Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011906.23ON38038019930.0
KAFR0A050806.23ON31130214330.0
KNAG0K01400singletonON30930512781e-177
NDAI0C026206.23ON31130812141e-167
NCAS0D021706.23ON31030211971e-165
CAGL0F01815gsingletonON31430811491e-157
SAKL0E01342g6.23ON34129811311e-154
NDAI0D008306.23ON37430010861e-147
TPHA0M002806.23ON30329110751e-146
KNAG0D02240singletonON35933410741e-145
Kpol_1061.27singletonON30629610541e-143
NCAS0H008406.23ON36029210581e-143
ZYRO0C07722g6.23ON37334510551e-142
Kpol_385.5singletonON30629610481e-142
TDEL0G044606.23ON36929610521e-142
CAGL0I08151gsingletonON38229510491e-141
KLTH0C11154g6.23ON30530410221e-138
Kwal_56.224396.23ON32030110131e-137
KLLA0D01243g6.23ON3113019971e-134
KAFR0G026806.23ON3832949861e-132
CAGL0C03047g3.516ON1027120731.7
NDAI0C045905.398ON27251721.8
Kwal_26.85248.611ON39499686.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01190
         (380 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {...   772   0.0  
KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {...   556   0.0  
KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {O...   496   e-177
NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23      472   e-167
NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON...   465   e-165
CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {O...   447   e-157
SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conser...   440   e-154
NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {O...   422   e-147
TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}...   418   e-146
KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {O...   418   e-145
Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON} (79476.....   410   e-143
NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {O...   412   e-143
ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conser...   410   e-142
Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..137...   408   e-142
TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON}              409   e-142
CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly...   408   e-141
KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserv...   398   e-138
Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {O...   394   e-137
KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {O...   388   e-134
KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23     384   e-132
CAGL0C03047g Chr3 (300099..303182) [3084 bp, 1027 aa] {ON} highl...    33   1.7  
NDAI0C04590 Chr3 (1048881..1049699) [819 bp, 272 aa] {ON} Anc_5....    32   1.8  
Kwal_26.8524 s26 complement(824956..826140) [1185 bp, 394 aa] {O...    31   6.7  

>KNAG0M01190 Chr13 complement(216456..217598) [1143 bp, 380 aa] {ON}
           Anc_6.23
          Length = 380

 Score =  772 bits (1993), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/380 (97%), Positives = 372/380 (97%)

Query: 1   MTDLLCQLCSVRFLLDSSHIKGRGTCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYSTI 60
           MTDLLCQLCSVRFLLDSSHIKGRGTCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYSTI
Sbjct: 1   MTDLLCQLCSVRFLLDSSHIKGRGTCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYSTI 60

Query: 61  SPXXXXXXXXEMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSH 120
           SP        EMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSH
Sbjct: 61  SPTTTATTTTEMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSH 120

Query: 121 PAGFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMEN 180
           PAGFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMEN
Sbjct: 121 PAGFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMEN 180

Query: 181 GDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELA 240
           GDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELA
Sbjct: 181 GDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELA 240

Query: 241 YTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIR 300
           YTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIR
Sbjct: 241 YTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIR 300

Query: 301 GMVDDDDTEFAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSI 360
           GMVDDDDTEFAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSI
Sbjct: 301 GMVDDDDTEFAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSI 360

Query: 361 RNGILEKDVPAFEAAGEAKK 380
           RNGILEKDVPAFEAAGEAKK
Sbjct: 361 RNGILEKDVPAFEAAGEAKK 380

>KAFR0A05080 Chr1 complement(1009747..1010682) [936 bp, 311 aa] {ON}
           Anc_6.23
          Length = 311

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/302 (85%), Positives = 283/302 (93%)

Query: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134
           FRTI KHF+A EQEEGVGARVRRSVGSMRQRNF+PFLLLDHFTVSHPAGFPDHPHHGQET
Sbjct: 10  FRTINKHFVAVEQEEGVGARVRRSVGSMRQRNFTPFLLLDHFTVSHPAGFPDHPHHGQET 69

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITYVR GMIAHEDF GSKG+LRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP
Sbjct: 70  ITYVRNGMIAHEDFTGSKGILRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 129

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254
           ++MKDC PRYRNLRG EIPI EPNEHLK+KVISG+S+G++SVKELAYTPVDFYH+IS+KK
Sbjct: 130 QEMKDCEPRYRNLRGGEIPIVEPNEHLKVKVISGRSYGVESVKELAYTPVDFYHFISNKK 189

Query: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314
           GT FVQ+ P NFN FLYVMKG+VKI  + FPQYST+F+NA+G+ I+G+V DDDTEFAIIG
Sbjct: 190 GTDFVQQTPENFNFFLYVMKGSVKIGDETFPQYSTIFFNADGNGIKGVVSDDDTEFAIIG 249

Query: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEA 374
           GLILDQPVIQHGPF+E+TREK+IEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP FE 
Sbjct: 250 GLILDQPVIQHGPFIESTREKLIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPKFEG 309

Query: 375 AG 376
           + 
Sbjct: 310 SA 311

>KNAG0K01400 Chr11 complement(280379..281308) [930 bp, 309 aa] {ON} 
          Length = 309

 Score =  496 bits (1278), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 226/305 (74%), Positives = 270/305 (88%)

