   4e-37
KNAG0F03415 Chr6 (646275..647036) [762 bp, 253 aa] {ON}               112   8e-29
ZYRO0A08536g Chr1 complement(682125..683711) [1587 bp, 528 aa] {...   102   6e-24
NDAI0H02900 Chr8 (707849..710590) [2742 bp, 913 aa] {ON} Anc_2.395    102   9e-24
CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some ...   101   2e-23
TDEL0G03270 Chr7 complement(607444..609081) [1638 bp, 545 aa] {O...   100   4e-23
SAKL0E04862g Chr5 (394898..396643) [1746 bp, 581 aa] {ON} weakly...    99   2e-22
KAFR0B05930 Chr2 complement(1222301..1224022) [1722 bp, 573 aa] ...    97   6e-22
YMR136W Chr13 (541199..542881) [1683 bp, 560 aa] {ON}  GAT2Prote...    94   8e-21
KNAG0A05940 Chr1 complement(887824..889656) [1833 bp, 610 aa] {O...    94   1e-20
KNAG0E02120 Chr5 complement(432952..433995) [1044 bp, 347 aa] {O...    92   1e-20
Skud_13.297 Chr13 (514594..516252) [1659 bp, 552 aa] {ON} YMR136...    93   2e-20
Smik_13.335 Chr13 (523587..524124,524203..525362) [1698 bp, 565 ...    92   4e-20
KAFR0B05130 Chr2 complement(1053911..1055392) [1482 bp, 493 aa] ...    91   5e-20
ADR249W Chr4 (1135915..1137792) [1878 bp, 625 aa] {ON} Syntenic ...    91   1e-19
SAKL0A06842g Chr1 complement(605900..607324) [1425 bp, 474 aa] {...    90   1e-19
CAGL0I00902g Chr9 complement(67387..69090) [1704 bp, 567 aa] {ON...    90   2e-19
KLLA0F17116g Chr6 complement(1569192..1570367) [1176 bp, 391 aa]...    89   2e-19
Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)...    90   2e-19
KAFR0F02680 Chr6 (524312..525370) [1059 bp, 352 aa] {ON} Anc_2.3...    88   3e-19
Ecym_6060 Chr6 complement(114016..116175) [2160 bp, 719 aa] {ON}...    90   3e-19
Kpol_1046.6 s1046 (13998..15221) [1224 bp, 407 aa] {ON} (13998.....    89   3e-19
TPHA0G02130 Chr7 complement(435945..437981) [2037 bp, 678 aa] {O...    89   5e-19
Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON} (68074....    87   2e-18
TPHA0G02640 Chr7 complement(552162..553214) [1053 bp, 350 aa] {O...    86   2e-18
KLTH0E09548g Chr5 (862710..864221) [1512 bp, 503 aa] {ON} weakly...    83   3e-17
Kwal_47.17849 s47 (579209..580630) [1422 bp, 473 aa] {ON} YMR136...    83   4e-17
TBLA0B08790 Chr2 (2089746..2091101) [1356 bp, 451 aa] {ON} Anc_2...    82   6e-17
Kwal_14.1746 s14 complement(450643..451956) [1314 bp, 437 aa] {O...    81   1e-16
KLTH0H06314g Chr8 complement(553271..554539) [1269 bp, 422 aa] {...    81   2e-16
NCAS0G03520 Chr7 (657612..658385) [774 bp, 257 aa] {ON}                77   6e-16
TBLA0B09240 Chr2 complement(2185248..2189084) [3837 bp, 1278 aa]...    79   2e-15
Kpol_385.3 s385 (7522..8601) [1080 bp, 359 aa] {ON} (7522..8601)...    72   2e-13
NCAS0C04570 Chr3 complement(935042..935572) [531 bp, 176 aa] {ON}      68   4e-13
ZYRO0E01738g Chr5 complement(125883..127247) [1365 bp, 454 aa] {...    66   1e-11
Ecym_3059 Chr3 complement(110013..111413) [1401 bp, 466 aa] {ON}...    65   2e-11
TDEL0G03430 Chr7 complement(633324..634625) [1302 bp, 433 aa] {O...    65   3e-11
NCAS0D01260 Chr4 complement(229646..230641) [996 bp, 331 aa] {ON...    65   3e-11
AAR174W Chr1 (657598..658980) [1383 bp, 460 aa] {ON} NOHBY117; N...    65   3e-11
NDAI0H01740 Chr8 complement(415810..417072) [1263 bp, 420 aa] {O...    64   8e-11
NDAI0H01910 Chr8 (467628..468887) [1260 bp, 419 aa] {ON}               63   1e-10
Smik_9.213 Chr9 complement(355801..356163) [363 bp, 120 aa] {ON}...    58   3e-10
KLLA0F09757g Chr6 (898398..899156) [759 bp, 252 aa] {ON} some si...    60   5e-10
Skud_9.191 Chr9 complement(350693..351079) [387 bp, 128 aa] {ON}...    57   2e-09
YIR013C Chr9 complement(380019..380384) [366 bp, 121 aa] {ON}  G...    56   2e-09
CAGL0D03608g Chr4 complement(363465..364790) [1326 bp, 441 aa] {...    59   3e-09
Suva_9.224 Chr9 complement(367588..367947) [360 bp, 119 aa] {ON}...    56   3e-09
Skud_16.312 Chr16 complement(583881..584309) [429 bp, 142 aa] {O...    52   6e-08
TPHA0O01160 Chr15 complement(225978..226589) [612 bp, 203 aa] {O...    53   9e-08
Suva_16.354 Chr16 complement(625042..625470) [429 bp, 142 aa] {O...    50   3e-07
Smik_16.268 Chr16 complement(495302..495718) [417 bp, 138 aa] {O...    50   3e-07
Skud_12.81 Chr12 (163225..163647) [423 bp, 140 aa] {ON} YLR013W ...    46   2e-05
TBLA0A07280 Chr1 (1813951..1814466) [516 bp, 171 aa] {ON}              46   2e-05
YLR013W Chr12 (171339..171764) [426 bp, 141 aa] {ON}  GAT3Protei...    44   4e-05
Suva_10.93 Chr10 (177471..177899) [429 bp, 142 aa] {ON} YLR013W ...    44   8e-05
Smik_12.76 Chr12 (158187..158660) [474 bp, 157 aa] {ON} YLR013W ...    43   2e-04
KAFR0I01960 Chr9 (401053..401247) [195 bp, 64 aa] {ON}                 38   0.002
ZYRO0F03520g Chr6 (300351..301334) [984 bp, 327 aa] {ON} uniprot...    39   0.010
AFR513C Chr6 complement(1355811..1357217) [1407 bp, 468 aa] {ON}...    39   0.016
NCAS0F03840 Chr6 (769692..772187) [2496 bp, 831 aa] {ON} Anc_3.5...    39   0.018
KNAG0H02780 Chr8 (513375..513572) [198 bp, 65 aa] {ON}                 35   0.020
YER040W Chr5 (229795..231987) [2193 bp, 730 aa] {ON}  GLN3Transc...    38   0.020
SAKL0B01826g Chr2 (179191..181242) [2052 bp, 683 aa] {ON} some s...    38   0.025
CAGL0C02277g Chr3 complement(230496..232967) [2472 bp, 823 aa] {...    38   0.027
TDEL0C00810 Chr3 (134908..135945) [1038 bp, 345 aa] {ON} Anc_8.5...    37   0.030
Suva_5.139 Chr5 (206012..208198) [2187 bp, 728 aa] {ON} YER040W ...    38   0.032
Kpol_1011.14 s1011 complement(30640..30891,30894..31928) [1287 b...    37   0.032
NDAI0G03250 Chr7 (766494..767987) [1494 bp, 497 aa] {ON} Anc_8.55      37   0.037
Smik_5.164 Chr5 (234546..236747) [2202 bp, 733 aa] {ON} YER040W ...    37   0.038
KAFR0J00320 Chr10 complement(52668..54641) [1974 bp, 657 aa] {ON...    37   0.040
Kwal_47.17980 s47 complement(634203..636368) [2166 bp, 721 aa] {...    37   0.040
Skud_5.149 Chr5 (227606..229801) [2196 bp, 731 aa] {ON} YER040W ...    37   0.041
KNAG0C01440 Chr3 complement(282044..283426) [1383 bp, 460 aa] {O...    37   0.046
KLLA0A01342g Chr1 complement(120385..122730) [2346 bp, 781 aa] {...    37   0.048
SAKL0F01496g Chr6 complement(124251..126668) [2418 bp, 805 aa] {...    37   0.052
Kpol_1058.27 s1058 (80407..81861) [1455 bp, 484 aa] {ON} (80407....    37   0.061
KLLA0F25300g Chr6 (2354118..2356196) [2079 bp, 692 aa] {ON} some...    37   0.070
Ecym_2569 Chr2 (1112550..1115093) [2544 bp, 847 aa] {ON} similar...    37   0.075
Skud_6.50 Chr6 (99142..100554) [1413 bp, 470 aa] {ON} YFL021W (R...    36   0.075
KNAG0E03370 Chr5 (674614..676113) [1500 bp, 499 aa] {ON} Anc_8.5...    36   0.084
TPHA0B01250 Chr2 complement(278851..280035) [1185 bp, 394 aa] {O...    36   0.092
Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W (...    36   0.11 
Smik_16.214 Chr16 (388331..388849) [519 bp, 172 aa] {ON} YPL021W...    35   0.11 
NCAS0C03920 Chr3 (795871..797250) [1380 bp, 459 aa] {ON} Anc_8.55      36   0.11 
Kpol_483.22 s483 (58125..60458) [2334 bp, 777 aa] {ON} (58125..6...    36   0.12 
KLTH0A03036g Chr1 complement(258170..260332) [2163 bp, 720 aa] {...    36   0.13 
YFL021W Chr6 (95966..97498) [1533 bp, 510 aa] {ON}  GAT1Transcri...    35   0.13 
Skud_16.261 Chr16 (475931..476494) [564 bp, 187 aa] {ON} YPL021W...    35   0.14 
Suva_11.266 Chr11 (490833..491654) [822 bp, 273 aa] {ON} YKR034W...    35   0.14 
SAKL0E12276g Chr5 complement(1016243..1016740) [498 bp, 165 aa] ...    34   0.15 
Suva_16.297 Chr16 (514206..514745) [540 bp, 179 aa] {ON} YPL021W...    35   0.15 
YPL021W Chr16 (511101..511664) [564 bp, 187 aa] {ON}  ECM23Non-e...    35   0.15 
NDAI0B06110 Chr2 (1482402..1485524) [3123 bp, 1040 aa] {ON} Anc_...    35   0.16 
Smik_11.296 Chr11 (496172..496981) [810 bp, 269 aa] {ON} YKR034W...    35   0.17 
Suva_6.37 Chr6 (69498..71045) [1548 bp, 515 aa] {ON} YFL021W (REAL)    35   0.18 
Skud_11.269 Chr11 (489067..489873) [807 bp, 268 aa] {ON} YKR034W...    35   0.19 
Kwal_27.12655 s27 (1320535..1322217) [1683 bp, 560 aa] {ON} YJL1...    35   0.19 
Ecym_1456 Chr1 complement(938648..940621) [1974 bp, 657 aa] {ON}...    35   0.20 
CAGL0K07634g Chr11 complement(754675..756054) [1380 bp, 459 aa] ...    35   0.20 
TDEL0D06070 Chr4 (1095543..1097978) [2436 bp, 811 aa] {ON} Anc_3...    35   0.21 
KLTH0E15488g Chr5 (1377607..1379232) [1626 bp, 541 aa] {ON} some...    35   0.23 
YKR034W Chr11 (506898..507707) [810 bp, 269 aa] {ON}  DAL80Negat...    34   0.24 
NDAI0B05160 Chr2 (1264852..1265931) [1080 bp, 359 aa] {ON} Anc_1...    34   0.38 
KNAG0D02830 Chr4 (512472..514739) [2268 bp, 755 aa] {ON} Anc_3.5...    34   0.39 
AFR237W Chr6 (866798..869221) [2424 bp, 807 aa] {ON} Syntenic ho...    34   0.54 
KAFR0A03410 Chr1 complement(695254..696264) [1011 bp, 336 aa] {O...    33   0.56 
SAKL0D04928g Chr4 complement(379886..381064) [1179 bp, 392 aa] {...    33   0.59 
Kwal_47.19160 s47 (1115610..1117646) [2037 bp, 678 aa] {ON} YER0...    33   0.68 
Smik_10.128 Chr10 complement(201424..203082) [1659 bp, 552 aa] {...    33   0.71 
Ecym_6365 Chr6 (722796..724517) [1722 bp, 573 aa] {ON} similar t...    33   0.73 
KLTH0G01320g Chr7 complement(95197..97431) [2235 bp, 744 aa] {ON...    33   0.81 
TPHA0A05930 Chr1 (1340674..1343112) [2439 bp, 812 aa] {ON} Anc_3...    33   0.82 
KAFR0C03380 Chr3 complement(688344..689252) [909 bp, 302 aa] {ON...    33   0.84 
KLLA0F21296g Chr6 (1990998..1992512) [1515 bp, 504 aa] {ON} some...    33   0.91 
AFR069C Chr6 complement(546145..547071) [927 bp, 308 aa] {ON} Sy...    33   0.96 
Kpol_1016.12 s1016 complement(29363..30892) [1530 bp, 509 aa] {O...    33   0.98 
YCR018C Chr3 complement(148238..148903) [666 bp, 221 aa] {ON}  S...    32   0.99 
TBLA0E00400 Chr5 complement(73944..76853) [2910 bp, 969 aa] {ON}...    33   1.1  
ZYRO0E08910g Chr5 (711088..713649) [2562 bp, 853 aa] {ON} some s...    33   1.4  
NCAS0B07810 Chr2 (1483287..1483889) [603 bp, 200 aa] {ON} Anc_1....    32   1.5  
Smik_3.106 Chr3 complement(148337..149002) [666 bp, 221 aa] {ON}...    32   1.9  
Suva_3.45 Chr3 complement(62203..62871) [669 bp, 222 aa] {ON} YC...    32   2.0  
Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON} (83527....    32   2.9  
Skud_3.86 Chr3 complement(130892..131560) [669 bp, 222 aa] {ON} ...    31   3.3  
TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3....    31   3.4  
TBLA0F01250 Chr6 complement(311865..313223) [1359 bp, 452 aa] {O...    30   7.3  

