Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011706.21ON33933915520.0
KAFR0L004106.21ON3313367841e-102
Kpol_1037.266.21ON3423417811e-102
TBLA0G010506.21ON3503277781e-101
Smik_15.1766.21ON3453367721e-100
NCAS0H008306.21ON3383407642e-99
YOR007C (SGT2)6.21ON3463327633e-99
Skud_15.1686.21ON3483377624e-99
ZYRO0C07788g6.21ON3343237596e-99
TPHA0J003406.21ON3383487476e-97
NDAI0D008106.21ON3493407479e-97
SAKL0E01210g6.21ON3233277395e-96
CAGL0E02739g6.21ON3433237242e-93
TDEL0G044806.21ON3433307024e-90
Suva_15.1826.21ON3463377015e-90
Kwal_56.224336.21ON3223266918e-89
KLTH0C11220g6.21ON3273296683e-85
KLLA0D01155g6.21ON3353356362e-80
Ecym_30256.21ON3183256013e-75
ACR005W6.21ON3273385658e-70
Kpol_1032.86.21ON3433304833e-57
TPHA0M002706.21ON3773763483e-37
TBLA0A072706.21ON3733383232e-33
NCAS0D026706.21ON3512432967e-30
NDAI0I022406.21ON3502222678e-26
NDAI0F009105.617ON583901993e-16
ZYRO0A05676g5.617ON5721001904e-15
SAKL0G07084g5.617ON5851051861e-14
Kwal_55.199355.617ON5931041852e-14
TBLA0E033005.617ON5821021852e-14
KNAG0B032005.617ON5791051852e-14
CAGL0H08195g5.617ON5831091842e-14
TPHA0D028805.617ON5851081833e-14
KLLA0A07062g5.617ON581991834e-14
TDEL0A048405.617ON5761071824e-14
KAFR0C058905.617ON575911808e-14
YOR027W (STI1)5.617ON5891041809e-14
Kpol_1018.695.617ON5901091791e-13
NCAS0G008105.617ON5841181753e-13
KLTH0E02178g5.617ON5931041737e-13
Skud_15.1925.617ON5891041729e-13
Smik_15.2055.617ON5891041729e-13
AEL224W5.617ON5801131665e-12
Ecym_55825.617ON5841001621e-11
Suva_8.805.617ON5861041612e-11
Smik_6.2153.481ON513651532e-10
YGR123C (PPT1)3.481ON513651532e-10
TBLA0C039503.481ON5121091522e-10
Skud_7.4323.481ON513651505e-10
Suva_7.4083.481ON513651471e-09
Ecym_44133.481ON5101461433e-09
KNAG0A079003.481ON5121111433e-09
TDEL0D055003.481ON5121111416e-09
TPHA0D032203.481ON513631407e-09
NCAS0A00490singletonON6201101381e-08
KAFR0B066103.481ON5111281354e-08
NDAI0B057903.481ON5231091328e-08
CAGL0D05060g3.481ON5101091329e-08
KLLA0F24046g2.152ON604651283e-07
SAKL0F03102g3.481ON513751274e-07
NCAS0F034903.481ON512631264e-07
Kpol_505.413.481ON5131091184e-06
AAR083C3.481ON538681184e-06
ZYRO0B04224g3.481ON5131121184e-06
Kwal_55.211753.481ON5111321141e-05
KLTH0F14542g3.481ON5131051132e-05
Skud_8.1782.152ON638881061e-04
NCAS0B024008.506ON380751051e-04
Kwal_27.118908.506ON334931032e-04
KLTH0B05170g2.152ON593761034e-04
CAGL0K09240g6.328ON14239974e-04
CAGL0H07425g8.506ON380861014e-04
KLLA0B10912g3.481ON5121171015e-04
Ecym_40315.689ON6881211016e-04
ZYRO0G06512g2.152ON604871008e-04
TDEL0B051402.152ON59987980.001
NDAI0C051308.470ON59097950.003
NCAS0B070102.152ON62588950.003
KNAG0A039508.506ON38689950.003
KAFR0F007202.152ON60875950.003
NCAS0G024802.152ON59664950.003
NCAS0B025608.470ON578107940.004
Suva_15.3142.152ON64488940.004
YHR117W (TOM71)2.152ON63976930.006
Kpol_513.28.506ON37476920.006
TBLA0H033808.506ON375123910.008
ABR131W2.152ON59463910.009
Kpol_1048.212.152ON59786910.010
Ecym_82042.152ON59775900.011
TPHA0L014208.506ON37471900.012
CAGL0L12936g2.152ON600125890.014
KLTH0H14872g5.352ON623134890.017
ZYRO0F08624g8.506ON379120870.021
AGL268C8.506ON37956870.023
Smik_8.1952.152ON63588870.026
SAKL0H10934g8.506ON38094870.026
Kwal_33.147672.152ON59465870.030
TBLA0C055302.152ON61085860.033
CAGL0L04048g2.152ON58756860.033
KLTH0E10934g8.470ON568106860.034
NDAI0F028102.152ON60970860.035
NDAI0C052908.506ON37954850.037
TBLA0I023106.328ON11648800.041
Kwal_27.117378.470ON575114850.046
Skud_14.2112.152ON61764850.048
Smik_2.2958.506ON38579840.050
Suva_4.4058.506ON38579830.072
CAGL0K11209g8.470ON59099840.072
AFR453W8.470ON56991830.077
SAKL0E10956g2.152ON60064820.10
Ecym_13968.470ON57391820.12
Suva_2.4108.470ON61161820.13
Skud_4.5068.470ON61161810.14
KAFR0E028208.470ON56287810.14
SAKL0H11946g8.470ON57364810.14
Smik_4.4918.470ON61261810.15
Skud_2.2828.506ON38555800.19
Smik_14.2072.152ON61788800.19
Suva_14.2192.152ON61788800.21
YDR244W (PEX5)8.470ON61261800.22
TDEL0B013108.506ON38079790.25
NDAI0I004406.328ON12855750.28
Smik_3.1596.328ON11563740.29
KLLA0D09020g3.395ON53023780.35
YBR155W (CNS1)8.506ON38570770.38
KAFR0C018505.352ON646151780.41
KAFR0E029808.506ON38094770.42
ZYRO0D10186g5.352ON635136770.44
TBLA0B086803.32ON91488770.44
KLLA0B09966g8.506ON37092770.45
TBLA0A016908.470ON66288770.50
ADR230W5.689ON68573770.54
NDAI0B043402.152ON66465770.54
KNAG0H035302.152ON61470760.61
YNL121C (TOM70)2.152ON61793760.63
CAGL0E01573g3.32ON90489760.68
Kpol_1031.648.470ON60764750.73
KLLA0E08009g2.665ON721118750.79
KLTH0E11748g8.506ON37882750.80
CAGL0C01903g7.412ON76996731.4
KAFR0J025706.328ON12148681.8
KLTH0F18150g5.689ON689105721.9
TPHA0I015102.152ON60387721.9
ZYRO0E03300g1.456ON397100712.1
KLLA0E20857g7.412ON71090722.1
TPHA0E007407.412ON74684722.2
Ecym_20906.328ON17247692.2
SAKL0G18348g4.361ON105176712.8
SAKL0E14542g5.689ON69035703.0
KLLA0B03520g7.546ON1401106713.1
SAKL0F12936g7.412ON63252703.5
TPHA0D038606.328ON12062663.5
SAKL0A01672g6.328ON12849663.5
TPHA0L012108.470ON58864703.5
Smik_4.7743.84ON58438703.6
CAGL0H07095g5.352ON66155703.7
TDEL0B016608.470ON54993693.8
Ecym_71427.412ON67564695.1
NCAS0E024907.412ON80989685.8
Kpol_1043.605.689ON70698686.0
AEL281C7.546ON139077687.0
AGL294W7.412ON65665677.8
KLLA0C15455g8.470ON566118668.6
KAFR0L018707.412ON71271678.7
ACR258W1.216ON408377679.1
KAFR0G006901.216ON410377679.6
Kwal_23.54087.546ON141073669.7
NDAI0E040407.412ON78350669.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01170
         (339 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...   602   0.0  
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...   306   e-102
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...   305   e-102
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...   304   e-101
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...   301   e-100
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...   298   2e-99
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...   298   3e-99
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...   298   4e-99
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...   296   6e-99
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...   292   6e-97
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...   292   9e-97
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...   289   5e-96
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...   283   2e-93
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...   275   4e-90
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...   274   5e-90
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...   270   8e-89
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...   261   3e-85
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...   249   2e-80
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...   236   3e-75
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...   222   8e-70
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...   190   3e-57
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...   138   3e-37
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...   129   2e-33
NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {O...   118   7e-30
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...   107   8e-26
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     81   3e-16
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    78   4e-15
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    76   1e-14
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    76   2e-14
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    76   2e-14
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    76   2e-14
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    75   2e-14
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    75   3e-14
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    75   4e-14
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    75   4e-14
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    74   8e-14
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    74   9e-14
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    74   1e-13
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    72   3e-13
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    71   7e-13
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    71   9e-13
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    71   9e-13
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    69   5e-12
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    67   1e-11
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    67   2e-11
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    64   2e-10
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    64   2e-10