Query: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134
           FR++QK F A EQ EGVGA VRRS+G  RQRNFSPFLLLDHFTVSHP+GFPDHPHHGQET
Sbjct: 5   FRSVQKAFRALEQAEGVGALVRRSIGVRRQRNFSPFLLLDHFTVSHPSGFPDHPHHGQET 64

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITY+++GMIAHEDF GSKG+LRPGDLQFMTAGKGI+HSEIPVL ++  A VGLQLWVDLP
Sbjct: 65  ITYIQQGMIAHEDFTGSKGILRPGDLQFMTAGKGIVHSEIPVLTKDAKAAVGLQLWVDLP 124

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254
           K+MKDC PRYRNLR +EIPIA+PNEHLK+KVISGKS+G++SVKELAYTPVDFYHYISDK+
Sbjct: 125 KNMKDCPPRYRNLRASEIPIAQPNEHLKVKVISGKSYGVESVKELAYTPVDFYHYISDKE 184

Query: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314
           G  FVQE+P N+N FLYVM+G+V +DGQ +PQYST+FYNANG+AI+G+  + +TEFAII 
Sbjct: 185 GINFVQEIPENYNAFLYVMEGSVVVDGQEYPQYSTIFYNANGNAIKGVTGEKNTEFAIIA 244

Query: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEA 374
           GLILDQ ++QHGPFVET+ EK+ EVF+N+Q+GINGFE+A+ W+SSI NGI EKD+  FE+
Sbjct: 245 GLILDQDIVQHGPFVETSPEKMKEVFRNYQWGINGFEKAINWESSIINGITEKDITNFES 304

Query: 375 AGEAK 379
             + K
Sbjct: 305 QPKEK 309

>NDAI0C02620 Chr3 (608649..609584) [936 bp, 311 aa] {ON} Anc_6.23
          Length = 311

 Score =  472 bits (1214), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 218/308 (70%), Positives = 266/308 (86%), Gaps = 1/308 (0%)

Query: 71  EMPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHH 130
           ++P+ R++ K+FIA EQEEGVGA VRRS+GSM+QRNFSPFLL+DHFTVSHPAGFPDHPHH
Sbjct: 3   KVPQIRSVAKNFIAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDHFTVSHPAGFPDHPHH 62

Query: 131 GQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLW 190
           GQETITYV  GMIAHEDF GSKGVLRPGDLQFMTAGK IMHSEIPV MENG  G+G+QLW
Sbjct: 63  GQETITYVLNGMIAHEDFTGSKGVLRPGDLQFMTAGKAIMHSEIPVKMENGTPGIGIQLW 122

Query: 191 VDLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYI 250
           V LP D+K+  PRYRNLRG +IPI +PNE+L ++VISGKS+G +SVK+LAYTP+D+Y + 
Sbjct: 123 VALPIDLKNSEPRYRNLRGDKIPIIKPNENLTVRVISGKSYGTESVKDLAYTPIDYYIFN 182

Query: 251 SDKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGM-VDDDDTE 309
            +KKG  F QE P NFN FLY+ KGAV+I+G V+P+YSTVF++ +GD+I+G    D++TE
Sbjct: 183 MNKKGVEFFQETPRNFNFFLYITKGAVEINGVVYPKYSTVFFDTDGDSIKGKSAADEETE 242

Query: 310 FAIIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           FAIIGGLILDQP++QHGPFVET RE +++VF+N+QY INGFERA GW+SSI +GILEKDV
Sbjct: 243 FAIIGGLILDQPILQHGPFVETDRESLLQVFKNYQYCINGFERARGWRSSIADGILEKDV 302

Query: 370 PAFEAAGE 377
           PAFE + +
Sbjct: 303 PAFEKSSK 310

>NCAS0D02170 Chr4 complement(403949..404881) [933 bp, 310 aa] {ON}
           Anc_6.23
          Length = 310

 Score =  465 bits (1197), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 211/302 (69%), Positives = 258/302 (85%)

Query: 74  EFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQE 133
           +FR++ K F+A EQEEGVGA VRRS+GSM+QRNFSPFLL+D+FTVSHPAGFPDHPHHGQE
Sbjct: 6   QFRSVLKSFVAIEQEEGVGAHVRRSIGSMKQRNFSPFLLMDNFTVSHPAGFPDHPHHGQE 65

Query: 134 TITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDL 193
           TITYV +GMIAHEDF GS+GVLRPGDLQFMTAGK IMHSEIPV M NGDAG+G+QLWVDL
Sbjct: 66  TITYVLKGMIAHEDFTGSRGVLRPGDLQFMTAGKAIMHSEIPVQMNNGDAGIGIQLWVDL 125

Query: 194 PKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDK 253
           PK +K+C PRYRNLR TEIPI +PN+ L ++V+SGKS+G++SVK+LAYTP+D+Y   + K
Sbjct: 126 PKKLKNCEPRYRNLRATEIPIVKPNDDLTVRVVSGKSYGVESVKDLAYTPIDYYFMNTKK 185

Query: 254 KGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAII 313
            GT FVQE P +FNVFLY++KG+VKI+  V PQYST+F+  +GDAI+G    +DTEF ++
Sbjct: 186 TGTEFVQEFPADFNVFLYIIKGSVKINDTVHPQYSTIFFKTDGDAIKGCSASEDTEFVLV 245

Query: 314 GGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFE 373
           GG ILDQP+IQHGPFVE+ RE ++EVF+N+QY INGFERA GW+S I +GI E DV AFE
Sbjct: 246 GGQILDQPIIQHGPFVESDRESLLEVFKNYQYCINGFERARGWRSRIADGIHEDDVEAFE 305