>KNAG0M01200 Chr13 complement(218147..219022) [876 bp, 291 aa] {ON} 
          Length = 291

 Score =  502 bits (1292), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/291 (86%), Positives = 251/291 (86%)

Query: 1   MPIGPPSNFWRTPMKPTKGGIDEVKGKMSISTLLAAAELLEKQDGESVSDEKKPRLLMYD 60
           MPIGPPSNFWRTPMKPTKGGIDEVKGKMSISTLLAAAELLEKQDGESVSDEKKPRLLMYD
Sbjct: 1   MPIGPPSNFWRTPMKPTKGGIDEVKGKMSISTLLAAAELLEKQDGESVSDEKKPRLLMYD 60

Query: 61  RVITQNAITGQHSARVQPDGSLVFAPRHRFPPLRERLKSRVRIVGGLASPDDPLNLGVSP 120
           RVITQNAITGQHSARVQPDGSLVFAPRHRFPPLRERLKSRVRIVGGLASPDDPLNLGVSP
Sbjct: 61  RVITQNAITGQHSARVQPDGSLVFAPRHRFPPLRERLKSRVRIVGGLASPDDPLNLGVSP 120

Query: 121 RGRRDSNXXXXXXXXXXXXXXXXXXKWSPWVVPTPVLLXXXXXXXXXXXXXXXXXXXXXX 180
           RGRRDSN                  KWSPWVVPTPVLL                      
Sbjct: 121 RGRRDSNPQRLLPAPQEPPQREPREKWSPWVVPTPVLLSPGSSRSPSSSSAKSQGRRKSK 180

Query: 181 TRATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFS 240
           TRATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFS
Sbjct: 181 TRATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFS 240

Query: 241 VREANLFMQYRLSQGGKNRRVPCTIEVPADFIKQLENNPSITGNYETRGEV 291
           VREANLFMQYRLSQGGKNRRVPCTIEVPADFIKQLENNPSITGNYETRGEV
Sbjct: 241 VREANLFMQYRLSQGGKNRRVPCTIEVPADFIKQLENNPSITGNYETRGEV 291

>KNAG0M01120 Chr13 (200158..200946) [789 bp, 262 aa] {ON} 
          Length = 262

 Score =  134 bits (337), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 58/94 (61%), Positives = 69/94 (73%)

Query: 182 RATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSV 241
           + T   K Y+ PHPMDG+PC+HC +LEKTPEWRSGPYG   KICNACGLF+ KLK KF  
Sbjct: 146 KVTKNRKTYRNPHPMDGRPCTHCNSLEKTPEWRSGPYGRKHKICNACGLFYLKLKAKFGE 205

Query: 242 REANLFMQYRLSQGGKNRRVPCTIEVPADFIKQL 275
           R ANL M YR +   KNR+VP  I++P +FI QL
Sbjct: 206 RAANLLMHYRKTHEVKNRKVPSVIDIPHEFIVQL 239

>KNAG0F03415 Chr6 (646275..647036) [762 bp, 253 aa] {ON}
          Length = 253

 Score =  112 bits (279), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%)

Query: 181 TRATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFS 240
           T+   G K +K  HPMDGKPC HC  +  TPEWRSGPYG   +ICNACGLF+RKLK+KF 
Sbjct: 151 TKKMVGKKRHKTFHPMDGKPCPHCSTVSATPEWRSGPYGNNVRICNACGLFYRKLKQKFG 210

Query: 241 VREANLFMQYRLSQGGKNRRVPCTIEV 267
           +++ANL MQYR     ++R +P ++EV
Sbjct: 211 LKKANLLMQYRRKNCPRDRNMPHSVEV 237

>ZYRO0A08536g Chr1 complement(682125..683711) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 528

 Score =  102 bits (255), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 47/89 (52%), Positives = 61/89 (68%), Gaps = 2/89 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC     TPEWR GPYG  R +CNACGLF+RKL KKFS R+AN+ M+Y+     ++RR
Sbjct: 433 CVHCKE-GITPEWRRGPYG-NRTLCNACGLFYRKLIKKFSTRDANILMRYKRQVNPEDRR 490

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETRG 289
           VP  ++VP  FI QLEN+P++   + T G
Sbjct: 491 VPSALDVPELFISQLENDPNLDSEFNTIG 519

>NDAI0H02900 Chr8 (707849..710590) [2742 bp, 913 aa] {ON} Anc_2.395
          Length = 913

 Score =  102 bits (255), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 44/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HCG+ + TPEWR GPYG  R +CNACGLF+RKL KKF++++ANLFM+Y+ +    +RR
Sbjct: 828 CKHCGD-KDTPEWRRGPYG-NRTLCNACGLFYRKLVKKFTIKDANLFMRYQRTINPSDRR 885

Query: 261 VPCTIEVPADFIKQLENNPSITGNY 285
           +P  I++P  F+ QL ++ S+  NY
Sbjct: 886 IPSIIKIPETFVIQLNSDLSLDRNY 910

>CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136w GAT2
          Length = 828

 Score =  101 bits (252), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 62/89 (69%), Gaps = 2/89 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HCG  + TPEWR GPYG +R +CNACGLF+RKL KKF+V   NL+M+YR  Q   +RR
Sbjct: 739 CHHCGESD-TPEWRRGPYG-SRTLCNACGLFYRKLTKKFTVPYGNLYMRYRRIQAPLDRR 796

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETRG 289
           VP  ++VP D +++ + + +I  NY T G
Sbjct: 797 VPLVLDVPTDIVREFDLDQNIDSNYFTIG 825

>TDEL0G03270 Chr7 complement(607444..609081) [1638 bp, 545 aa] {ON}
           Anc_2.395 YMR136W
          Length = 545

 Score =  100 bits (249), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 59/89 (66%), Gaps = 2/89 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HCG    TPEWR GPYG  R +CNACGLF+RKL KKF V++ANL M+++     ++RR
Sbjct: 451 CVHCGE-GSTPEWRRGPYG-NRTLCNACGLFYRKLIKKFGVKDANLLMRFKKQINPEDRR 508

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETRG 289
           VP  + VPA F+ QL  + S+   Y T G
Sbjct: 509 VPSLVNVPAAFLSQLNEDSSLDSEYNTIG 537

>SAKL0E04862g Chr5 (394898..396643) [1746 bp, 581 aa] {ON} weakly
           similar to uniprot|P40209 Saccharomyces cerevisiae
           YMR136W GAT2
          Length = 581

 Score = 98.6 bits (244), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 46/91 (50%), Positives = 58/91 (63%), Gaps = 2/91 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GPYG  R +CNACGLF+ KL KKF ++EAN  M YR     ++RR
Sbjct: 487 CLHCAQ-KDTPEWRRGPYG-NRTLCNACGLFYGKLMKKFGLKEANTLMHYRRCTFPEDRR 544