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    63   2e-10
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    62   5e-10
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    61   1e-09
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    60   3e-09
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    60   3e-09
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    59   6e-09
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    59   7e-09
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       58   1e-08
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    57   4e-08
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    55   8e-08
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    55   9e-08
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...    54   3e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    54   4e-07
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    53   4e-07
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    50   4e-06
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    50   4e-06
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    50   4e-06
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    49   1e-05
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    48   2e-05
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...    45   1e-04
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    45   1e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    44   2e-04
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...    44   4e-04
CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {...    42   4e-04
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    44   4e-04
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    44   5e-04
Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON} s...    44   6e-04
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...    43   8e-04
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...    42   0.001
NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON} Anc_8...    41   0.003
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...    41   0.003
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    41   0.003
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...    41   0.003
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...    41   0.003
NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {O...    41   0.004
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...    41   0.004
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...    40   0.006
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    40   0.006
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    40   0.008
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...    40   0.009
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...    40   0.010
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...    39   0.011
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    39   0.012
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...    39   0.014
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    39   0.017
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    38   0.021
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    38   0.023
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...    38   0.026
SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {...    38   0.026
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...    38   0.030
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...    38   0.033
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...    38   0.033
KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} simila...    38   0.034
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...    38   0.035
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    37   0.037
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    35   0.041
Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244...    37   0.046
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...    37   0.048
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.050
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    37   0.072
CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON} sim...    37   0.072
AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic ...    37   0.077
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...    36   0.10 
Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar t...    36   0.12 
Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W ...    36   0.13 
Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W ...    36   0.14 
KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.4...    36   0.14 
SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]...    36   0.14 
Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W ...    36   0.15 
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    35   0.19 
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...    35   0.19 
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...    35   0.21 
YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}  PEX5Peroxi...    35   0.22 
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    35   0.25 
NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON} ...    33   0.28 
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    33   0.29 
KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} simila...    35   0.35 
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    34   0.38 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    35   0.41 
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    34   0.42 
ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {...    34   0.44 
TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3...    34   0.44 
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    34   0.45 
TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {O...    34   0.50 
ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic ...    34   0.54 
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...    34   0.54 
KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...    34   0.61 
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...    34   0.63 
CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {...    34   0.68 
Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON} (1611...    33   0.73 
KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} simila...    33   0.79 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    33   0.80 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    33   1.4  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    31   1.8  
KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weak...    32   1.9  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...    32   1.9  
ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {...    32   2.1  
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    32   2.1  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    32   2.2  
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    31   2.2  
SAKL0G18348g Chr7 (1582267..1585422) [3156 bp, 1051 aa] {ON} sim...    32   2.8  
SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weak...    32   3.0  
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    32   3.1  
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    32   3.5  
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    30   3.5  
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    30   3.5  
TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8....    32   3.5  
Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {...    32   3.6  
CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} simila...    32   3.7  
TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {O...    31   3.8  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    31   5.1  
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    31   5.8  
Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON} (1235...    31   6.0  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    31   7.0  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    30   7.8  
KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} simi...    30   8.6  
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    30   8.7  
ACR258W Chr3 (809748..821999) [12252 bp, 4083 aa] {ON} Syntenic ...    30   9.1  
KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1...    30   9.6  
Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR1...    30   9.7  
NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.4...    30   9.9  