Query: 374 AA 375
            +
Sbjct: 306 KS 307

>CAGL0F01815g Chr6 complement(179470..180414) [945 bp, 314 aa] {ON}
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii
          Length = 314

 Score =  447 bits (1149), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 209/308 (67%), Positives = 251/308 (81%)

Query: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131
           M  +R+IQKHF+  EQEEGVGARVRRSVG+M+QR FSPFL+LD F V HPAGFPDHPHHG
Sbjct: 1   MTTYRSIQKHFMTFEQEEGVGARVRRSVGTMKQRMFSPFLMLDDFYVKHPAGFPDHPHHG 60

Query: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191
           QETITYV  GM+AHEDF G+KGVL  GDLQFMTAGKGI+HSEIPV ME+G+A  GLQ WV
Sbjct: 61  QETITYVLNGMVAHEDFTGAKGVLGKGDLQFMTAGKGIVHSEIPVQMESGEACHGLQFWV 120

Query: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251
           DLPKD+K C PRYRNLRG +IP+  PNE+L +KVISGKS+G+DSV++LAYTP+  YHY++
Sbjct: 121 DLPKDLKWCEPRYRNLRGDKIPVVRPNENLTVKVISGKSYGVDSVRDLAYTPIHMYHYLT 180

Query: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311
           +K GT + QE P NFNVF+YVMKG V +  QVFP+++ VF+N +GDA++G    DD +FA
Sbjct: 181 NKAGTQWEQEFPKNFNVFMYVMKGKVSVGDQVFPEHTAVFFNTDGDAVKGEFATDDAQFA 240

Query: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPA 371
           I+GG ILDQ  IQHGPFVET RE +++VF N+QYGINGFERA GW+SSI +GI EK V  
Sbjct: 241 IMGGQILDQQTIQHGPFVETDRESLMKVFMNYQYGINGFERAKGWQSSIIHGITEKQVRE 300

Query: 372 FEAAGEAK 379
            EA G  K
Sbjct: 301 NEAKGLYK 308

>SAKL0E01342g Chr5 (101847..102872) [1026 bp, 341 aa] {ON} conserved
           hypothetical protein
          Length = 341

 Score =  440 bits (1131), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 196/298 (65%), Positives = 253/298 (84%)

Query: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131
           M + RTI KHF+A EQ EGVGARVRRS+G+ + RNF+PFL+LDHF V+ PAGFPDHPHHG
Sbjct: 37  MSKVRTIYKHFVAVEQSEGVGARVRRSIGTTQLRNFTPFLMLDHFNVTPPAGFPDHPHHG 96

Query: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191
           QETITYV  GM+AHEDF GSKGVLRPGDLQFMTAGKGI+HSEIPV ME+G+  VGLQLWV
Sbjct: 97  QETITYVLGGMMAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEIPVKMESGEPTVGLQLWV 156

Query: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251
           DLP+ +K+C PRYR+LRG E PIAEP+++LK++VISG+S+G+ S  ELAYTPV FYH+IS
Sbjct: 157 DLPERLKNCEPRYRDLRGAETPIAEPHQNLKVRVISGESYGVQSRSELAYTPVHFYHFIS 216

Query: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311
            KKGT F Q+ P +FNVF+YV+KG++ ++ + FPQYS +F+  +G+ + G+   DDTEFA
Sbjct: 217 SKKGTPFEQKFPEDFNVFMYVLKGSLTLNSKNFPQYSAIFFKNDGEGVEGIAASDDTEFA 276

Query: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           ++GG IL+QPV+QHGPFVET++E++I+VFQ++Q+G+NGFERA  WKSSI +GI +++ 
Sbjct: 277 LVGGSILEQPVVQHGPFVETSKERMIQVFQDYQFGMNGFERAHNWKSSISDGISQQNA 334

>NDAI0D00830 Chr4 complement(188085..189209) [1125 bp, 374 aa] {ON}
           Anc_6.23
          Length = 374

 Score =  422 bits (1086), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 199/300 (66%), Positives = 242/300 (80%), Gaps = 3/300 (1%)

Query: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPA-GFPDHPHHGQET 134
           RTI K+FI  EQ EGVGARVRR++G+     F PFL+LDHF V+ P  GFPDHPHHGQET
Sbjct: 73  RTILKYFIPDEQSEGVGARVRRAIGTNEMPRFPPFLMLDHFKVTPPEQGFPDHPHHGQET 132

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITY+ +GMIAHEDF GSKGVLRPGDLQFMTAGKGI+HSE+PVLM++G  G+GLQLWVDLP
Sbjct: 133 ITYILDGMIAHEDFTGSKGVLRPGDLQFMTAGKGIVHSEMPVLMKDGRPGIGLQLWVDLP 192

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNE--HLKIKVISGKSHGIDSVKELAYTPVDFYHYISD 252
           +++K+C PRYRNLR  EIPI   ++  H+ +KVISG ++G+DSV++LAYTP+ FYHYISD
Sbjct: 193 RELKNCEPRYRNLRKNEIPIVHTDDEKHMTVKVISGNAYGVDSVRDLAYTPIHFYHYISD 252