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETRGEV 291
           VP T EVP  FIK+L+NN ++   +    E 
Sbjct: 545 VPQTAEVPESFIKELKNNAALNETFSVSHEA 575

>KAFR0B05930 Chr2 complement(1222301..1224022) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 97.4 bits (241), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 59/87 (67%), Gaps = 2/87 (2%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKN 258
           K C HC + + T EWR GPYG  R +CNACGLF RKL  KF V+ +N+ M+YR      N
Sbjct: 485 KTCVHCSDAD-TAEWRVGPYG-ERTLCNACGLFHRKLTDKFGVKYSNILMRYRKRINPFN 542

Query: 259 RRVPCTIEVPADFIKQLENNPSITGNY 285
           RRVP  IEVPA+F+K+L  +P+I  N+
Sbjct: 543 RRVPAFIEVPANFVKKLLADPTIDQNF 569

>YMR136W Chr13 (541199..542881) [1683 bp, 560 aa] {ON}  GAT2Protein
           containing GATA family zinc finger motifs; similar to
           Gln3p and Dal80p; expression repressed by leucine
          Length = 560

 Score = 94.0 bits (232), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 58/88 (65%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLS-QGGKNR 259
           C HCG  E TPEWR GPYG TR +CNACGLF+RK+ KKF  + +NL ++YR S     +R
Sbjct: 472 CFHCGETE-TPEWRKGPYG-TRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRSIDLANDR 529

Query: 260 RVPCTIEVPADFIKQLENNPSITGNYET 287
           R+P  I +P  FI  ++N+ ++   Y T
Sbjct: 530 RIPDFITIPNRFIHDMDNDQTLDSEYNT 557

>KNAG0A05940 Chr1 complement(887824..889656) [1833 bp, 610 aa] {ON}
           Anc_2.395 YMR136W
          Length = 610

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/81 (56%), Positives = 53/81 (65%), Gaps = 3/81 (3%)

Query: 197 DG-KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQG 255
           DG K C HC N  KTPEWR+GPYG    ICNACGLF+RK+  KF VR  NL M+YR    
Sbjct: 515 DGEKRCFHC-NSSKTPEWRAGPYG-NENICNACGLFYRKVITKFGVRGGNLLMKYRQHTA 572

Query: 256 GKNRRVPCTIEVPADFIKQLE 276
             NRRVP  IE+P +F+ Q  
Sbjct: 573 PTNRRVPPYIEIPEEFMIQFH 593

>KNAG0E02120 Chr5 complement(432952..433995) [1044 bp, 347 aa] {ON}
           Anc_2.395 YMR136W
          Length = 347

 Score = 92.0 bits (227), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (65%), Gaps = 2/87 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   E TPEWR GPYG  R +CNACGL++RKL K F  +  NL M++      ++R+
Sbjct: 261 CKHCQETE-TPEWRRGPYG-NRSLCNACGLYYRKLIKSFDTKNGNLIMRFNRMINPQDRK 318

Query: 261 VPCTIEVPADFIKQLENNPSITGNYET 287
           VP +I +P + IKQL+ +P++  NY T
Sbjct: 319 VPVSIHIPRNIIKQLDRDPTLDVNYFT 345

>Skud_13.297 Chr13 (514594..516252) [1659 bp, 552 aa] {ON} YMR136W
           (REAL)
          Length = 552

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQG-GKNR 259
           C HCG  E TPEWR GPYG TR +CNACGLF+RK+ KKF  + +NL ++YR +     +R
Sbjct: 464 CFHCGETE-TPEWRKGPYG-TRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAVDLANDR 521

Query: 260 RVPCTIEVPADFIKQLENNPSITGNYET 287
           R+P  I +P  FI  ++N+ ++   Y T
Sbjct: 522 RIPDFITIPNRFIHDMDNDQTLDSEYNT 549

>Smik_13.335 Chr13 (523587..524124,524203..525362) [1698 bp, 565 aa]
           {ON} YMR136W (REAL)
          Length = 565

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 58/88 (65%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLS-QGGKNR 259
           C HCG  E TPEWR GPYG TR +CNACGLF+RK+ KKF  + +NL ++YR +     +R
Sbjct: 477 CFHCGETE-TPEWRKGPYG-TRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAIDLANDR 534

Query: 260 RVPCTIEVPADFIKQLENNPSITGNYET 287
           R+P  I +P  FI  ++N+ ++   Y T
Sbjct: 535 RIPDFITIPNRFIHDMDNDRTLDSEYNT 562

>KAFR0B05130 Chr2 complement(1053911..1055392) [1482 bp, 493 aa]
           {ON} Anc_2.395 YMR136W
          Length = 493

 Score = 91.3 bits (225), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 61/94 (64%), Gaps = 2/94 (2%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGG 256
           D   C HC  ++ TPEWR GPYG  R +CNACGLF+RKL KKF  + ANL M++      
Sbjct: 400 DKTKCLHCDEID-TPEWRRGPYG-NRTLCNACGLFYRKLVKKFGNKNANLLMRFNKLINP 457

Query: 257 KNRRVPCTIEVPADFIKQLENNPSITGNYETRGE 290
           ++RR+P    VP + +K L+++P++  +Y T+ E
Sbjct: 458 EDRRIPLEFFVPGEVVKSLDSDPTLDSDYFTKIE 491

>ADR249W Chr4 (1135915..1137792) [1878 bp, 625 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR136W (GAT2)
          Length = 625

 Score = 90.5 bits (223), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 52/85 (61%), Gaps = 2/85 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GPYG  R +CNACGLF+ KL KKF  +EAN+ M YR      +RR
Sbjct: 536 CLHCQERD-TPEWRRGPYG-NRTLCNACGLFYNKLIKKFGTKEANMVMHYRRRVFPDDRR 593

Query: 261 VPCTIEVPADFIKQLENNPSITGNY 285
           VP  +EVP  FIK L+    +   Y
Sbjct: 594 VPDVVEVPETFIKLLDQRHDLDDKY 618

>SAKL0A06842g Chr1 complement(605900..607324) [1425 bp, 474 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 474

 Score = 90.1 bits (222), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 58/89 (65%), Gaps = 2/89 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC ++E TPEWR GPYG  R +CNACGLF++KL  +F  ++AN+ M YR S    +RR
Sbjct: 383 CLHCASME-TPEWRRGPYG-KRSLCNACGLFYKKLINQFGNKDANILMHYRRSILPTDRR 440

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETRG 289
           VP   EVP  F+ +LE + ++   ++  G
Sbjct: 441 VPKVFEVPESFVNKLEGDLALDREFKVMG 469

>CAGL0I00902g Chr9 complement(67387..69090) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136w GAT2
          Length = 567

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 55/88 (62%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLS-QGGKNR 259
           C HCG    TPEWR GPYG  R +CNACGLF+RK   KF V+ ANL ++YR       NR
Sbjct: 477 CLHCGE-NHTPEWRRGPYG-NRTLCNACGLFYRKAISKFGVKNANLLLRYRKRISNTANR 534

Query: 260 RVPCTIEVPADFIKQLENNPSITGNYET 287
           RVP  +++P   I++ + +P +  NY T
Sbjct: 535 RVPKMLKIPIGIIEEFDADPYLDSNYNT 562

>KLLA0F17116g Chr6 complement(1569192..1570367) [1176 bp, 391 aa]
           {ON} weakly similar to uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2
          Length = 391

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/81 (51%), Positives = 56/81 (69%), Gaps = 3/81 (3%)

Query: 197 DG-KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQG 255
           DG + C HC     TPEWR GPYG  R +CNACGLF+ KL +KF+ ++AN+ M YR  +G
Sbjct: 295 DGTESCKHCHET-VTPEWRRGPYG-NRTLCNACGLFYCKLIRKFNTKDANILMHYRKMKG 352

Query: 256 GKNRRVPCTIEVPADFIKQLE 276
            ++RRVP ++ VP  FI+ LE
Sbjct: 353 PEDRRVPESLNVPRSFIESLE 373

>Suva_13.316 Chr13 (519713..520254,520783..521103,521223..522051)
           [1692 bp, 563 aa] {ON} YMR136W (REAL)
          Length = 563

 Score = 89.7 bits (221), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/88 (46%), Positives = 57/88 (64%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLS-QGGKNR 259
           C HCG  E TPEWR GPYG TR +CNACGLF+RK+ KKF  + +NL ++YR +     +R
Sbjct: 475 CFHCGETE-TPEWRKGPYG-TRTLCNACGLFYRKVTKKFGSKSSNLLLRYRRAIDLANDR 532

Query: 260 RVPCTIEVPADFIKQLENNPSITGNYET 287
           R+P  I +P  FI  ++ + ++   Y T
Sbjct: 533 RIPDFITIPNRFIHDMDKDQTLDSEYNT 560

>KAFR0F02680 Chr6 (524312..525370) [1059 bp, 352 aa] {ON} Anc_2.395
           YMR136W
          Length = 352

 Score = 88.2 bits (217), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKN 258
           K C HC + + TPEWR GPYG  R +CNACGLF RKL  KF  + +NL M+YR      N
Sbjct: 265 KRCKHCLD-DDTPEWRHGPYG-ERSVCNACGLFHRKLVHKFGYKYSNLLMRYRRRLNPLN 322

Query: 259 RRVPCTIEVPADFIKQLENNPSITGNY 285
           R+VP  IE+P +F  +L+N+  +   +
Sbjct: 323 RKVPNFIEIPVEFFNRLQNDTLLNTEF 349

>Ecym_6060 Chr6 complement(114016..116175) [2160 bp, 719 aa] {ON}
           similar to Ashbya gossypii ADR249W
          Length = 719

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 53/86 (61%), Gaps = 2/86 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GPYG  R +CNACGLF+ KL KKF VR+AN+ M YR      +RR
Sbjct: 630 CLHCHERD-TPEWRRGPYG-NRTLCNACGLFYNKLIKKFGVRDANIMMHYRRRLFPDDRR 687

Query: 261 VPCTIEVPADFIKQLENNPSITGNYE 286
           VP  +E+P  F++ +     +   Y+
Sbjct: 688 VPDAVEIPESFVQMINERTDLDEQYD 713

>Kpol_1046.6 s1046 (13998..15221) [1224 bp, 407 aa] {ON}
           (13998..15221) [1224 nt, 408 aa]
          Length = 407