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/339 (89%), Positives = 303/339 (89%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN
Sbjct: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GKSLTELLDAASQNAGNTDECKTETVKINIPQ                   VASKDYDLA
Sbjct: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQEDAETKAKAEALKLEGNKAVASKDYDLA 120

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY
Sbjct: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
           VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA
Sbjct: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240

Query: 241 AGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQFKG 300
           AGGGFPDFSSLMSGGLEGL                 GAMEKIQSMMQNPAIQQMAEQFKG
Sbjct: 241 AGGGFPDFSSLMSGGLEGLMNNPQMMQAAQSMMSNPGAMEKIQSMMQNPAIQQMAEQFKG 300

Query: 301 GNTPDFSEMMNNPAVRNMASSLFSGAGEPAAPKDDAKPE 339
           GNTPDFSEMMNNPAVRNMASSLFSGAGEPAAPKDDAKPE
Sbjct: 301 GNTPDFSEMMNNPAVRNMASSLFSGAGEPAAPKDDAKPE 339

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 221/336 (65%), Gaps = 21/336 (6%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M  SNKE+S+LI+DYL KV  K +VS D  DSLNVAIDC+T+ F  E+D+ S  I+SKF 
Sbjct: 1   MPLSNKEISTLIVDYLVKVTEKNDVSEDVKDSLNVAIDCITDSFEFERDSTSGLIKSKFY 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXX----XXVASKD 116
             SL ELL+ A +N+        E V +N+P+                       +A KD
Sbjct: 61  NLSLPELLEVAMENSA------KENVTVNVPKDELENDEETKVKAEKLKLEGNKAMAMKD 114

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176
           +DLA+ KY+EAI I P NA+Y+ANRAAAY++ +++++A +DAE AI++DP YSKGYSRL 
Sbjct: 115 FDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKATEDAESAIRVDPNYSKGYSRLG 174

Query: 177 YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEK--SVP----- 229
           +AKY     EE+LEAYKKVL++EGD ATE+ KR YETAKKRVE+SLNLEK  S P     
Sbjct: 175 FAKYALNKPEEALEAYKKVLDLEGDKATEIMKRDYETAKKRVEQSLNLEKKESTPKEESV 234

Query: 230 TESAGGQTNPAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNP 289
           TESA      AA GGFPD SS++ GGL GL                  AM KIQSMMQNP
Sbjct: 235 TESAAN----AAAGGFPDMSSMLGGGLNGLLNNPQLMQAAQQMMSDPNAMSKIQSMMQNP 290

Query: 290 AIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSG 325
           +I+QMAE F+ GNTPDFS++MN+P +++MA + F G
Sbjct: 291 SIRQMAENFQNGNTPDFSQLMNDPNIKDMAKNFFGG 326

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 166/341 (48%), Positives = 230/341 (67%), Gaps = 10/341 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ SNK++++LIID+L+ VV K EVS D+ DSLNVA+DC+ E F  E+D+++  ++S F 
Sbjct: 1   MSVSNKDIAALIIDFLSTVVDKNEVSEDNADSLNVAMDCIAEAFEFERDSVAGVVKSSFQ 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           G SL+  L+ ++  +  T     ETVK+N+ +                   +A KDY+LA
Sbjct: 61  GNSLSSYLNGSTSASAAT-TTADETVKVNVTEDDTEASEAAEALKLEGNKAMAGKDYELA 119