Query: 253 KKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAI 312
           K G  F Q VP +FNVFLYVMKGAV ID Q+F Q + VF+N +G +I+G    +DTEFAI
Sbjct: 253 KAGVEFKQSVPDDFNVFLYVMKGAVVIDDQIFKQNTAVFFNVDGHSIKGQSATNDTEFAI 312

Query: 313 IGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAF 372
           IGG ILDQP++QHGPFVETTRE + +VF+N+Q GINGFERAV W+SSI +GI E    A 
Sbjct: 313 IGGKILDQPLVQHGPFVETTREDLYKVFENYQQGINGFERAVNWRSSIADGIDEDTANAL 372

>TPHA0M00280 Chr13 complement(55778..56689) [912 bp, 303 aa] {ON}
           Anc_6.23
          Length = 303

 Score =  418 bits (1075), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 241/291 (82%)

Query: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135
           R+I KHFIA EQ EGVGARVRRS+G+ + R FSPFL+LDHF V  PAGFPDHPHHGQETI
Sbjct: 6   RSILKHFIAQEQAEGVGARVRRSIGTAKMRKFSPFLMLDHFNVIPPAGFPDHPHHGQETI 65

Query: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195
           TYVR+GM+AHEDF GSKG+LRPGDLQFMTAGK + HSE+PVLMENG+   GLQLWVDLP 
Sbjct: 66  TYVRKGMVAHEDFTGSKGILRPGDLQFMTAGKAVCHSEMPVLMENGEILDGLQLWVDLPT 125

Query: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255
           ++K+  PRYR+L    IPIA+P+E+L+I+VISGKS+GI+SVK+LAYTPVDFY Y + KKG
Sbjct: 126 NLKNTEPRYRDLHKENIPIAKPDENLEIEVISGKSYGIESVKDLAYTPVDFYVYKARKKG 185

Query: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315
           + F Q+   ++NVFLY++KG+V I  +VFPQ+S++F+N +GD ++G+V  DDTEFAIIGG
Sbjct: 186 SAFTQDFSRDYNVFLYIVKGSVAIGNEVFPQHSSIFFNTDGDNVQGIVGSDDTEFAIIGG 245

Query: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILE 366
            IL Q  +QHGPFVE T EK+++VF N++    GFERA+ W+SSIRNGI E
Sbjct: 246 QILRQETVQHGPFVEETVEKLVKVFHNYESYTGGFERALNWRSSIRNGIDE 296

>KNAG0D02240 Chr4 complement(385803..386882) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score =  418 bits (1074), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 198/334 (59%), Positives = 250/334 (74%), Gaps = 3/334 (0%)

Query: 39  FSLYSTQNTIQYRRVVHCYSTISPXXXXXXXXEMP---EFRTIQKHFIAGEQEEGVGARV 95
           FS Y     I    VV  Y   +          MP   + R+I  HFI  E  EGVGARV
Sbjct: 21  FSTYKKAALIFLFSVVLYYFYPTRTNTTNNDYTMPSLFKLRSIANHFIPREVAEGVGARV 80

Query: 96  RRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETITYVREGMIAHEDFLGSKGVL 155
           +RSVGSM+QR F+PFL+LD FTV  P+GFPDHPHHGQETITYV +G+IAHEDF GSKGVL
Sbjct: 81  KRSVGSMQQRRFTPFLMLDDFTVKSPSGFPDHPHHGQETITYVIDGLIAHEDFTGSKGVL 140

Query: 156 RPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRYRNLRGTEIPIA 215
           RPGDLQFMTAGKGI+HSE+PV ME+G    GLQLWVDLPKD+K+C PRYRNLR  +IP+ 
Sbjct: 141 RPGDLQFMTAGKGIVHSEMPVEMEDGRPARGLQLWVDLPKDLKNCEPRYRNLRSEDIPVV 200

Query: 216 EPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKGTGFVQEVPTNFNVFLYVMKG 275
           +P+E+L+++VISGKS+G +SVK+LAYTP+DFY+ ++ K GT F QE+P++FN FLYVMKG
Sbjct: 201 KPHENLEVRVISGKSYGTESVKDLAYTPIDFYYMLASKAGTEFAQEIPSDFNAFLYVMKG 260

Query: 276 AVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGGLILDQPVIQHGPFVETTREK 335
           +V I+ +VF Q + +F++ +G+ + G    DDTEFAIIGG ILDQP++QHGPFVET +EK
Sbjct: 261 SVVINEKVFKQNTAIFFDTDGEGVAGQAGSDDTEFAIIGGKILDQPLVQHGPFVETDQEK 320

Query: 336 IIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           + E F N++    GFERA GW+S I +GI E + 
Sbjct: 321 LYEAFMNYEGYTKGFERAKGWRSDIASGINESEA 354

>Kpol_1061.27 s1061 (79476..80396) [921 bp, 306 aa] {ON}
           (79476..80396) [921 nt, 307 aa]
          Length = 306

 Score =  410 bits (1054), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 196/296 (66%), Positives = 233/296 (78%)

Query: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134
            R+I KHFI+ EQ EGVGARVRRS+G+M  R FSPFL+LDHF V+  AGFPDHPHHGQET
Sbjct: 7   LRSIFKHFISREQSEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITYV EGMIAHEDF G KGVL  GDLQFMTAGK I H+E+PV   +G+  VGLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLGKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254
            DMK+  PRYR+LR  +IP A P + L+I+VISG S+G+DSVK+LAYTP+DFY Y   K 
Sbjct: 127 TDMKNTEPRYRDLRNKDIPRANPTDDLEIEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314
           GT F Q+   +FNVF+YV+KGAV I  QVFPQYS++F+N +GDA+ G V  DDTEFAIIG
Sbjct: 187 GTEFTQKFSRDFNVFIYVLKGAVNIGDQVFPQYSSIFFNTDGDAVGGTVAADDTEFAIIG 246