 Score = 88.6 bits (218), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (64%), Gaps = 2/88 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C  CG  + TPEWR GPYG  + +CNACGLF+ KL KKF  + ANL M+YR      +R+
Sbjct: 320 CLQCGETQ-TPEWRRGPYG-NKTLCNACGLFYSKLTKKFGNKNANLLMRYRQKTSPSDRK 377

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETR 288
           VP  I VP D+I+ + ++ ++  +Y T+
Sbjct: 378 VPVDIGVPDDYIQLISHDTTLDQDYFTQ 405

>TPHA0G02130 Chr7 complement(435945..437981) [2037 bp, 678 aa] {ON}
           Anc_2.395 YMR136W
          Length = 678

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 60/97 (61%), Gaps = 3/97 (3%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYR 251
           R + +    C HC N   TPEWR GPYG  R +CNACGLF+RKL KKF ++ ANL M+YR
Sbjct: 582 RKNEITKMACVHC-NDHDTPEWRKGPYG-NRTLCNACGLFYRKLIKKFGLKSANLVMRYR 639

Query: 252 LSQGGKNRRVPCTI-EVPADFIKQLENNPSITGNYET 287
            +    +RRVP  +  +P   IK L ++ ++  +Y T
Sbjct: 640 KNISPHDRRVPSGLSNIPESHIKVLNSDKTLDDDYNT 676

>Kpol_1041.26 s1041 (68074..69477) [1404 bp, 467 aa] {ON}
           (68074..69477) [1404 nt, 468 aa]
          Length = 467

 Score = 86.7 bits (213), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (64%), Gaps = 3/88 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GPYG  R +CNACGLF+RKL KKF  ++ANL M+YR     ++RR
Sbjct: 380 CVHCKE-QDTPEWRRGPYG-NRTLCNACGLFYRKLIKKFGNKQANLLMRYRREICPQDRR 437

Query: 261 VPCTI-EVPADFIKQLENNPSITGNYET 287
           VP  + ++P + I + + +  +  +Y T
Sbjct: 438 VPSNVSDIPNEVIDKFDQDEQLDADYNT 465

>TPHA0G02640 Chr7 complement(552162..553214) [1053 bp, 350 aa] {ON}
           Anc_2.395 YMR136W
          Length = 350

 Score = 85.5 bits (210), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 57/85 (67%), Gaps = 2/85 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C  C N  +TPEWR GPYG  + +CNACGL++ KL KKF+  +AN+ M+Y+ +    +R+
Sbjct: 265 CKQC-NENETPEWRRGPYG-NKTLCNACGLYYSKLIKKFNSEQANIIMRYKKTTYPSDRK 322

Query: 261 VPCTIEVPADFIKQLENNPSITGNY 285
           +P   E+P +FI+ L+N+ ++   Y
Sbjct: 323 IPLQFEIPINFIEHLKNDSTLDDAY 347

>KLTH0E09548g Chr5 (862710..864221) [1512 bp, 503 aa] {ON} weakly
           similar to uniprot|P40209 Saccharomyces cerevisiae
           YMR136W GAT2
          Length = 503

 Score = 83.2 bits (204), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (61%), Gaps = 2/78 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GPYG  R +CNACGLF+ KL ++F    AN+ M YR     ++RR
Sbjct: 413 CVHCSR-KDTPEWRRGPYG-NRTVCNACGLFYGKLVRRFGAHRANIMMHYRRRTAPEDRR 470

Query: 261 VPCTIEVPADFIKQLENN 278
           VP    VP  F+K+L  +
Sbjct: 471 VPNAFFVPESFLKELHQD 488

>Kwal_47.17849 s47 (579209..580630) [1422 bp, 473 aa] {ON} YMR136W
           (GAT2) - Similar to GATA-family of DNA binding proteins
           [contig 204] FULL
          Length = 473

 Score = 82.8 bits (203), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/85 (44%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC + + TPEWR GPYG +R +CNACGLF+ KL K+F  + AN+ M YR +   ++RR
Sbjct: 388 CVHCAS-KDTPEWRRGPYG-SRTVCNACGLFYGKLVKRFGAQRANIMMHYRRTTVPEDRR 445

Query: 261 VPCTIEVPADFIKQLENNPSITGNY 285
           VP    VP  FI  L +  ++   +
Sbjct: 446 VPNNFIVPEAFINALNSESNLNRGF 470

>TBLA0B08790 Chr2 (2089746..2091101) [1356 bp, 451 aa] {ON}
           Anc_2.395 YMR136W
          Length = 451

 Score = 82.0 bits (201), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 2/88 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C +C     TPEWR GP G  R +CNACGL++RKL KKF    ANL ++YR      +RR
Sbjct: 366 CFYCSKTS-TPEWRRGPQG-NRTLCNACGLYYRKLIKKFGYENANLLLRYRNFISSTDRR 423

Query: 261 VPCTIEVPADFIKQLENNPSITGNYETR 288
           VP  ++VP  F+K L  + ++  ++  +
Sbjct: 424 VPTIVDVPNSFVKMLNEDETLNPDWSAK 451

>Kwal_14.1746 s14 complement(450643..451956) [1314 bp, 437 aa] {ON}
           YIR013C (GAT4) - very short and so far mRNA can't be
           detected [contig 237] FULL
          Length = 437

 Score = 80.9 bits (198), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 56/89 (62%), Gaps = 5/89 (5%)

Query: 181 TRATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFS 240
           T++  G K+     P     C+HC +  KTPEWR GPYG  R +CNACGLF++KL  KF 
Sbjct: 347 TKSRIGSKIRS---PRSSLQCAHCAS-TKTPEWRKGPYG-KRSLCNACGLFYKKLLHKFG 401

Query: 241 VREANLFMQYRLSQGGKNRRVPCTIEVPA 269
             +A + M+YR S   K+R+VP + +VP+
Sbjct: 402 FDQAAMIMKYRKSIFSKDRKVPRSFDVPS 430

>KLTH0H06314g Chr8 complement(553271..554539) [1269 bp, 422 aa] {ON}
           some similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2 Protein containing GATA family
           zinc finger motifs; similar to Gln3p and Dal80p;
           expression repressed by leucine
          Length = 422

 Score = 80.9 bits (198), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 51/73 (69%), Gaps = 2/73 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C+HC +  KTPEWR GP G  R +CNACGLF++KL +KF   +A++ M++R S   KNR+
Sbjct: 351 CAHCSS-TKTPEWRKGPCG-RRSLCNACGLFYKKLVRKFGDGQASMIMKHRKSISSKNRK 408

Query: 261 VPCTIEVPADFIK 273
           VP   +VP  F++
Sbjct: 409 VPHVFDVPHSFVQ 421

>NCAS0G03520 Chr7 (657612..658385) [774 bp, 257 aa] {ON} 
          Length = 257

 Score = 77.4 bits (189), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 55/89 (61%), Gaps = 2/89 (2%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGG 256
           D   C  CG+ E T +WR GPYG  R +CN CGL++RKL   F  ++AN  ++Y  ++  
Sbjct: 165 DDDQCRQCGDKE-TGQWRKGPYG-KRTLCNKCGLYYRKLVNDFKPKKANALLRYCKNKAL 222

Query: 257 KNRRVPCTIEVPADFIKQLENNPSITGNY 285
           ++RRVP  +E+P +F++ LE +  +   +
Sbjct: 223 QDRRVPKKVELPEEFLESLEEDKELDDEF 251

>TBLA0B09240 Chr2 complement(2185248..2189084) [3837 bp, 1278 aa] {ON}
            
          Length = 1278

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 2/85 (2%)

Query: 201  CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
            C HCG+   TPEWR GPYG    +CNACGLF+RK+ ++FS   ANL M  R  +   +RR
Sbjct: 1189 CLHCGD-TSTPEWRRGPYG-DGTLCNACGLFYRKIVRRFSAIGANLLMWLRKDRVPSDRR 1246

Query: 261  VPCTIEVPADFIKQLENNPSITGNY 285
            VP  IE+P   I +L  + +I  N+
Sbjct: 1247 VPLFIEIPGHLISRLCEDSNIDCNF 1271

>Kpol_385.3 s385 (7522..8601) [1080 bp, 359 aa] {ON} (7522..8601)
           [1080 nt, 360 aa]
          Length = 359

 Score = 71.6 bits (174), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (70%), Gaps = 2/62 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HCG+ E TPEWR GP G T  +CNACGLF++KL +K ++ +ANL M+ R +    NRR
Sbjct: 295 CLHCGDTE-TPEWRKGPSGPT-SLCNACGLFYKKLLEKSTLEDANLLMKERFNSNPYNRR 352

Query: 261 VP 262
           +P
Sbjct: 353 IP 354

>NCAS0C04570 Chr3 complement(935042..935572) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 68.2 bits (165), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 48/85 (56%), Gaps = 2/85 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C  C + E   +WR GPYG    +CN CGLF+ K+ K+F  R AN+ M+Y      ++R 
Sbjct: 85  CRQCSSSE-IGQWRRGPYG-PHTLCNKCGLFYSKVTKRFGSRSANMLMRYHREMSIEDRH 142

Query: 261 VPCTIEVPADFIKQLENNPSITGNY 285
           VP    +P DF+++L  +  +  N+
Sbjct: 143 VPQKCSIPMDFVERLLADEQLDPNF 167

>ZYRO0E01738g Chr5 complement(125883..127247) [1365 bp, 454 aa] {ON}
           some similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W
          Length = 454

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC + E TPEWR GP G T  +CNACGLF++KL KKF    A   M+ R ++  +NR+
Sbjct: 390 CLHCSSTE-TPEWRKGPSGPT-TLCNACGLFYKKLIKKFGEEVATSIMKSRQTEDPQNRK 447

Query: 261 VP 262
           +P
Sbjct: 448 IP 449

>Ecym_3059 Chr3 complement(110013..111413) [1401 bp, 466 aa] {ON}
           similar to Ashbya gossypii AAR174W
          Length = 466

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 6/81 (7%)

Query: 189 VYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFM 248
           V + P  M+   C  CG+   T EWRSGP G  + +CNACG+++ KLK++F   +A + M
Sbjct: 345 VVRDPKSMN---CLQCGS-RDTSEWRSGPLG-RKSMCNACGIWYMKLKQRFGEEDAAVIM 399

Query: 249 QY-RLSQGGKNRRVPCTIEVP 268
           +Y RL+    +RRVP   EVP
Sbjct: 400 EYRRLTNRHDDRRVPKKFEVP 420

>TDEL0G03430 Chr7 complement(633324..634625) [1302 bp, 433 aa] {ON} 
          Length = 433