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           ++KYTEAI  LPTNAVYFANRAAAY++ + YDEAV+DA  AIK++P YSKGYSRL +AK+
Sbjct: 120 IKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANSAIKINPTYSKGYSRLGFAKF 179

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQT--- 237
            Q   E++LEAYKKVL+IEGD ATE+ KR YETAKK+VE+SLNLEKS  + +A  ++   
Sbjct: 180 AQGKAEDALEAYKKVLDIEGDKATEMMKRDYETAKKKVEQSLNLEKSTVSGNATAESDSA 239

Query: 238 ---NPAAG-GGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXG-AMEKIQSMMQNPAIQ 292
              +P AG GG PDFSS++ GG  G                    AM++++SMMQNP+++
Sbjct: 240 SAADPFAGMGGMPDFSSMLGGGGLGNLLNNPQLMQAAQQMMQDPEAMKQVESMMQNPSVK 299

Query: 293 QMAEQFKGGN-TPDFSEMMNNPAVRNMASSLFSGAGEPAAP 332
           QMA+QF  GN TPDFS +MN+P++R+MA ++F   G   AP
Sbjct: 300 QMADQFSSGNGTPDFSALMNDPSIRDMAKNMFGNGGFQGAP 340

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score =  304 bits (778), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 157/327 (48%), Positives = 220/327 (67%), Gaps = 8/327 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+YSNK++++L++D+L+  + K  VS+D+ DSLNVAIDC+TE F  EKD + +T+ SKF 
Sbjct: 1   MSYSNKDIANLLVDFLSTAIEKKAVSSDNADSLNVAIDCITEAFEFEKDDVKSTLASKFG 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIP----QXXXXXXXXXXXXXXXXXXXVASKD 116
           GKSLTELLDAA+   G +     E +K++I     +                   +A+KD
Sbjct: 61  GKSLTELLDAATNAKGRS--SSPEDIKVSISDKDEEEDKELAAKAEALKLEGNKAMAAKD 118

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176
           Y+LAVEKY  AIK++PT AVY+ANRAAAY++ + YDEA+KDAE AIK++P +SKGYSRL 
Sbjct: 119 YNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAESAIKVEPNWSKGYSRLG 178

Query: 177 YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQ 236
           +AK+ Q   +E+LEAYKK LE++GD AT++ KR YETAKK+VE+SLN+EKS    ++   
Sbjct: 179 FAKFAQGKSQEALEAYKKALEVDGDKATDIMKRDYETAKKKVEQSLNVEKSATPSAS--A 236

Query: 237 TNPAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAE 296
           +  A+ GG PD +S++ GGL                     AME+++SMMQNP+I+QMAE
Sbjct: 237 SASASAGGMPDMASMLGGGLGSFLNNPQIMQAAQQMMSNPRAMEQMESMMQNPSIRQMAE 296

Query: 297 QFKGGNTPDFSEMMNNPAVRNMASSLF 323
               G++    + MNNPA+R MAS+LF
Sbjct: 297 NLSSGSSEGMGDFMNNPAIREMASNLF 323

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score =  301 bits (772), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 225/336 (66%), Gaps = 5/336 (1%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-ESKF 59
           M  S +E+++LI++Y + +V K E+S D  DSLNVA+DC++E FG E+D  S  + +S+F
Sbjct: 1   MLASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFERDAASGILGKSEF 60

Query: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDL 119
            GKSL ++L++AS+ + + ++   + V++NIP+                   +A+KDY+L
Sbjct: 61  KGKSLADVLNSASKASESNEKDDAQNVEVNIPEEDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           A+ KYTEAI++LPTNA+Y+ANRAAA+++ + YDEAVKDAE +I +DP+Y +GYSRL +AK
Sbjct: 121 AINKYTEAIQVLPTNAIYYANRAAAHSSLREYDEAVKDAESSISIDPSYFRGYSRLGFAK 180

Query: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     N 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKAVPEQSRDADANA 240

Query: 240 AAGGGFPDFSSLMSGGLEGLXXXX---XXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAE 296
           + G G      L S    GL                    GAM+ IQ MMQ+P+I+QMAE
Sbjct: 241 SQGAGSSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 297 QF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPAA 331
            F  GG  P+ S++MNNPA+RNMA +LF GA  P++
Sbjct: 301 GFTSGGGAPNLSDLMNNPALRNMAGNLFGGADAPSS 336

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  298 bits (764), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 221/340 (65%), Gaps = 14/340 (4%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ SNKEV SLI+D+L+ V+   E+S D  DSLNVAIDC+TE F  E+DT++ T++ KF+
Sbjct: 1   MSLSNKEVGSLIVDFLSTVIKNKEISEDSADSLNVAIDCITESFEFERDTVAQTLQDKFS 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GK+L E+L +AS  +  ++  K E+VK+NIP                    +A+KDY LA
Sbjct: 61  GKTLKEILSSASATSTGSE--KEESVKVNIPVEDAEIKATAESFKLEGNKAMAAKDYRLA 118

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           +EKY+EAIK LPTN +Y+ANRAAAY++ + YD A+KDAE+AI++DPAYSKGYSRLA+AKY
Sbjct: 119 IEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEKAIEIDPAYSKGYSRLAFAKY 178