Query: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP 370
           G ILDQ  +QHGPFVE T+EK+I+VF ++Q   NGFERA  W+SSIR+GI E D P
Sbjct: 247 GKILDQETVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWRSSIRDGIKEDDAP 302

>NCAS0H00840 Chr8 complement(153671..154753) [1083 bp, 360 aa] {ON}
           Anc_6.23
          Length = 360

 Score =  412 bits (1058), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/292 (65%), Positives = 233/292 (79%)

Query: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135
           R+I KHFIA EQ EG GA VRRSVGS +   FSPFL+LD F V+ P GFPDHPHHGQETI
Sbjct: 62  RSILKHFIAEEQSEGDGATVRRSVGSYQMTRFSPFLMLDDFKVTPPEGFPDHPHHGQETI 121

Query: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195
           TYV  G++AHEDF GSKGVL PGDLQFMTAGKGI+H E+PV M +     GLQ WVDLP 
Sbjct: 122 TYVTGGILAHEDFTGSKGVLYPGDLQFMTAGKGIVHCEMPVTMNDSAVSTGLQFWVDLPA 181

Query: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255
           D+K+C PRYRNLR   IP+ + N++L +KVISGKS+ ++SVK+LAYTP+DFY++IS+K G
Sbjct: 182 DLKNCEPRYRNLRADTIPVVQVNDNLNVKVISGKSYDVESVKDLAYTPIDFYYFISNKAG 241

Query: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315
           T F QE+P +FN F+YV KGA+ I  +VF  +S+VF+  +G+ IRG    D+TEFA+IGG
Sbjct: 242 TEFAQEIPPDFNAFIYVTKGAITIGEEVFKVHSSVFFQTDGNFIRGFTASDNTEFAVIGG 301

Query: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEK 367
            ILDQ V+QHGPFVETTREK+IEVF N++ GINGFE+A+GWKSSI NGI E+
Sbjct: 302 KILDQQVVQHGPFVETTREKLIEVFDNYRAGINGFEKALGWKSSISNGIDEQ 353

>ZYRO0C07722g Chr3 (585947..587068) [1122 bp, 373 aa] {ON} conserved
           hypothetical protein
          Length = 373

 Score =  410 bits (1055), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 194/345 (56%), Positives = 252/345 (73%), Gaps = 7/345 (2%)

Query: 25  TCWFIGKRSSFSQLFSLYSTQNTIQYRRVVHCYSTISPXXXXXXXXEMPEFRTIQKHFIA 84
           +C ++       QLFS  S Q       + + ++            +    R++ K+FIA
Sbjct: 30  SCSYLTSNKDNKQLFSFLSGQEQNPKEPINYQFND-------GIMSKSISVRSVLKNFIA 82

Query: 85  GEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETITYVREGMIA 144
            EQEEGVGARVRRS+G+M+ R F PFL+LD F V  PAGFPDHPHHGQETITY  +GMIA
Sbjct: 83  IEQEEGVGARVRRSIGTMKMRRFPPFLMLDDFFVKPPAGFPDHPHHGQETITYNLKGMIA 142

Query: 145 HEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRY 204
           HEDF GSKGVL PGDLQFMTAGKGI+HSEIPV +E+G A  GLQLWVDLP ++K+C PRY
Sbjct: 143 HEDFTGSKGVLFPGDLQFMTAGKGIVHSEIPVSLEDGSASNGLQLWVDLPAELKNCEPRY 202

Query: 205 RNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKGTGFVQEVPT 264
           R+LR  + P  + N++L ++VISGKS+G+DSV+ELAYTPV FYH+I+ KKGT F QE P 
Sbjct: 203 RDLRKKQTPEVKVNDNLTVRVISGKSYGVDSVQELAYTPVHFYHFITSKKGTEFAQEFPK 262

Query: 265 NFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGGLILDQPVIQ 324
           +FNVF Y++KG++ ++ QVFP++S VF++ +G+ + G    DD EF +IGG ILDQ V+Q
Sbjct: 263 DFNVFFYILKGSLAVNDQVFPEHSAVFFDTDGEGVAGTSVSDDAEFVLIGGKILDQEVLQ 322

Query: 325 HGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           HGPFVET+RE++I+VF+N+QYG+NGFE A  W S I  GI E + 
Sbjct: 323 HGPFVETSRERMIDVFRNYQYGMNGFENAHSWDSKIAGGISEAEA 367

>Kpol_385.5 s385 (12788..13708) [921 bp, 306 aa] {ON} (12788..13708)
           [921 nt, 307 aa]
          Length = 306

 Score =  408 bits (1048), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 193/296 (65%), Positives = 232/296 (78%)

Query: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134
            R+I KHFIA EQ EGVGARVRRS+G+M  R FSPFL+LDHF V+  AGFPDHPHHGQET
Sbjct: 7   LRSIFKHFIAREQAEGVGARVRRSIGTMLLRKFSPFLMLDHFNVAPGAGFPDHPHHGQET 66