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 2/62 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HC   + TPEWR GP G T  +CNACGLFF+KL KKF    A++ M+ R  +  ++R+
Sbjct: 369 CLHCAATD-TPEWRKGPVGPT-TLCNACGLFFKKLVKKFGPETASVIMKSRQDENPQDRK 426

Query: 261 VP 262
           VP
Sbjct: 427 VP 428

>NCAS0D01260 Chr4 complement(229646..230641) [996 bp, 331 aa] {ON}
           Anc_2.395
          Length = 331

 Score = 64.7 bits (156), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%), Gaps = 2/61 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C+HC  ++ TPEWR GP G  R +CNACG+F+RKL  +FS  EANL MQ +      +RR
Sbjct: 271 CTHCKEID-TPEWRRGPDG-CRTLCNACGIFYRKLLGRFSKEEANLKMQTQKLINPHDRR 328

Query: 261 V 261
           +
Sbjct: 329 I 329

>AAR174W Chr1 (657598..658980) [1383 bp, 460 aa] {ON} NOHBY117; No
           homolog in Saccharomyces cerevisiae
          Length = 460

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (62%), Gaps = 6/89 (6%)

Query: 189 VYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFM 248
           V + P  M+   C  CG+ + T EWRSGP G  + +CNACG+++ KLK++F   +A + M
Sbjct: 333 VIRDPKTMN---CLQCGSRD-TSEWRSGPLG-RKSMCNACGIWYMKLKQRFGEEDAAVIM 387

Query: 249 QY-RLSQGGKNRRVPCTIEVPADFIKQLE 276
           +Y RL+    +RRVP   EVP   +++++
Sbjct: 388 EYRRLTNRHDDRRVPKKFEVPLPEVEKVK 416

>NDAI0H01740 Chr8 complement(415810..417072) [1263 bp, 420 aa] {ON} 
          Length = 420

 Score = 63.9 bits (154), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 9/93 (9%)

Query: 200 PCSHCGNL--EKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGK 257
           P + CG    E+TPEWR GPYG   K+CN CGLF+RKL K+F        +++R    G+
Sbjct: 307 PSAKCGQCRDEETPEWRRGPYGKNNKLCNKCGLFYRKLCKRFGDYRGTAILRFRFR--GR 364

Query: 258 N----RRVPCTIEVPAD-FIKQLENNPSITGNY 285
           +    R +P T E   D ++ +L+ + ++  N+
Sbjct: 365 DYKGMRDMPTTSEELKDEYLDKLKEDKTLDQNF 397

>NDAI0H01910 Chr8 (467628..468887) [1260 bp, 419 aa] {ON} 
          Length = 419

 Score = 63.2 bits (152), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/93 (36%), Positives = 53/93 (56%), Gaps = 9/93 (9%)

Query: 200 PCSHCGNL--EKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGK 257
           P + CG    E+TPEWR GPYG   K+CN CGLF+RKL K+F        +++R    G+
Sbjct: 306 PSAKCGQCRDEETPEWRRGPYGKNNKLCNKCGLFYRKLCKRFGDYRGTAILRFRFR--GR 363

Query: 258 N----RRVPCTIEVPAD-FIKQLENNPSITGNY 285
           +    R +P T E   D ++ +L+ + ++  N+
Sbjct: 364 DYKGMRDMPTTSEELKDEYLDKLKEDKTLDQNF 396

>Smik_9.213 Chr9 complement(355801..356163) [363 bp, 120 aa] {ON}
           YIR013C (REAL)
          Length = 120

 Score = 58.2 bits (139), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 2/80 (2%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYR 251
           RP     K C  CG ++ + +WR GP G    +CNACGLFFRKL  +F    A  +M+ +
Sbjct: 43  RPRTGVTKTCGQCGEIKTSLQWREGPNG-AACLCNACGLFFRKLILRFGRAAAKRYME-Q 100

Query: 252 LSQGGKNRRVPCTIEVPADF 271
           +   G  RR+P  +   A F
Sbjct: 101 IKGTGTKRRIPKELTGTARF 120

>KLLA0F09757g Chr6 (898398..899156) [759 bp, 252 aa] {ON} some
           similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136W GAT2 Protein containing GATA family
           zinc finger motifs; similar to Gln3p and Dal80p
          Length = 252

 Score = 60.5 bits (145), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 31/71 (43%), Positives = 45/71 (63%), Gaps = 5/71 (7%)

Query: 190 YKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQ 249
           +KR  P   K C HC  +E T EWR+GP+G    +CNACGL++RKLKKKF+  ++ + M+
Sbjct: 118 FKREGP---KYCVHCECVE-TIEWRNGPWG-KATLCNACGLWYRKLKKKFTAEQSAIIME 172

Query: 250 YRLSQGGKNRR 260
            +     K+ R
Sbjct: 173 EKRLFSNKHDR 183

>Skud_9.191 Chr9 complement(350693..351079) [387 bp, 128 aa] {ON}
           YIR013C (REAL)
          Length = 128

 Score = 56.6 bits (135), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYR 251
           RP     + C  CG ++ + +WR GP G    +CNACGLFFRKL  +F    A  +M+ +
Sbjct: 51  RPRTGITRTCGQCGEIKTSLQWREGPNG-AACLCNACGLFFRKLVLRFGRAAAKRYME-Q 108

Query: 252 LSQGGKNRRVP 262
           +   G  RR+P
Sbjct: 109 IKGTGTKRRIP 119

>YIR013C Chr9 complement(380019..380384) [366 bp, 121 aa] {ON}
           GAT4Protein containing GATA family zinc finger motifs
          Length = 121

 Score = 56.2 bits (134), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 40/71 (56%), Gaps = 2/71 (2%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYR 251
           RP     + C  CG ++ + +WR GP G    +CNACGLFFRKL  +F    A  +M+ +
Sbjct: 44  RPRTGITRTCGQCGEIKTSLQWREGPNG-AACLCNACGLFFRKLILRFGRAAAKRYME-Q 101

Query: 252 LSQGGKNRRVP 262
           +   G  RR+P
Sbjct: 102 IKGTGTKRRIP 112

>CAGL0D03608g Chr4 complement(363465..364790) [1326 bp, 441 aa] {ON}
           no similarity
          Length = 441

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 41/63 (65%), Gaps = 3/63 (4%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANL-FMQYRLSQGGKNR 259
           C  CG ++ TPEWR+GP G    +CNACGLF++KLKK F+     + FMQ+R     ++R
Sbjct: 379 CLQCGKVD-TPEWRNGPQG-KATLCNACGLFYKKLKKYFADENMAIQFMQHRSIVDPEDR 436

Query: 260 RVP 262
            +P
Sbjct: 437 TMP 439

>Suva_9.224 Chr9 complement(367588..367947) [360 bp, 119 aa] {ON}
           YIR013C (REAL)
          Length = 119

 Score = 55.8 bits (133), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 42/80 (52%), Gaps = 2/80 (2%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYR 251
           RP     + C  CG ++ + +WR GP G    +CNACGLFFRKL  +F    A  +M+ +
Sbjct: 42  RPRTGITRTCGQCGEIKTSLQWREGPNG-AACLCNACGLFFRKLTLRFGRAAAKRYME-Q 99

Query: 252 LSQGGKNRRVPCTIEVPADF 271
           +      RR+P  +   A F
Sbjct: 100 IKGTAAKRRIPKELTGTARF 119

>Skud_16.312 Chr16 complement(583881..584309) [429 bp, 142 aa] {ON}
           YIR013C (REAL)
          Length = 142

 Score = 52.4 bits (124), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKN 258
           K CS C   + + +WR GP G +  +CNACGLF+RKL   F  + A  +++   + G K 
Sbjct: 71  KTCSQCNEKKSSSQWREGPTGRS-CLCNACGLFYRKLFLAFGKQSARRYLEETRNTGAK- 128

Query: 259 RRVPCTI 265
           RR+P T+
Sbjct: 129 RRIPRTL 135

>TPHA0O01160 Chr15 complement(225978..226589) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 53.1 bits (126), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKNRR 260
           C HCG + +T EWR GP G    +CN+CGLF+R+L    S  E  +  + R      +RR
Sbjct: 130 CVHCG-VTETVEWRKGPQG-NHTLCNSCGLFYRRLLGFTSYDETIMIFKERYKNNPTDRR 187

Query: 261 VPCTI 265
           +P  I
Sbjct: 188 IPVHI 192

>Suva_16.354 Chr16 complement(625042..625470) [429 bp, 142 aa] {ON}
           YIR013C (REAL)
          Length = 142

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 191 KRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQY 250
           +R      K C  C   + + +WR GP G +  +CNACGLF+RKL   F  + A  +++ 
Sbjct: 63  RREKASITKTCDQCKETKSSSQWREGPTGGS-CLCNACGLFYRKLFLAFGKQSAKRYLE- 120

Query: 251 RLSQGGKNRRVP 262
            +   G  RR+P
Sbjct: 121 EIKTTGARRRIP 132

>Smik_16.268 Chr16 complement(495302..495718) [417 bp, 138 aa] {ON}
           YLR013W (REAL)
          Length = 138

 Score = 50.4 bits (119), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%), Gaps = 2/64 (3%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQYRLSQGGKN 258
           K C+ C   + + +WR GP G +  +CNACGLF+RKL   F  + A  +++  +   G  
Sbjct: 67  KTCNQCKETKTSSQWREGPTGGS-CLCNACGLFYRKLFLAFGKQSAKRYLE-EIKNTGAK 124

Query: 259 RRVP 262
           RR+P
Sbjct: 125 RRIP 128

>Skud_12.81 Chr12 (163225..163647) [423 bp, 140 aa] {ON} YLR013W
           (REAL)
          Length = 140

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 6/64 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQY--RLSQGGKN 258
           C  C  ++ +P+WR GP G    +CNACGLF+RK+   F V   NL  +Y   +   G  
Sbjct: 71  CPQCAVVKTSPQWREGPDGEV-TLCNACGLFYRKI---FLVFGKNLAKRYFDEIKGVGVK 126

Query: 259 RRVP 262
           R+VP
Sbjct: 127 RKVP 130

>TBLA0A07280 Chr1 (1813951..1814466) [516 bp, 171 aa] {ON} 
          Length = 171

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 2/49 (4%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKKFSVREANLFMQ 249
           C+ CG ++ +PEWR  P G T  +CNACGL  +KL K +S      F++
Sbjct: 102 CTRCG-IKSSPEWRKNPQGET-SLCNACGLNLKKLTKAYSENGVRYFLK 148

>YLR013W Chr12 (171339..171764) [426 bp, 141 aa] {ON}  GAT3Protein
           containing GATA family zinc finger motifs
          Length = 141