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV-----PTESAGG 235
                EE+LE YKKVL++EGD AT   KR +E AK RVE S+NLEKS      P+ SAG 
Sbjct: 179 ALNKPEEALEYYKKVLDMEGDKATPAMKRDFEMAKNRVESSMNLEKSSTTTPEPSRSAGQ 238

Query: 236 Q-TNPAAGGGFPDFSSLM-----SGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNP 289
           Q  NP AG G PD SSL       GGL                     +M+K+Q MMQNP
Sbjct: 239 QPANPFAGSGMPDMSSLFGNGGGMGGLSSFLNNPQVMQAAQQMMSDPNSMQKMQEMMQNP 298

Query: 290 AIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSGAGEP 329
            +++MA+    G+  +  ++MNNP+V++MA++LF   G P
Sbjct: 299 NLREMAQNLASGDA-NLDDLMNNPSVKDMANNLFGPNGAP 337

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score =  298 bits (763), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 158/332 (47%), Positives = 222/332 (66%), Gaps = 5/332 (1%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATI-ESKF 59
           M+ S +E+++LI++Y + +V K E+S D  DSLNVA+DC++E FG E++ +S  + +S+F
Sbjct: 1   MSASKEEIAALIVNYFSSIVEKKEISEDGADSLNVAMDCISEAFGFEREAVSGILGKSEF 60

Query: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDL 119
            G+ L ++L++AS+   +  +   E V+INIP+                   +A+KDY+L
Sbjct: 61  KGQHLADILNSASRVPESNKKDDAENVEINIPEDDAETKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           A+ KYTEAIK+LPTNA+Y+ANRAAA+++ + YD+AVKDAE AI +DP+Y +GYSRL +AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAVKDAESAISIDPSYFRGYSRLGFAK 180

Query: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     + 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADVDA 240

Query: 240 AAGGGFPDFSSLMSGGLEGLXXXX---XXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAE 296
           + G        L S    GL                    GAM+ IQ MMQ+P+I+QMAE
Sbjct: 241 SQGASAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPSIRQMAE 300

Query: 297 QF-KGGNTPDFSEMMNNPAVRNMASSLFSGAG 327
            F  GG TP+ S++MNNPA+RNMA +LF GAG
Sbjct: 301 GFASGGGTPNLSDLMNNPALRNMAGNLFGGAG 332

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score =  298 bits (762), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 165/337 (48%), Positives = 229/337 (67%), Gaps = 7/337 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIE-SKF 59
           M+ S  E++SLI++Y + +V K E+S D  DSLNVA+DC++E FG E++ + + +E S+F
Sbjct: 1   MSASKGEIASLIVNYFSSIVEKKEISEDSADSLNVAMDCISEAFGFEREAVPSILENSEF 60

Query: 60  NGKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDL 119
            G++LT+LL++ S+ + +T +   + V++NIP+                   +A+KDY+L
Sbjct: 61  KGQNLTDLLNSTSRVSESTKKDDAQNVEVNIPEEDAEIKAKAEDLKMQGNKAMANKDYEL 120

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           A+ KYTEAIK+LPTNA+Y+ANRAAA+++ + YDEAV+DAE AI +DP Y +GYSRL +AK
Sbjct: 121 AINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAISIDPTYFRGYSRLGFAK 180

Query: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239
           Y Q   EE+LEAYKKVL+IEGD+ATE  KR YE+AKK+VE+SLNLEK+VP +S     N 
Sbjct: 181 YAQGKPEEALEAYKKVLDIEGDNATEAMKRDYESAKKKVEQSLNLEKTVPEQSRDADANA 240

Query: 240 AAGGG-----FPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQM 294
            A  G      PD  SL+ GGL GL                 GAM+ IQ MMQ+P I+QM
Sbjct: 241 DASQGAGTSGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQKMMQDPNIKQM 300

Query: 295 AEQF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPA 330
           AE F  GG  P+ S++MNNPA+R+MA +LF GAG P+
Sbjct: 301 AEGFTSGGGAPNLSDLMNNPALRSMAGNLFGGAGAPS 337

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score =  296 bits (759), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 167/323 (51%), Positives = 220/323 (68%), Gaps = 14/323 (4%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           MA SNK++SSLI+DYL  VV K  VS D IDSLNVAI+C+TE FG+EK + SA     F 
Sbjct: 1   MAPSNKDISSLIVDYLADVVDKKSVSEDSIDSLNVAIECITEAFGIEKGSSSAA----FG 56

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GK+L ELL A +         + E VK+NIP                    +A KDY+LA
Sbjct: 57  GKNLAELLSAGA----GAPSSQGENVKVNIPAEDAELKSKAESLKLEGNKAMAGKDYELA 112

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           ++KY+EAI ++PTNAVY+ANRAAA+++ +NYDEA+KDAE A+K+D +YSKGYSRL YAK+
Sbjct: 113 IKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAESAVKVDSSYSKGYSRLGYAKF 172

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAG-GQTNP 239
            Q   EE+LEAYKKVL+IEGDSAT+V KR YETAK++VE++L L K+  TE++  G   P
Sbjct: 173 AQGKSEEALEAYKKVLDIEGDSATDVMKRDYETAKRKVEQALELNKTDETETSDRGTGEP 232

