Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M01180singletonON26026013670.0
KNAG0F03520singletonON26026013310.0
TDEL0F03380na 1ON290911137e-06
Kpol_1045.81na 2ON3071051111e-05
ZYRO0C06248gna 1ON30586940.002
KAFR0A01250singletonON27450830.040
NDAI0E04950singletonON31956790.16
NDAI0F01140singletonON30554780.17
NDAI0B00110singletonON31961720.90
TPHA0J006704.189ON66072683.8
Kpol_543.294.189ON45164683.8
NDAI0G027608.295ON496157684.9
KAFR0D006701.76ON1388105658.6
SAKL0F03168g3.479ON70692658.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01180
         (260 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01180 Chr13 (214939..215721) [783 bp, 260 aa] {ON}              531   0.0  
KNAG0F03520 Chr6 complement(665500..666282) [783 bp, 260 aa] {ON}     517   0.0  
TDEL0F03380 Chr6 (623519..624391) [873 bp, 290 aa] {ON}                48   7e-06
Kpol_1045.81 s1045 complement(190276..191199) [924 bp, 307 aa] {...    47   1e-05
ZYRO0C06248g Chr3 (473999..474916) [918 bp, 305 aa] {ON} no simi...    41   0.002
KAFR0A01250 Chr1 (243479..244303) [825 bp, 274 aa] {ON}                37   0.040
NDAI0E04950 Chr5 (1125068..1126027) [960 bp, 319 aa] {ON}              35   0.16 
NDAI0F01140 Chr6 (275800..276717) [918 bp, 305 aa] {ON}                35   0.17 
NDAI0B00110 Chr2 complement(1233..2192) [960 bp, 319 aa] {ON}          32   0.90 
TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {...    31   3.8  
Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}...    31   3.8  
NDAI0G02760 Chr7 (629341..644226) [14886 bp, 4961 aa] {ON} Anc_8...    31   4.9  
KAFR0D00670 Chr4 (111615..115781) [4167 bp, 1388 aa] {ON} Anc_1....    30   8.6  
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    30   8.7  

>KNAG0M01180 Chr13 (214939..215721) [783 bp, 260 aa] {ON}
          Length = 260

 Score =  531 bits (1367), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/260 (100%), Positives = 260/260 (100%)

Query: 1   MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF 60
           MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF
Sbjct: 1   MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF 60

Query: 61  SEVVEIVTSRGGSKFDIAEAIEKFNRTSTDWLTGLPTDDEGAAQLRSNMAETASIWGEVR 120
           SEVVEIVTSRGGSKFDIAEAIEKFNRTSTDWLTGLPTDDEGAAQLRSNMAETASIWGEVR
Sbjct: 61  SEVVEIVTSRGGSKFDIAEAIEKFNRTSTDWLTGLPTDDEGAAQLRSNMAETASIWGEVR 120

Query: 121 EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR 180
           EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR
Sbjct: 121 EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR 180

Query: 181 LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT 240
           LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT
Sbjct: 181 LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT 240

Query: 241 LVTIEVIIWILVLVKYLNER 260
           LVTIEVIIWILVLVKYLNER
Sbjct: 241 LVTIEVIIWILVLVKYLNER 260

>KNAG0F03520 Chr6 complement(665500..666282) [783 bp, 260 aa] {ON} 
          Length = 260

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/260 (97%), Positives = 256/260 (98%)

Query: 1   MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF 60
           MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF
Sbjct: 1   MKFFNVVCALGAIQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTF 60

Query: 61  SEVVEIVTSRGGSKFDIAEAIEKFNRTSTDWLTGLPTDDEGAAQLRSNMAETASIWGEVR 120
           SEVVEIVTSRGGSKFDIAEAI+KFNRTST WLTGLPTDDEGAAQLRSNMAE ASIWGEV+
Sbjct: 61  SEVVEIVTSRGGSKFDIAEAIDKFNRTSTHWLTGLPTDDEGAAQLRSNMAEAASIWGEVQ 120

Query: 121 EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR 180
           EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR
Sbjct: 121 EDFESSSPLRKVVRKYIAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFR 180

Query: 181 LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT 240
           LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT
Sbjct: 181 LRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGT 240