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 1/35 (2%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKL 235
           C  C  ++ +P+WR GP G    +CNACGLF+RK+
Sbjct: 72  CPQCAVIKTSPQWREGPDGEV-TLCNACGLFYRKI 105

>Suva_10.93 Chr10 (177471..177899) [429 bp, 142 aa] {ON} YLR013W
           (REAL)
          Length = 142

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKL 235
           + C  C  ++ +P+WR GP G    +CNACGLF+RK+
Sbjct: 71  RKCPQCDVIKTSPQWREGPNGEV-TLCNACGLFYRKV 106

>Smik_12.76 Chr12 (158187..158660) [474 bp, 157 aa] {ON} YLR013W
           (REAL)
          Length = 157

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 25/37 (67%), Gaps = 1/37 (2%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKL 235
           + C  C  ++ +P+WR GP G    +CNACGLF+RK+
Sbjct: 86  RKCPQCAVVKTSPQWREGPDGEV-TLCNACGLFYRKI 121

>KAFR0I01960 Chr9 (401053..401247) [195 bp, 64 aa] {ON} 
          Length = 64

 Score = 38.1 bits (87), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 194 HPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKK 238
           H      C  C  LE TP+WRSGP G    +CN CGL++++  +K
Sbjct: 18  HRKQHDKCKMCFTLE-TPQWRSGPDG-PSTLCNKCGLYYKRQTRK 60

>ZYRO0F03520g Chr6 (300351..301334) [984 bp, 327 aa] {ON}
           uniprot|P87016 Zygosaccharomyces rouxii SAT1 DNA-
           binding protein
          Length = 327

 Score = 38.9 bits (89), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 4/39 (10%)

Query: 195 PMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           P D K C+HC +   TP WR  P G    +CNACGLF +
Sbjct: 241 PKDTK-CTHC-HTRTTPLWRRDPMG--NPLCNACGLFLK 275

>AFR513C Chr6 complement(1355811..1357217) [1407 bp, 468 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL021W
           (GAT1)
          Length = 468

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 23/38 (60%), Gaps = 4/38 (10%)

Query: 198 GKPCSHCGNL--EKTPEWRSGPYGFTRKICNACGLFFR 233
           GKP + C N   + TP WR GP G    +CNACGLF +
Sbjct: 283 GKPDTKCSNCMTKTTPLWRRGPQG--DPLCNACGLFLK 318

>NCAS0F03840 Chr6 (769692..772187) [2496 bp, 831 aa] {ON} Anc_3.539
           YER040W
          Length = 831

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 26/45 (57%), Gaps = 4/45 (8%)

Query: 189 VYKRPHPMDGKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           +  + + ++ KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 292 ISNQNNSLNKKPIIQCFNCKTFKTPLWRRDPQGNT--LCNACGLF 334

>KNAG0H02780 Chr8 (513375..513572) [198 bp, 65 aa] {ON} 
          Length = 65

 Score = 35.0 bits (79), Expect = 0.020,   Method: Composition-based stats.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 248 MQYRLSQGGKNRRVPCTIEVPADFIKQL 275
           M YR +   KNR+VP  I++P +FI QL
Sbjct: 1   MHYRKTHEVKNRKVPSVIDIPHEFIVQL 28

>YER040W Chr5 (229795..231987) [2193 bp, 730 aa] {ON}
           GLN3Transcriptional activator of genes regulated by
           nitrogen catabolite repression (NCR), localization and
           activity regulated by quality of nitrogen source
          Length = 730

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 192 RPHPMDGKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
            P   + KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 294 EPSGQNKKPLIQCFNCKTFKTPLWRRSPEGNT--LCNACGLF 333

>SAKL0B01826g Chr2 (179191..181242) [2052 bp, 683 aa] {ON} some
           similarities with uniprot|P43574 Saccharomyces
           cerevisiae YFL021W GAT1 Transcriptional activator of
           genes involved in nitrogen catabolite repression member
           of the GATA family of DNA binding proteins activity and
           localization regulated by nitrogen limitation and Ure2p
          Length = 683

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 26/52 (50%), Gaps = 4/52 (7%)

Query: 184 TGGGKVYKRPHPMDGKPCSHCGN--LEKTPEWRSGPYGFTRKICNACGLFFR 233
           + G      P+    KP + C N   + TP WR  P+G    +CNACGLF +
Sbjct: 403 SSGHSSNNNPYAPSNKPDTKCTNCHTKTTPLWRRDPHG--NPLCNACGLFLK 452

>CAGL0C02277g Chr3 complement(230496..232967) [2472 bp, 823 aa] {ON}
           weakly similar to uniprot|P18494 Saccharomyces
           cerevisiae YER040w GLN3 transcription factor for
           positive nitrogen regulation
          Length = 823

 Score = 38.1 bits (87), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 191 KRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           +RP   D   C +C    KTP WR  P G  + +CNACGLF
Sbjct: 328 ERPPDPDAVHCDNCKTY-KTPLWRRSPEG--KVLCNACGLF 365

>TDEL0C00810 Chr3 (134908..135945) [1038 bp, 345 aa] {ON} Anc_8.55
           YFL021W
          Length = 345

 Score = 37.4 bits (85), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 20/33 (60%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C N   TP WR  P G    +CNACGLF +
Sbjct: 188 CSNC-NTRTTPLWRRDPAG--NPLCNACGLFLK 217

>Suva_5.139 Chr5 (206012..208198) [2187 bp, 728 aa] {ON} YER040W
           (REAL)
          Length = 728

 Score = 37.7 bits (86), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 192 RPHPMDGKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
            P   + KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 293 EPSGQNKKPLIQCFNCKTFKTPLWRRSPEGNT--LCNACGLF 332

>Kpol_1011.14 s1011 complement(30640..30891,30894..31928) [1287 bp,
           428 aa] {ON} complement(30640..30891,30894..31928) [1287
           nt, 429 aa]
          Length = 428

 Score = 37.4 bits (85), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 8/49 (16%)

Query: 185 GGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           G   +Y+ P       C++C     TP WR  P G  R +CNACGLF++
Sbjct: 355 GSKTIYRDP-----LVCTNCE-TTNTPLWRRDPIG--RPLCNACGLFYK 395

>NDAI0G03250 Chr7 (766494..767987) [1494 bp, 497 aa] {ON} Anc_8.55
          Length = 497

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 20/33 (60%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C++CG    TP WR  P G    +CNACGLF +
Sbjct: 367 CNNCG-TGTTPLWRKDPNG--NSLCNACGLFLK 396

>Smik_5.164 Chr5 (234546..236747) [2202 bp, 733 aa] {ON} YER040W
           (REAL)
          Length = 733

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/42 (47%), Positives = 22/42 (52%), Gaps = 4/42 (9%)

Query: 192 RPHPMDGKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
            P     KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 297 EPSVQSKKPLIQCFNCKTFKTPLWRRSPEGNT--LCNACGLF 336

>KAFR0J00320 Chr10 complement(52668..54641) [1974 bp, 657 aa] {ON}
           Anc_3.539 YER040W
          Length = 657

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 22/39 (56%), Gaps = 6/39 (15%)

Query: 196 MDGKP---CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           M  KP   C +C  L KTP WR  P G    +CNACGLF
Sbjct: 251 MHKKPQIQCFNCKTL-KTPLWRRDPNG--NALCNACGLF 286

>Kwal_47.17980 s47 complement(634203..636368) [2166 bp, 721 aa] {ON}
           YFL021W (GAT1) - transcriptional activator with
           GATA-1-type Zn finger DNA-binding motif [contig 202]
           FULL
          Length = 721

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%), Gaps = 4/51 (7%)

Query: 183 ATGGGKVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           A  G  +    +  D K C++C + + TP WR  P+G    +CNACGLF +
Sbjct: 441 AGAGSSIGSTVNKTDTK-CTNC-HTKTTPLWRRDPHG--NPLCNACGLFLK 487

>Skud_5.149 Chr5 (227606..229801) [2196 bp, 731 aa] {ON} YER040W
           (REAL)
          Length = 731

 Score = 37.4 bits (85), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 301 KPLIQCFNCKTFKTPLWRRSPEGNT--LCNACGLF 333

>KNAG0C01440 Chr3 complement(282044..283426) [1383 bp, 460 aa] {ON}
           Anc_1.250 YJL110C
          Length = 460

 Score = 37.0 bits (84), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%)

Query: 191 KRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           ++  P  G  C +C  +  TP WR    G T  +CNACGLF +
Sbjct: 169 RKNSPHSGSICKNCATV-NTPLWRRDNEGNT--LCNACGLFLK 208

>KLLA0A01342g Chr1 complement(120385..122730) [2346 bp, 781 aa] {ON}
           some similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 781

 Score = 37.0 bits (84), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 20/31 (64%), Gaps = 3/31 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           C +C  L KTP WR  P G T  +CNACGLF
Sbjct: 349 CYNCKTL-KTPLWRRDPDGNT--LCNACGLF 376

>SAKL0F01496g Chr6 complement(124251..126668) [2418 bp, 805 aa] {ON}
           some similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 805

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 27/48 (56%), Gaps = 6/48 (12%)

Query: 188 KVYKRPHPMD--GKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
            + K P+ +D   KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 276 SIPKNPNSVDMPKKPQVQCFNCKTFKTPLWRRDPQGNT--LCNACGLF 321

>Kpol_1058.27 s1058 (80407..81861) [1455 bp, 484 aa] {ON}
           (80407..81861) [1455 nt, 485 aa]
          Length = 484

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%), Gaps = 3/37 (8%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           D   C +C     TP WR  P G    +CNACGLF++
Sbjct: 396 DDMICDNCK-TTNTPLWRRDPIG--NPLCNACGLFYK 429

>KLLA0F25300g Chr6 (2354118..2356196) [2079 bp, 692 aa] {ON} some
           similarities with uniprot|P43574 Saccharomyces
           cerevisiae YFL021W GAT1 Transcriptional activator of
           genes involved in nitrogen catabolite repression member
           of the GATA family of DNA binding proteins activity and
           localization regulated by nitrogen limitation and Ure2p
          Length = 692

 Score = 36.6 bits (83), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C + + TP WR  P G    +CNACGLF +
Sbjct: 471 CSNC-HTKTTPLWRRDPQG--NPLCNACGLFLK 500

>Ecym_2569 Chr2 (1112550..1115093) [2544 bp, 847 aa] {ON} similar to
           Ashbya gossypii AFR237W
          Length = 847

 Score = 36.6 bits (83), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 21/36 (58%), Gaps = 4/36 (11%)