Query: 240 AA---GGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAE 296
           A    GGGF D SS++ GGL GL                  AM ++++MMQNP ++QMAE
Sbjct: 233 AGANPGGGF-DLSSMLGGGLGGLLNNPQVMQAAQQMMQNPQAMSQMETMMQNPNVRQMAE 291

Query: 297 QFKGGN-TPDFSEMMNNPAVRNM 318
           +F GGN TP+ +++MNNPA+R+M
Sbjct: 292 KFAGGNGTPNLNDIMNNPALRDM 314

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score =  292 bits (747), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 164/348 (47%), Positives = 220/348 (63%), Gaps = 25/348 (7%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           MA SNKE+++LI+DYLN VV K EVS D+ DSLNVA+DC+ E F  E+D++  T++S FN
Sbjct: 1   MAASNKEIAALIVDYLNNVVDKKEVSGDNADSLNVAMDCIAEAFEFERDSVKDTVKSAFN 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXX--XXXXXXXVASKDYD 118
           G  LT  L  ++ N           +++NI                       +A+KDY+
Sbjct: 61  GNGLTSFLSGSATN----------DIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYE 110

Query: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178
            A++KY+EAI++LPTNAVY+ANRAAAY++ + YD+AV DAE AIK++P YSKGYSRL +A
Sbjct: 111 SAIKKYSEAIEVLPTNAVYYANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSRLGFA 170

Query: 179 KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTES------ 232
           K+ Q   E++L+AYKKVL+IEGD AT++ KR YETAKK+VE+SLNLEK  P E+      
Sbjct: 171 KFAQGKVEDALDAYKKVLDIEGDKATDIMKRDYETAKKKVEQSLNLEKVTPKEAETESNA 230

Query: 233 --AGGQTNPAAGGGFPDFSSLMSGGLEGLXXXXXX----XXXXXXXXXXXGAMEKIQSMM 286
               G       GGFPD SS++ GGL G                       AM++++SMM
Sbjct: 231 DAGTGAAGMGGMGGFPDLSSMLGGGLGGGLGDLLKNPQIMQAAQQMMQNPNAMQQMESMM 290

Query: 287 QNPAIQQMAEQFKGG-NTPDFSEMMNNPAVRNMASSLFSGAGEPAAPK 333
           QNPA++QMAE F  G  TPD S MMNNP +++MA ++F   G P APK
Sbjct: 291 QNPAVRQMAENFASGEGTPDLSAMMNNPDLKDMAKNMFGNGGFPGAPK 338

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score =  292 bits (747), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 224/340 (65%), Gaps = 16/340 (4%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ +NK++ +LI+D+L+ ++ K EVS D+ DSLNVA+DC++E    +++ +  TI++KFN
Sbjct: 1   MSLNNKDIGALIVDFLSTIIEKNEVSEDNADSLNVAMDCISEALEFDREVVPETIKNKFN 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GK+L ++L+  S    NT   K E+V++NIP                    +A KD+ LA
Sbjct: 61  GKTLVDILNTTSTATANTTIEKEESVEVNIPVEDAEIKANAEAFKLEGNKAMAMKDFHLA 120

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           VEKYTEAIKILPTNA+Y+ANRAAA+++ + ++EA+KDAE AIK+DP+YSKGYSRLA+AKY
Sbjct: 121 VEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAESAIKIDPSYSKGYSRLAFAKY 180

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGG--QTN 238
                EE+LE+YKKVL+IEGD+AT   KR YETAKKRVEES+N+EKS   E   G  QTN
Sbjct: 181 GLGKHEEALESYKKVLDIEGDNATAGMKRDYETAKKRVEESMNVEKSKTPEQGQGQQQTN 240

Query: 239 PAA--------GGGFPDFSSLMSGGLEGLXXXXXXX-----XXXXXXXXXXGAMEKIQSM 285
            +A         GG PD SSL  G   G                        AM+++QSM
Sbjct: 241 ESAQGNAPNPFAGGMPDMSSLFGGAGMGGGLGSLLSNPDFMSTAQKLMSDPNAMQQVQSM 300

Query: 286 MQNPAIQQMAEQFKGGNTPDFSEMMNNPAVRNMASSLFSG 325
           M +P+++ +A  FK GNT D +++MNNPA+RNMAS+LF G
Sbjct: 301 MSDPSMRDLANNFKNGNT-DMNDIMNNPAIRNMASNLFKG 339

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score =  289 bits (739), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 159/327 (48%), Positives = 224/327 (68%), Gaps = 11/327 (3%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           MA SNKE+++LI+D+L+  V K  VS D  DSLNVAIDC++E F  E+D +S  +++ F+
Sbjct: 1   MAQSNKEIAALIVDFLSSTVEKNAVSEDYADSLNVAIDCISEAFEFERDAVSEIVKNSFD 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
            + L ELL    ++A      ++E VK+NIP                    +ASKD++ A
Sbjct: 61  NRKLDELL----KSAATALPTQSEPVKVNIPAEDANTKAKAEDLKLQGNKAMASKDFETA 116

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           ++KYTEAI++LP+NAVY+ANRAAAY++ + Y+E+V+DAE AIK++P+YSKGYSRL +AKY
Sbjct: 117 IKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIKVNPSYSKGYSRLGFAKY 176