Query: 241 LVTIEVIIWILVLVKYLNER 260
           LVTIEVI WIL LVKYLNER
Sbjct: 241 LVTIEVIRWILELVKYLNER 260

>TDEL0F03380 Chr6 (623519..624391) [873 bp, 290 aa] {ON} 
          Length = 290

 Score = 48.1 bits (113), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 174 VTKRAFRLRKRSENTGDVESELAVETMDAAD------DLKYLTENIFAIITGLAFVLVCW 227
           + ++AF    R  +  D+   LAV      D      D+KYL EN+  II    F+  C+
Sbjct: 199 IIQKAFH-NSRKSDPQDLGDSLAVSIAAQRDPATLESDIKYLRENLAVIIKSGMFMFFCF 257

Query: 228 SLTFHICVAVLGTLVTIEVIIWILVLVKYLN 258
           +   +IC    G L+T+  +IWI + ++ ++
Sbjct: 258 AFQIYICSFTFGVLLTVSSLIWIAIFLQLID 288

>Kpol_1045.81 s1045 complement(190276..191199) [924 bp, 307 aa] {ON}
           complement(190278..191201) [924 nt, 308 aa]
          Length = 307

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 49/105 (46%), Gaps = 15/105 (14%)

Query: 170 KSYRVTKRAFRLRKRSENTGDV--------ESELAVETMDAADD-------LKYLTENIF 214
            SYRV     R+ K   NTG+         E+ +  E M+           L Y+ + +F
Sbjct: 192 NSYRVVSEILRIAKYLLNTGNSFEQYKVPDETSVKFEIMEDPKKKPNQDQYLLYIRKMMF 251

Query: 215 AIITGLAFVLVCWSLTFHICVAVLGTLVTIEVIIWILVLVKYLNE 259
            +  G+A V  C +     C+   G+L+++  +IWI V+++Y+ E
Sbjct: 252 FMSQGIAIVFFCVAANSIPCIFAFGSLISMSFVIWIFVMIQYMAE 296

>ZYRO0C06248g Chr3 (473999..474916) [918 bp, 305 aa] {ON} no
           similarity
          Length = 305

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 39/86 (45%), Gaps = 10/86 (11%)

Query: 173 RVTKRAFRLRKRSENTGDVESELAVETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFH 232
           R+ K  F + KR E+             D A D+ YL E +   I    F+L+C     +
Sbjct: 227 RLFKDNFNVGKRDESP----------PRDIAADMNYLREGLSITIKAGMFLLLCMQYQVY 276

Query: 233 ICVAVLGTLVTIEVIIWILVLVKYLN 258
           +C    G ++++   IWI V ++ L+
Sbjct: 277 LCSVAFGFMISMSCFIWISVYLEMLS 302

>KAFR0A01250 Chr1 (243479..244303) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 36.6 bits (83), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 12/50 (24%), Positives = 30/50 (60%)

Query: 205 DLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGTLVTIEVIIWILVLV 254
           ++KY+ +    ++  +  + +C     HICVA+   L+ ++ I+W+L+++
Sbjct: 221 NIKYIQDGSLHLVQAIGALTICIVSHMHICVAIFTVLLPLQFILWMLMVI 270

>NDAI0E04950 Chr5 (1125068..1126027) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 205 DLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGTLVTIEVIIWILVLVKYLNER 260
           D+ +L E+I  I   +AF+L+C+    + CV      + I +IIW L+L +Y+  R
Sbjct: 262 DMSFLLEHISTIAKSIAFMLLCFGFGIYPCVVFFVIFIPIAIIIWSLILWRYIKGR 317

>NDAI0F01140 Chr6 (275800..276717) [918 bp, 305 aa] {ON} 
          Length = 305

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 32/54 (59%)

Query: 205 DLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGTLVTIEVIIWILVLVKYLN 258
           +LK+L + +  I  G+ F+++C ++    C  V    +++ V++WI++  + LN
Sbjct: 251 ELKFLIKGLKTITQGMVFLVLCVTIANVFCSVVFILTISVAVVVWIIIFWRMLN 304

>NDAI0B00110 Chr2 complement(1233..2192) [960 bp, 319 aa] {ON}
          Length = 319

 Score = 32.3 bits (72), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%)

Query: 198 ETMDAADDLKYLTENIFAIITGLAFVLVCWSLTFHICVAVLGTLVTIEVIIWILVLVKYL 257
           + M    +LK+L + +  +  G+ F+ +C  L+   C  V    +++ V+IW+++  + L
Sbjct: 258 KIMVDPPELKFLIKGLKTLAEGMVFLALCVVLSNVFCSVVFILTISVAVVIWMIIFWRML 317