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITYV EGMIAHEDF G KGVL  GDLQFMTAGK I H+E+PV   +G+  VGLQLWVDLP
Sbjct: 67  ITYVNEGMIAHEDFTGCKGVLYKGDLQFMTAGKAICHAEMPVQSNSGEHVVGLQLWVDLP 126

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254
            DMK+  PRYR+L+  EIP A P + L+++VISG S+G+DSVK+LAYTP+DFY Y   K 
Sbjct: 127 TDMKNTEPRYRDLKNKEIPRANPTDDLEVEVISGNSYGVDSVKDLAYTPIDFYMYRGKKA 186

Query: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314
           GT F Q    +FNVF+YV++GA+ I  QVFPQYS++F+N +GDA+ G +  D+TEFAIIG
Sbjct: 187 GTEFTQNFSRDFNVFIYVLQGAITIGDQVFPQYSSIFFNTDGDAVGGTIAADNTEFAIIG 246

Query: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVP 370
           G ILDQ  +QHGPFVE T+EK+I+VF ++Q   NGFERA  WKSSIR+GI E D P
Sbjct: 247 GKILDQQTVQHGPFVEETKEKLIKVFYDYQSYSNGFERARNWKSSIRDGIKENDAP 302

>TDEL0G04460 Chr7 (809440..810549) [1110 bp, 369 aa] {ON} 
          Length = 369

 Score =  409 bits (1052), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 182/296 (61%), Positives = 236/296 (79%)

Query: 74  EFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQE 133
           + R+I K+F+A +QEEGVGA VRRS+G+M+ R FSPFL+LDHFTVS PAGFPDHPHHGQE
Sbjct: 63  QVRSIIKNFVATQQEEGVGATVRRSIGTMQMRRFSPFLMLDHFTVSPPAGFPDHPHHGQE 122

Query: 134 TITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDL 193
           TITY+  GM+AHEDF  SKG+L PGDLQFMTAGK I+HSEIPV M++G   VGLQLWVDL
Sbjct: 123 TITYMLGGMLAHEDFSNSKGILSPGDLQFMTAGKAIIHSEIPVKMDSGQPAVGLQLWVDL 182

Query: 194 PKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDK 253
           P+ +K+C PRYR+L+  +IP+ +P+EHLK+ VISG S+G+ S ++LAYTPV +YH+ + K
Sbjct: 183 PEKLKNCEPRYRDLKAKDIPVIKPSEHLKVTVISGTSYGVQSARDLAYTPVHYYHFATSK 242

Query: 254 KGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAII 313
           KGT FVQE P  FN F+Y++KG++ I  ++FPQ+STVF++ +GDA+ G    D+ EF +I
Sbjct: 243 KGTEFVQEFPRVFNAFMYILKGSIGIGEKLFPQFSTVFFDTDGDAVEGFSASDNAEFVLI 302

Query: 314 GGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           GG IL Q V+QHGPFVET RE++IEVF N+Q  INGF+R   W+S+I  GI E + 
Sbjct: 303 GGEILHQDVVQHGPFVETNRERLIEVFHNYQNSINGFDRGRNWRSTIAGGITESEA 358

>CAGL0I08151g Chr9 (793917..795065) [1149 bp, 382 aa] {ON} highly
           similar to KLLA0D01243g Kluyveromyces lactis and
           DEHA0E07447g Debaryomyces hansenii and YALI0E33297g
           Yarrowia lipolytica and CA2891|CaIFS4 Candida albicans
          Length = 382

 Score =  408 bits (1049), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 187/295 (63%), Positives = 239/295 (81%)

Query: 75  FRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQET 134
           +R+I  HFIAGEQEEGVGARVRRSVG+ + R F+PFL+LD FTV+ P GFPDHPHHGQET
Sbjct: 82  YRSILTHFIAGEQEEGVGARVRRSVGTYQMRRFTPFLMLDDFTVAPPNGFPDHPHHGQET 141

Query: 135 ITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLP 194
           ITYV +GMIAHED  GSKGVL  GDLQFMTAGKGI+HSEIPV  ++G    GLQLWVDLP
Sbjct: 142 ITYVTDGMIAHEDITGSKGVLLKGDLQFMTAGKGIVHSEIPVTTKDGKPCRGLQLWVDLP 201

Query: 195 KDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKK 254
            DMK+  PRYRNLRG E P+A PNE+L+++VISGKS+G++S+++LAYTPV  YH++++K 
Sbjct: 202 SDMKNIDPRYRNLRGNETPVAYPNENLEVRVISGKSYGVESLRDLAYTPVHLYHFLANKT 261

Query: 255 GTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIG 314
           GT FVQ++P +FNVF+YVMKG+++++      +S+ F++ +G+AIRG    +D +FAII 
Sbjct: 262 GTEFVQDIPEDFNVFIYVMKGSIQVNDVELTTFSSAFFDVDGNAIRGKALSEDAQFAIIA 321

Query: 315 GLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
           G ILDQ VIQHGPFVET REK++EVF+N+Q   NGFE A  W+SSI +GI E++ 
Sbjct: 322 GRILDQEVIQHGPFVETNREKLMEVFRNYQEEKNGFENAHSWRSSIHDGISEEEA 376

>KLTH0C11154g Chr3 (916374..917291) [918 bp, 305 aa] {ON} conserved
           hypothetical protein
          Length = 305

 Score =  398 bits (1022), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 188/304 (61%), Positives = 237/304 (77%)