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
                EE+LEAYK VL+IEGD AT+V KR YETAK++VE+SLNLEKSVPT++   +++  
Sbjct: 177 ALGKPEEALEAYKTVLDIEGDKATDVMKRDYETAKRKVEQSLNLEKSVPTQTDEQESSTD 236

Query: 241 AGG---GFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQ 297
           AG    GFPD +SL+ GGL GL                 GAM++   MM+NPA++QMAE 
Sbjct: 237 AGAGASGFPDMASLLGGGLGGLLNNPQVMSAAQKLMQNPGAMDE---MMKNPAVRQMAEN 293

Query: 298 F-KGGNTPDFSEMMNNPAVRNMASSLF 323
           F  GG TP+  ++M+NPA+++MA +LF
Sbjct: 294 FSSGGGTPNLGDLMSNPAIKDMAKNLF 320

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score =  283 bits (724), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 213/323 (65%), Gaps = 9/323 (2%)

Query: 5   NKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFNGKSL 64
           +KEV+++II YL  VV++  V  D +DS+NVAIDC+ E F VE+  + + ++     K L
Sbjct: 2   SKEVAAVIIKYLEGVVAEKAVGEDYLDSVNVAIDCIAESFEVERGDVDSVLKQSGISKGL 61

Query: 65  TELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLAVEKY 124
            E L+     A      K+E VK+NIP                    +A KD++LA+ KY
Sbjct: 62  EECLECMKGGA-----VKSEDVKVNIPAEDAETKAKAEALKLEGNKAMAGKDFELAIAKY 116

Query: 125 TEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQEN 184
           +EAI++LPTNA+Y+ANRAAA+++ + YDEAV DAE+AI++DPAYSKGYSRL +AKY Q  
Sbjct: 117 SEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEKAIEIDPAYSKGYSRLGFAKYAQNK 176

Query: 185 FEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPAAGGG 244
            EE+LEAYKKV+++EGD AT++ KR YETAKK+VE+SLNLEK+     A       AG G
Sbjct: 177 PEEALEAYKKVMDLEGDKATDIMKRDYETAKKKVEQSLNLEKTPDARGADSGAGAGAGAG 236

Query: 245 FP---DFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQFKGG 301
                DFSS++SGGL GL                  A++++QSMMQ+P+I+QMAEQF  G
Sbjct: 237 GAGGFDFSSMLSGGLSGLMNNPQIMQAAQQMMSNPQALQQMQSMMQDPSIRQMAEQFTSG 296

Query: 302 N-TPDFSEMMNNPAVRNMASSLF 323
           N TP+  ++M+NPA+RNMASS+F
Sbjct: 297 NGTPNMDDLMSNPALRNMASSMF 319

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score =  275 bits (702), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 217/330 (65%), Gaps = 8/330 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ SNKEV+SLI+DYL+++V K  VS + IDSLNVAIDC+ E F V+K    A     F 
Sbjct: 1   MSPSNKEVASLIVDYLSQLVEKKAVSEEAIDSLNVAIDCIGESFEVQKGDSKAV----FG 56

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GK L ELL   S ++  T   + E++K+NIP                    +A KD+DLA
Sbjct: 57  GKGLVELLQNESGSSSETATTQAESIKVNIPAEDAETKAKAETLKLEGNKAMACKDFDLA 116

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           ++KY++AI++LPTNAVY+ANRAAA+++ + Y+EA+KDAE AIK DP YSKGYSRL YAK+
Sbjct: 117 IKKYSDAIEVLPTNAVYYANRAAAHSSMKAYEEAIKDAESAIKTDPTYSKGYSRLGYAKF 176

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTES---AGGQT 237
                E++LEAYKKVL+IEGD A++V KR YETAKK+VE+SL+LEK   T++     G  
Sbjct: 177 ALGQAEDALEAYKKVLDIEGDKASDVMKRDYETAKKKVEQSLDLEKKPETQARGADAGAG 236

Query: 238 NPAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQ 297
                GGF DF+S++ GGL GL                  AM +++SMMQNP ++QMAE 
Sbjct: 237 GAGGSGGFGDFASMLGGGLGGLLNNPQLMQAAQQMMQNPQAMSQMESMMQNPGVRQMAEN 296

Query: 298 FKGGN-TPDFSEMMNNPAVRNMASSLFSGA 326
           F  GN  P+  ++MNNPA+R+MA SLF GA
Sbjct: 297 FAQGNGMPNMGDLMNNPALRDMAGSLFGGA 326

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score =  274 bits (701), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 165/337 (48%), Positives = 229/337 (67%), Gaps = 9/337 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIE-SKF 59
           M+ S +E++SLI++Y + +V K EVS D  DSLNVA+DC++E FG E+D +S+ ++ S F
Sbjct: 1   MSASKEEIASLIVNYFSSIVEKKEVSEDSADSLNVAMDCISEAFGFERDAVSSILDKSTF 60

Query: 60  NGKSLTELLDAASQ--NAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDY 117
            G+SL  LL ++S+   +G  D+   + V++NIP+                   +A+K+Y
Sbjct: 61  KGQSLNNLLSSSSKLPESGKKDDA--QNVEVNIPEEDAETKAKAEELKIQGNKAMANKEY 118