Query: 198 GKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
            KP   C N +  KTP WR  P G T  +CNACGLF
Sbjct: 334 AKPQVQCFNCKTYKTPLWRRDPQGNT--LCNACGLF 367

>Skud_6.50 Chr6 (99142..100554) [1413 bp, 470 aa] {ON} YFL021W
           (REAL)
          Length = 470

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C     TP WR  P G    +CNACGLF +
Sbjct: 269 CSNCT-TSTTPLWRKDPKGL--PLCNACGLFLK 298

>KNAG0E03370 Chr5 (674614..676113) [1500 bp, 499 aa] {ON} Anc_8.55
           YFL021W
          Length = 499

 Score = 36.2 bits (82), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 3/39 (7%)

Query: 195 PMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           P D   CS+C     TP WR    G    +CNACGLF +
Sbjct: 402 PQDKIRCSNC-QTHNTPLWRKDAEG--NSLCNACGLFLK 437

>TPHA0B01250 Chr2 complement(278851..280035) [1185 bp, 394 aa] {ON}
           Anc_1.250 YJL110C
          Length = 394

 Score = 35.8 bits (81), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%), Gaps = 3/38 (7%)

Query: 196 MDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           +D   C++C    KTP WR   +G    +CNACGLF +
Sbjct: 39  LDKPVCNNCLT-SKTPLWRRDEFGSI--LCNACGLFLK 73

>Smik_6.57 Chr6 (111118..112689) [1572 bp, 523 aa] {ON} YFL021W
           (REAL)
          Length = 523

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C     TP WR  P G    +CNACGLF +
Sbjct: 316 CSNCT-TSTTPLWRKDPKGL--PLCNACGLFLK 345

>Smik_16.214 Chr16 (388331..388849) [519 bp, 172 aa] {ON} YPL021W
           (REAL)
          Length = 172

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 197 DGKP--CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKK 238
           +GKP  C+ CG+   T +WRSGP G   ++C+ CG+ +RK  +K
Sbjct: 126 NGKPKECATCGDTW-TSQWRSGPNG-NVELCSRCGIAYRKKMEK 167

>NCAS0C03920 Chr3 (795871..797250) [1380 bp, 459 aa] {ON} Anc_8.55
          Length = 459

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+CG    TP WR    G    +CNACGLF +
Sbjct: 346 CSNCG-TGTTPLWRKDANG--NSLCNACGLFLK 375

>Kpol_483.22 s483 (58125..60458) [2334 bp, 777 aa] {ON}
           (58125..60458) [2334 nt, 778 aa]
          Length = 777

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 19/31 (61%), Gaps = 3/31 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           C++C    KTP WR  P G    +CNACGLF
Sbjct: 320 CANCK-TSKTPLWRRDPQG--NVLCNACGLF 347

>KLTH0A03036g Chr1 complement(258170..260332) [2163 bp, 720 aa] {ON}
           conserved hypothetical protein
          Length = 720

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C++C + + TP WR  P G    +CNACGLF +
Sbjct: 461 CTNC-HTKTTPLWRRDPQG--NPLCNACGLFLK 490

>YFL021W Chr6 (95966..97498) [1533 bp, 510 aa] {ON}
           GAT1Transcriptional activator of genes involved in
           nitrogen catabolite repression; contains a GATA-1-type
           zinc finger DNA-binding motif; activity and localization
           regulated by nitrogen limitation and Ure2p
          Length = 510

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C     TP WR  P G    +CNACGLF +
Sbjct: 310 CSNCTT-STTPLWRKDPKGL--PLCNACGLFLK 339

>Skud_16.261 Chr16 (475931..476494) [564 bp, 187 aa] {ON} YPL021W
           (REAL)
          Length = 187

 Score = 34.7 bits (78), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 2/40 (5%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKK 238
           K C+ CG+   T +WRSGP G   ++C+ CG+ +RK  +K
Sbjct: 130 KECATCGDTW-TSQWRSGPEGNV-ELCSRCGIAYRKKMEK 167

>Suva_11.266 Chr11 (490833..491654) [822 bp, 273 aa] {ON} YKR034W
           (REAL)
          Length = 273

 Score = 35.0 bits (79), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           D   C +C  + KTP WR   +G    +CNACGLF +
Sbjct: 28  DHPTCQNCFTV-KTPLWRRDEHGTV--LCNACGLFLK 61

>SAKL0E12276g Chr5 complement(1016243..1016740) [498 bp, 165 aa]
           {ON} no similarity
          Length = 165

 Score = 34.3 bits (77), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 31/58 (53%), Gaps = 5/58 (8%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFT-RKICNACGLFFRKLKKKFSVREANLFMQYRLSQG 255
           + C +CG    TP WR  P   + ++ICNACGL++   K +  +R A L  +   S G
Sbjct: 16  RACGNCGTTS-TPLWRKPPPDISFQRICNACGLYY---KSRGKMRPAKLAYRNNSSMG 69

 Score = 33.5 bits (75), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 4/42 (9%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           RPH    + C +C +  +TP WR    G  R ICNACGL+ +
Sbjct: 72  RPHESSSR-CFNC-HTRQTPLWRRDAVG--RSICNACGLYLK 109

>Suva_16.297 Chr16 (514206..514745) [540 bp, 179 aa] {ON} YPL021W
           (REAL)
          Length = 179

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 2/36 (5%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRK 234
           K C+ CG+   T +WRSGP G   ++C+ CG+ +RK
Sbjct: 122 KECAACGDTW-TSQWRSGPDGNV-ELCSRCGIAYRK 155

>YPL021W Chr16 (511101..511664) [564 bp, 187 aa] {ON}
           ECM23Non-essential protein of unconfirmed function;
           affects pre-rRNA processing, may act as a negative
           regulator of the transcription of genes involved in
           pseudohyphal growth; homologous to Srd1p
          Length = 187

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 3/48 (6%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR-KLKKKFSVREAN 245
           K C+ CG+   T +WRSGP G   ++C+ CG+ +R K++KK   ++++
Sbjct: 130 KECATCGDTW-TSQWRSGPNG-NVELCSRCGIAYRKKMEKKIRSQQSS 175

>NDAI0B06110 Chr2 (1482402..1485524) [3123 bp, 1040 aa] {ON}
           Anc_3.539
          Length = 1040

 Score = 35.4 bits (80), Expect = 0.16,   Method: Composition-based stats.
 Identities = 19/35 (54%), Positives = 22/35 (62%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           KP + C N +  KTP WR  P G T  +CNACGLF
Sbjct: 372 KPMTICFNCKTTKTPLWRRDPQGNT--LCNACGLF 404

>Smik_11.296 Chr11 (496172..496981) [810 bp, 269 aa] {ON} YKR034W
           (REAL)
          Length = 269

 Score = 35.0 bits (79), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           D   C +C  + KTP WR   +G    +CNACGLF +
Sbjct: 27  DQPTCQNCFTV-KTPLWRRDEHGTV--LCNACGLFLK 60

>Suva_6.37 Chr6 (69498..71045) [1548 bp, 515 aa] {ON} YFL021W (REAL)
          Length = 515

 Score = 35.0 bits (79), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           CS+C     TP WR  P G    +CNACGLF +
Sbjct: 279 CSNCTT-STTPLWRKDPKGL--PLCNACGLFLK 308

>Skud_11.269 Chr11 (489067..489873) [807 bp, 268 aa] {ON} YKR034W
           (REAL)
          Length = 268

 Score = 34.7 bits (78), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           D   C +C  + KTP WR   +G    +CNACGLF +
Sbjct: 27  DHPTCQNCFTV-KTPLWRRDEHGTV--LCNACGLFLK 60

>Kwal_27.12655 s27 (1320535..1322217) [1683 bp, 560 aa] {ON} YJL110C
           (GZF3) - GATA zinc finger protein 3 homologous to Dal80
           in structure and function [contig 260] FULL
          Length = 560

 Score = 35.0 bits (79), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C  L  TP WR   +G    +CNACGLF +
Sbjct: 29  CKNCHTL-TTPLWRRNEHGAV--LCNACGLFLK 58

>Ecym_1456 Chr1 complement(938648..940621) [1974 bp, 657 aa] {ON}
           similar to Ashbya gossypii AFR513C
          Length = 657

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C++C + + TP WR  P G    +CNACGLF +
Sbjct: 445 CTNC-HTKTTPLWRRDPQG--NPLCNACGLFLK 474

>CAGL0K07634g Chr11 complement(754675..756054) [1380 bp, 459 aa]
           {ON} weakly similar to uniprot|P43574 Saccharomyces
           cerevisiae YFL021w transcriptional regulatory protein
           GAT1
          Length = 459

 Score = 35.0 bits (79), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%), Gaps = 5/34 (14%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRK-ICNACGLFFR 233
           C++CG    TP WR       RK +CNACGLFF+
Sbjct: 258 CTNCG-TTNTPLWRKD---IDRKPLCNACGLFFK 287

>TDEL0D06070 Chr4 (1095543..1097978) [2436 bp, 811 aa] {ON}
           Anc_3.539 YER040W
          Length = 811

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 23/39 (58%), Gaps = 6/39 (15%)

Query: 196 MDGKP---CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           M  KP   C +C   +KTP WR   +G T  +CNACGLF
Sbjct: 319 MQKKPPLLCFNC-KTQKTPLWRRDSHGNT--LCNACGLF 354

>KLTH0E15488g Chr5 (1377607..1379232) [1626 bp, 541 aa] {ON} some
           similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 541

 Score = 35.0 bits (79), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C  L  TP WR   +G    +CNACGLF +
Sbjct: 29  CKNCHTL-TTPLWRRNEHGAV--LCNACGLFLK 58

>YKR034W Chr11 (506898..507707) [810 bp, 269 aa] {ON}  DAL80Negative
           regulator of genes in multiple nitrogen degradation
           pathways; expression is regulated by nitrogen levels and
           by Gln3p; member of the GATA-binding family, forms
           homodimers and heterodimers with Deh1p
          Length = 269

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%), Gaps = 3/37 (8%)

Query: 197 DGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           D   C +C  + KTP WR   +G    +CNACGLF +
Sbjct: 27  DHPTCQNCFTV-KTPLWRRDEHGTV--LCNACGLFLK 60

>NDAI0B05160 Chr2 (1264852..1265931) [1080 bp, 359 aa] {ON}
           Anc_1.250
          Length = 359

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%)

Query: 201 CSHCGN--LEKTPEWRSGPYGFTRKICNACGLFFR 233
            +HC N   + TP WR    G    +CNACGLF +
Sbjct: 114 VTHCRNCFTQNTPLWRRDDMGTV--LCNACGLFLK 146