Query: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131
           M + R+I K+F A EQ EGVGA+VRRS+GS   RNF+PFL+LDHF VS PAGFPDHPHHG
Sbjct: 1   MNKPRSILKYFTALEQSEGVGAKVRRSIGSQELRNFTPFLMLDHFNVSPPAGFPDHPHHG 60

Query: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191
           QETITYV  GMIAHEDF GS+GVLRPGDLQFMTAGKGI+HSEIPV +E+G   VGLQLWV
Sbjct: 61  QETITYVLGGMIAHEDFTGSRGVLRPGDLQFMTAGKGIIHSEIPVELESGAPSVGLQLWV 120

Query: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251
           DLP  +KDC PRYR+L   EIP  +P   L+++VISG+S+G+ S+ ELAYTPV FYHYI+
Sbjct: 121 DLPMHLKDCEPRYRDLLNNEIPSVQPKAGLEVRVISGESYGVGSMSELAYTPVHFYHYIT 180

Query: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311
            K GT F Q  P+NFNVF+YV+KG+V ++G+ F QYS+VF+N +G  + G    +++EF 
Sbjct: 181 RKPGTTFEQHFPSNFNVFMYVLKGSVIVNGKTFAQYSSVFFNTDGSRVEGSGSSEESEFI 240

Query: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPA 371
           +IGG +LDQP++Q+GPFVET+++ + EV  N+Q G NGFERA GW SSI  G++  DV  
Sbjct: 241 LIGGEVLDQPILQYGPFVETSKQNMYEVIGNYQSGTNGFERAQGWSSSIARGVVFSDVAK 300

Query: 372 FEAA 375
            E+ 
Sbjct: 301 IESC 304

>Kwal_56.22439 s56 complement(129210..130172) [963 bp, 320 aa] {ON}
           [contig 185] FULL
          Length = 320

 Score =  394 bits (1013), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 177/301 (58%), Positives = 231/301 (76%)

Query: 72  MPEFRTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHG 131
           M + R+I K+F A EQ EGVGA+VRRS+G+ + RNF+PFL+LDHFT++ PAGFPDHPHHG
Sbjct: 15  MKKARSILKYFTALEQSEGVGAKVRRSIGTQKLRNFTPFLMLDHFTIAPPAGFPDHPHHG 74

Query: 132 QETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWV 191
           QET+T++  G +AHEDF GSKGVLR GDLQFMTAGKG +HSEIPV +E+GD   G+QLWV
Sbjct: 75  QETVTHILRGAVAHEDFTGSKGVLRAGDLQFMTAGKGTVHSEIPVQLESGDPTEGIQLWV 134

Query: 192 DLPKDMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYIS 251
           DLP  +KDC PRYR+L+   IP A     L I VISG+S+G+DS++ELAYT V +YHY+ 
Sbjct: 135 DLPARLKDCQPRYRDLKRDRIPTARSKNGLNISVISGQSYGVDSIQELAYTSVHYYHYVF 194

Query: 252 DKKGTGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFA 311
            +    F Q  PT+FNVFLYV+KG + I GQ F ++S++F+  +G  + G    +D EF 
Sbjct: 195 SEANISFEQVFPTDFNVFLYVLKGRLNIAGQEFSKHSSIFFKTDGSHVSGFSGSNDLEFI 254

Query: 312 IIGGLILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPA 371
           + GG ILDQP++Q+GPFVET++E+++EVFQN+Q G NGFE+A GW SSI NGI+E D+  
Sbjct: 255 LAGGQILDQPIVQYGPFVETSKERMMEVFQNYQSGTNGFEKAAGWTSSIANGIVESDISD 314

Query: 372 F 372
           F
Sbjct: 315 F 315

>KLLA0D01243g Chr4 complement(108848..109783) [936 bp, 311 aa] {ON}
           conserved hypothetical protein
          Length = 311

 Score =  388 bits (997), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 175/301 (58%), Positives = 232/301 (77%)

Query: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135
           R++ KHF+A EQ EG GA V+RS+G+++ RNF PFL+LD+F VS PAGFP+HPHHGQETI
Sbjct: 10  RSVLKHFVAIEQSEGAGALVKRSIGTIQMRNFPPFLMLDNFDVSPPAGFPEHPHHGQETI 69

Query: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195
           TYV  GM+AHEDF GSKGVLR GDLQFMTAGK I+HSEIPV M+NG++  GLQLWVDLP 
Sbjct: 70  TYVLRGMMAHEDFTGSKGVLRSGDLQFMTAGKAIVHSEIPVKMDNGESTQGLQLWVDLPN 129

Query: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255
           D+K+  PRYR+LR  EIP+A P+++L +KVISG+S+G+ S+ ELAYTPV+FYH+I++KK 
Sbjct: 130 DIKNVEPRYRDLRREEIPLATPSDNLIVKVISGESYGVKSLTELAYTPVEFYHFIANKKN 189

Query: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315
           T F Q    +F+ F+Y+MKG++ I  Q +P+ S +F+  +GD IRG    D+ EFAII G
Sbjct: 190 TEFAQPFSDDFSSFIYIMKGSISISDQEYPESSAIFFKNDGDGIRGFTTSDNAEFAIIAG 249

Query: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDVPAFEAA 375
              +Q V+Q+GPFVE++RE I++V QN+Q G+NGFE A  W   I+NG+ E +V  +   
Sbjct: 250 KYFNQKVVQYGPFVESSRENIVDVIQNYQNGVNGFENARTWSPVIKNGVTEAEVQQYLPK 309