Query: 258 N 258
           N
Sbjct: 318 N 318

>TPHA0J00670 Chr10 complement(148901..150883) [1983 bp, 660 aa] {ON}
           Anc_4.189 YGR044C
          Length = 660

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 16/72 (22%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 13  IQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTFSEVVEIVTSRGG 72
           +++ CA    + + DTL+ +LN+  +++ ++        K  + KD+++    IV     
Sbjct: 559 LRRHCAIQHKDELSDTLKKELNLNDEMYPILDCPHQYCDKTFIRKDSYNRHFSIVHKEAN 618

Query: 73  SKFD--IAEAIE 82
           S+F+  +A+ +E
Sbjct: 619 SRFNKRLAQVLE 630

>Kpol_543.29 s543 complement(59228..60583) [1356 bp, 451 aa] {ON}
           complement(59228..60583) [1356 nt, 452 aa]
          Length = 451

 Score = 30.8 bits (68), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 12/64 (18%), Positives = 36/64 (56%)

Query: 13  IQKACAFSFPEAVKDTLESQLNVTAQLFQLVFPDFDISGKLPVLKDTFSEVVEIVTSRGG 72
           +++ CA    + + + L+ +LN+  +++ ++    +   K+ + +D+++  V IV  +  
Sbjct: 348 LRRHCAIQHKDELPNKLKEELNLNDEMYPVLHCPSEYCDKVFIRRDSYNRHVSIVHEKKS 407

Query: 73  SKFD 76
           S+F+
Sbjct: 408 SRFN 411

>NDAI0G02760 Chr7 (629341..644226) [14886 bp, 4961 aa] {ON} Anc_8.295
            YLR106C
          Length = 4961

 Score = 30.8 bits (68), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 29/57 (50%), Gaps = 1/57 (1%)

Query: 137  IAHQSQKVDELAVDSESYGDDLVALTKHVGKSLKSYRVTKRAFRLRKRSENTGDVES 193
            IAHQ ++ +E  V+  S  +   AL K +G SL+ Y    +  +     EN  DVE+
Sbjct: 4483 IAHQEEQQNENEVNEPSREEAKEAL-KQLGDSLRQYHKRHQEIKEASNDENQEDVEN 4538

>KAFR0D00670 Chr4 (111615..115781) [4167 bp, 1388 aa] {ON} Anc_1.76
            YCR042C
          Length = 1388

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 23/105 (21%)

Query: 45   PDFDISGKLPVLKDTFSEVVEIVTSRGGSKF---DIAEAIEKFNRTSTDWLTGLPTDDE- 100
            PD  I G L    DTF EV+EI+ ++  +     DI   IEK N    +    +  +DE 
Sbjct: 1124 PDVYIRGNL---VDTFIEVIEIIATKKMTHTLDDDITFLIEKINPAQIN----IENEDEI 1176

Query: 101  -----GAAQLRSNMAET----ASIWG---EVREDFESSSPLRKVV 133
                 GA     N  +T    ++I G    +R +FE   PL+K++
Sbjct: 1177 SALMMGATDFELNDRKTQLMRSTIEGLLILLRRNFEDYEPLKKIL 1221

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 29.6 bits (65), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 40/92 (43%), Gaps = 12/92 (13%)

Query: 36  TAQLFQLVFPDFDISGKLPVLKDTFSEVVEIVTSRGGSKFDIAEAIEKFNRTSTDWLTGL 95
           + + + ++ P    +G +P   D   + + ++  RG      ++ IE +N T  D L GL
Sbjct: 455 SGKTYTMLHPQ---NGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRGL 511

Query: 96  PTDDEGAAQLRSNMAETASIWGEVREDFESSS 127
             D E           T S+  E+R D ES +
Sbjct: 512 NNDTEDI---------TESLKHEIRHDQESQT 534

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 25,372,018
Number of extensions: 1021009
Number of successful extensions: 3482
Number of sequences better than 10.0: 37
Number of HSP's gapped: 3586
Number of HSP's successfully gapped: 37
Length of query: 260
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 153
Effective length of database: 41,212,137
Effective search space: 6305456961
Effective search space used: 6305456961
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 64 (29.3 bits)