>KNAG0D02830 Chr4 (512472..514739) [2268 bp, 755 aa] {ON} Anc_3.539
           YER040W
          Length = 755

 Score = 34.3 bits (77), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 196 MDGKPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           M  KP   C N +  KTP WR    G T  +CNACGLF
Sbjct: 328 MHKKPTIQCFNCKTFKTPLWRRDTDGNT--LCNACGLF 363

>AFR237W Chr6 (866798..869221) [2424 bp, 807 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER040W (GLN3)
          Length = 807

 Score = 33.9 bits (76), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 21/35 (60%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           KP + C N +  KTP WR    G T  +CNACGLF
Sbjct: 325 KPQTQCFNCKTFKTPLWRRDLQGNT--LCNACGLF 357

>KAFR0A03410 Chr1 complement(695254..696264) [1011 bp, 336 aa] {ON}
           Anc_1.250 YJL110C
          Length = 336

 Score = 33.5 bits (75), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 4/39 (10%)

Query: 197 DGKPCSHCGN--LEKTPEWRSGPYGFTRKICNACGLFFR 233
           + K   HC N     TP WR    G    +CNACGLF +
Sbjct: 111 ESKDAHHCSNCLTTTTPLWRRDLDG--NILCNACGLFLK 147

>SAKL0D04928g Chr4 complement(379886..381064) [1179 bp, 392 aa] {ON}
           weakly similar to uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 392

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C +   TP WR   +G    +CNACGLF +
Sbjct: 33  CKNC-HTSTTPLWRRDEHGAV--LCNACGLFLK 62

>Kwal_47.19160 s47 (1115610..1117646) [2037 bp, 678 aa] {ON} YER040W
           (GLN3) - Transcriptional activator of nitrogen-regulated
           genes [contig 344] FULL
          Length = 678

 Score = 33.5 bits (75), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           KP   C N +  KTP WR    G T  +CNACGLF
Sbjct: 235 KPQVQCFNCKTFKTPLWRRDAQGNT--MCNACGLF 267

>Smik_10.128 Chr10 complement(201424..203082) [1659 bp, 552 aa] {ON}
           YJL110C (REAL)
          Length = 552

 Score = 33.5 bits (75), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C     TP WR   +G    +CNACGLF +
Sbjct: 131 CRNCS-TSTTPLWRRDEHGAV--LCNACGLFLK 160

>Ecym_6365 Chr6 (722796..724517) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR069C
          Length = 573

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C +   TP WR   +G    +CNACGLF +
Sbjct: 126 CKNC-HTSTTPLWRRDEHGAV--LCNACGLFLK 155

>KLTH0G01320g Chr7 complement(95197..97431) [2235 bp, 744 aa] {ON}
           weakly similar to uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 744

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           KP   C N +  KTP WR    G T  +CNACGLF
Sbjct: 252 KPQVQCFNCKTFKTPLWRRDAQGNT--MCNACGLF 284

>TPHA0A05930 Chr1 (1340674..1343112) [2439 bp, 812 aa] {ON}
           Anc_3.539 YER040W
          Length = 812

 Score = 33.1 bits (74), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           C++C    KTP WR    G    +CNACGLF
Sbjct: 331 CANCKTF-KTPLWRRDAQG--NILCNACGLF 358

>KAFR0C03380 Chr3 complement(688344..689252) [909 bp, 302 aa] {ON}
           Anc_8.55 YFL021W
          Length = 302

 Score = 32.7 bits (73), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 20/46 (43%), Gaps = 2/46 (4%)

Query: 188 KVYKRPHPMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           K+ K+P         H      TP WR    G    +CNACGLF R
Sbjct: 190 KIKKKPSSDTQVNICHNCQTSTTPLWRKDSEG--HPLCNACGLFLR 233

>KLLA0F21296g Chr6 (1990998..1992512) [1515 bp, 504 aa] {ON} some
           similarities with uniprot|P42944 Saccharomyces
           cerevisiae YJL110C GZF3 GATA zinc finger protein and
           Dal80p homolog that negatively regulates nitrogen
           catabolic gene expression by competing with Gat1p for
           GATA site binding function requires a repressive carbon
           source dimerizes with Dal80p and binds to Tor1p
          Length = 504

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 19/39 (48%), Gaps = 3/39 (7%)

Query: 195 PMDGKPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           P     C +C     TP WR   +G    +CNACGLF +
Sbjct: 78  PASNPVCKNCY-TSTTPLWRRDEHGSV--LCNACGLFLK 113

>AFR069C Chr6 complement(546145..547071) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR034W
           (DAL80) and YJL110C (GZF3)
          Length = 308

 Score = 32.7 bits (73), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C +   TP WR   +G    +CNACGLF +
Sbjct: 42  CQNC-HTSTTPLWRRDEHGAV--LCNACGLFLK 71

>Kpol_1016.12 s1016 complement(29363..30892) [1530 bp, 509 aa] {ON}
           complement(29363..30892) [1530 nt, 510 aa]
          Length = 509

 Score = 32.7 bits (73), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C    KTP WR    G    +CNACGLF +
Sbjct: 112 CKNCL-TSKTPLWRRDENGAI--LCNACGLFLK 141

>YCR018C Chr3 complement(148238..148903) [666 bp, 221 aa] {ON}
           SRD1Protein involved in the processing of pre-rRNA to
           mature rRNA; contains a C2/C2 zinc finger motif; srd1
           mutation suppresses defects caused by the rrp1-1
           mutation
          Length = 221

 Score = 32.3 bits (72), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFF-RKLKKK 238
           K CS C +   T +WRSGP    R++C+ CGL + ++LKK+
Sbjct: 166 KECSKCKDTW-TIQWRSGP-DQNRELCSPCGLAYGKRLKKE 204

>TBLA0E00400 Chr5 complement(73944..76853) [2910 bp, 969 aa] {ON}
           Anc_3.539 YER040W
          Length = 969

 Score = 32.7 bits (73), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 20/35 (57%), Gaps = 4/35 (11%)

Query: 199 KPCSHCGNLEK--TPEWRSGPYGFTRKICNACGLF 231
           KP   C N +   TP WR  P G T  +CNACGLF
Sbjct: 262 KPPIQCENCKTVTTPLWRRDPRGKT--LCNACGLF 294

>ZYRO0E08910g Chr5 (711088..713649) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P18494 Saccharomyces
           cerevisiae YER040W GLN3 Transcriptional activator of
           genes regulated by nitrogen catabolite repression (NCR)
           localization and activity regulated by quality of
           nitrogen source
          Length = 853

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 3/31 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLF 231
           C +C    KTP WR    G T  +CNACGLF
Sbjct: 325 CYNC-KTNKTPLWRRDAQGNT--MCNACGLF 352

>NCAS0B07810 Chr2 (1483287..1483889) [603 bp, 200 aa] {ON} Anc_1.250
          Length = 200

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 3/33 (9%)

Query: 201 CSHCGNLEKTPEWRSGPYGFTRKICNACGLFFR 233
           C +C    +TP WR    G    +CNACGLF +
Sbjct: 25  CQNCS-ATRTPLWRRDLNGTV--LCNACGLFLK 54

>Smik_3.106 Chr3 complement(148337..149002) [666 bp, 221 aa] {ON}
           YCR018C (REAL)
          Length = 221

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFF-RKLKKK 238
           K CS C +   T +WRSGP    R++C+ CGL + ++LKK+
Sbjct: 166 KACSKCKDTW-TIQWRSGPEQ-NRELCSPCGLAYGKRLKKE 204

>Suva_3.45 Chr3 complement(62203..62871) [669 bp, 222 aa] {ON}
           YCR018C (REAL)
          Length = 222

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 24/40 (60%), Gaps = 2/40 (5%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFFRKLKKK 238
           K C+ C +   T +WRSGP    R++C+ CGL + K  KK
Sbjct: 166 KECAKCRDTW-TIQWRSGP-AHNRELCSPCGLAYGKRMKK 203

>Kpol_1043.42 s1043 (83527..86493) [2967 bp, 988 aa] {ON}
           (83527..86493) [2967 nt, 989 aa]
          Length = 988

 Score = 31.6 bits (70), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 2/59 (3%)

Query: 31  STLLAAAELLEKQDGESVSDEKKPRLLMYD--RVITQNAITGQHSARVQPDGSLVFAPR 87
           ST+   AE  +  D     +E    L+     R++ +NAIT Q S +VQP   +V  PR
Sbjct: 326 STVALDAEHYDVNDNPENDNEVDANLIADSQRRLLAENAITAQKSNKVQPTARVVAIPR 384

>Skud_3.86 Chr3 complement(130892..131560) [669 bp, 222 aa] {ON}
           YCR018C (REAL)
          Length = 222

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 3/41 (7%)

Query: 199 KPCSHCGNLEKTPEWRSGPYGFTRKICNACGLFF-RKLKKK 238
           K C+ C +   T +WRSGP    R++C+ CGL + ++LKK+
Sbjct: 165 KKCAKCKDTW-TIQWRSGP-DHNRELCSPCGLAYGKRLKKE 203

>TBLA0I03360 Chr9 (812803..815988) [3186 bp, 1061 aa] {ON} Anc_3.539
           YER040W
          Length = 1061

 Score = 31.2 bits (69), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/30 (56%), Positives = 19/30 (63%), Gaps = 4/30 (13%)

Query: 204 CGNLE--KTPEWRSGPYGFTRKICNACGLF 231
           CGN +  KTP WR    G T  +CNACGLF
Sbjct: 423 CGNCKTTKTPLWRRDNDGNT--LCNACGLF 450

>TBLA0F01250 Chr6 complement(311865..313223) [1359 bp, 452 aa] {ON}
           Anc_4.283 YKL185W
          Length = 452

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%), Gaps = 2/48 (4%)

Query: 192 RPHPMDGKPCSHCGNLEKTPEWRSGPYGF-TRKICNACGLFFRKLKKK 238
           RP     + C  C + + +P WR    G  T+++CN+CGL ++K K +
Sbjct: 357 RPSRRHHRQCLSCRSTD-SPCWRPSWSGLKTQQLCNSCGLRYKKTKTR 403

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.428 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,531,928
Number of extensions: 1082370
Number of successful extensions: 2229
Number of sequences better than 10.0: 130
Number of HSP's gapped: 2200
Number of HSP's successfully gapped: 131
Length of query: 291
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 182
Effective length of database: 40,982,805
Effective search space: 7458870510
Effective search space used: 7458870510
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)