Query: 376 G 376
           G
Sbjct: 310 G 310

>KAFR0G02680 Chr7 (553335..554486) [1152 bp, 383 aa] {ON} Anc_6.23
          Length = 383

 Score =  384 bits (986), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 177/294 (60%), Positives = 229/294 (77%)

Query: 76  RTIQKHFIAGEQEEGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETI 135
           R+I  HFI  E  EG GARV+RS+GS  QR F+PFL+LD F V+ PAGFPDHPHHGQETI
Sbjct: 85  RSIINHFIPNETFEGDGARVKRSIGSHEQRRFAPFLMLDDFDVTPPAGFPDHPHHGQETI 144

Query: 136 TYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMHSEIPVLMENGDAGVGLQLWVDLPK 195
           TYV  GMIAHEDF G  G+L PGDLQFMTAG+GI+HSEIPV MENG +  GLQLWVDLP+
Sbjct: 145 TYVLSGMIAHEDFTGLNGILSPGDLQFMTAGRGIVHSEIPVTMENGGSCRGLQLWVDLPQ 204

Query: 196 DMKDCAPRYRNLRGTEIPIAEPNEHLKIKVISGKSHGIDSVKELAYTPVDFYHYISDKKG 255
           D+K   PRYRNLR  +IPIA P E+LK+ VISGKS+ ++S+ +LAYTPV  YH+++ K G
Sbjct: 205 DLKTIEPRYRNLRAADIPIAMPYENLKVYVISGKSYDVESLNDLAYTPVHLYHFVTIKAG 264

Query: 256 TGFVQEVPTNFNVFLYVMKGAVKIDGQVFPQYSTVFYNANGDAIRGMVDDDDTEFAIIGG 315
           T F+QE P +FNVFLYV+KGAV I+ ++F + + +F++ +G++I G    DD+EF ++GG
Sbjct: 265 TPFIQEFPKDFNVFLYVIKGAVLINEKIFKENTAIFFDVDGESIEGQFATDDSEFVLVGG 324

Query: 316 LILDQPVIQHGPFVETTREKIIEVFQNFQYGINGFERAVGWKSSIRNGILEKDV 369
            IL+QPV+Q GPFVET ++K+++VF +F+   NGFERA  W+S+IR GI E + 
Sbjct: 325 EILNQPVVQQGPFVETDKQKLMQVFDDFESYRNGFERAENWESNIRKGIKEAEA 378

>CAGL0C03047g Chr3 (300099..303182) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|P32558 Saccharomyces cerevisiae
           YGL207w SPT16
          Length = 1027

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 51/120 (42%), Gaps = 9/120 (7%)

Query: 89  EGVGARVRRSVGSMRQRNFSPFLLLDHFTVSHPAGFPDHPHHGQETITYVREGMIAHEDF 148
           E   ARV    G  R+    P    +    +  +  P++P+     + Y   G     +F
Sbjct: 9   EAFKARVELLHGKYREFENEP----NSMVFALGSSNPENPYQKTTALHYWLMGY----EF 60

Query: 149 LGSKGVLRPGDLQFMTAGKGIMHSEIPV-LMENGDAGVGLQLWVDLPKDMKDCAPRYRNL 207
             +  V  PG +  +T+G    H E  V L +N + GV L++W    KD++     ++++
Sbjct: 61  PATLIVFTPGKVVIITSGPKAKHLEKVVELFKNNNNGVELEIWQRNNKDVEHSQKLFKDI 120

>NDAI0C04590 Chr3 (1048881..1049699) [819 bp, 272 aa] {ON} Anc_5.398
           YDR347W
          Length = 272

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 13  FLLDSSHIKGRGTCWFIGKRSSFSQLF-SLYSTQNTIQYRRVVHCYSTISP 62
           F+   S I G G  W I KR+S + +  SL +++N +    V++ Y+  SP
Sbjct: 115 FMNSCSAISGDGFTWLIAKRNSSNMMMESLTNSKNNLDKLFVLNTYNAGSP 165

>Kwal_26.8524 s26 complement(824956..826140) [1185 bp, 394 aa] {ON}
           YOR201C (PET56) - Ribose methyltransferase for
           mitochondrial 21S rRNA [contig 61] FULL
          Length = 394

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 41/99 (41%), Gaps = 10/99 (10%)

Query: 112 LLDHFTVSHPAGFPDHPHHGQETITYVREGMIAHEDFLGSKGVLRPGDLQFMTAGKGIMH 171
           LL  FTV  P  F        E  T+V  G+     F   K  L  GDLQ M        
Sbjct: 284 LLPIFTVDRPLDF--FTKSQAEGWTFVTAGVTKENKFTKDKK-LAVGDLQGML------- 333

Query: 172 SEIPVLMENGDAGVGLQLWVDLPKDMKDCAPRYRNLRGT 210
            E+PV++  G+ G G++  + +  D     P+ R   GT
Sbjct: 334 QELPVVLVVGNEGEGVRTNLQMRSDFLVEIPQGRETSGT 372

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.140    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,099,993
Number of extensions: 1750889
Number of successful extensions: 3066
Number of sequences better than 10.0: 24
Number of HSP's gapped: 3115
Number of HSP's successfully gapped: 24
Length of query: 380
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 269
Effective length of database: 40,753,473
Effective search space: 10962684237
Effective search space used: 10962684237
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 66 (30.0 bits)