Query: 118 DLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAY 177
           +LA++KYTEAI +LPTNA+Y+ANRAAA+++ + YDEA+KDAE AI +DP+Y +GYSRL +
Sbjct: 119 ELAIKKYTEAIDVLPTNAIYYANRAAAHSSLKEYDEAIKDAESAISVDPSYFRGYSRLGF 178

Query: 178 AKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV---PTESAG 234
           AKY Q   EE+LEAYKKVL+IEGD+AT+  KR YE+AKKRVE+SLNLEK+    P ++  
Sbjct: 179 AKYAQGKPEEALEAYKKVLDIEGDNATDAMKRDYESAKKRVEQSLNLEKTAPEQPRDAGA 238

Query: 235 GQTNPAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQM 294
                A  GG PD  SL+ GGL GL                 GAM+ IQ+MMQ+P+I+QM
Sbjct: 239 NAGQGAGAGGLPDLGSLLGGGLGGLMNNPQLMQAAQKMMSNPGAMQNIQNMMQDPSIRQM 298

Query: 295 AEQF-KGGNTPDFSEMMNNPAVRNMASSLFSGAGEPA 330
           AE F  GG TP+ S++M NPA+RNMA SLF GA  P+
Sbjct: 299 AEGFTSGGGTPNLSDLMKNPALRNMAGSLFGGADAPS 335

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score =  270 bits (691), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 221/326 (67%), Gaps = 8/326 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ SNK++++LI+D+L+  V   EVS D +DSLNVAIDC+TE F  ++++++ T+E  F 
Sbjct: 1   MSPSNKDLANLIVDFLSHTVENKEVSEDYVDSLNVAIDCITEAFEFDRESVATTLEKTFA 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           G+SL ++++AAS  + +  E    +VK+NIP                    +A+KD++ A
Sbjct: 61  GRSLKQVVEAASVGSSSPQE----SVKVNIPVEDAETKAKAESLKLEGNKAMAAKDFEQA 116

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           V KY+EAI++LPTNAVY+ANRAAA+++ + Y+EAVKDAE+AIK++P+YSKGYSRL +A+Y
Sbjct: 117 VLKYSEAIQVLPTNAVYYANRAAAHSSLKKYEEAVKDAEDAIKVNPSYSKGYSRLGFAQY 176

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
                EE+L+AYKKVL+IEG++AT+  KR Y+TA K+V +SLN+EKS P  +  G  +  
Sbjct: 177 ALGKPEEALDAYKKVLDIEGEAATDAMKRDYDTAMKKVGQSLNVEKSAPAATRDGAGSAT 236

Query: 241 AGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQFK- 299
             GG PD SS++ GGL GL                  AM   Q +M NPA++QMAE+F+ 
Sbjct: 237 GSGGLPDISSMLGGGLGGLLNNPQLMQAAQQMMQNPNAM---QEVMNNPAVKQMAEKFQS 293

Query: 300 GGNTPDFSEMMNNPAVRNMASSLFSG 325
           GG TP  +++MNNPA+ +MA ++F G
Sbjct: 294 GGGTPSMADLMNNPALMDMAKNMFGG 319

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score =  261 bits (668), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 153/329 (46%), Positives = 214/329 (65%), Gaps = 9/329 (2%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M  + KE++SLIIDYL +     E+  D IDSLNVAIDC+TE F VEK++ S+ IE  F 
Sbjct: 1   MNPTKKELASLIIDYLCRTAEGKEIGEDYIDSLNVAIDCVTEAFEVEKESASSVIEKSFG 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           G+SL +++ A+S+    T +   E VK+NIP                    +A+KD++ A
Sbjct: 61  GQSLEQIVGASSKGPTATQQ---EPVKVNIPVEDAEIKAKAEALKLEGNKAMATKDFEHA 117

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           + KY+EAI+ LP+NAVYFANRAAAY++ + Y EAV+DAE AIK++P+YSKGYSRL +A+Y
Sbjct: 118 ISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEAAIKVNPSYSKGYSRLGFAQY 177

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
                EE+L+AYKKVL+IEG +AT+  KR Y+TA K+VE+SLN+E+S P  S     + A
Sbjct: 178 ALGRPEEALDAYKKVLDIEGSNATDAMKRDYDTAMKKVEQSLNVERSAPAASNAESPDAA 237

Query: 241 AGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEK---IQSMMQNPAIQQMAEQ 297
            G GFPD +S++ GGL G                    M+    +Q MM NPAI+QMA++
Sbjct: 238 GGSGFPDIASMLGGGLGGGLGGLLKNPQVMQAAQQM--MQNPNAMQEMMSNPAIKQMADK 295

Query: 298 FK-GGNTPDFSEMMNNPAVRNMASSLFSG 325
           F+ GG TP  +++MNNPA+ +MA ++F G
Sbjct: 296 FQSGGGTPSMADLMNNPALMDMAKNMFGG 324

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score =  249 bits (636), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 147/335 (43%), Positives = 207/335 (61%), Gaps = 16/335 (4%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ SNKE+++LI+D+L+   S + V+ D +DSLNVAIDC+TE F  E+D   + I   FN
Sbjct: 1   MSLSNKEIAALIVDFLSS--SSSSVNEDYVDSLNVAIDCITEAFQFERDETDSLISGPFN 58

Query: 61  GKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDLA 120
           GK L ELL +A  + G       E VK++IP                    +A+K +D A
Sbjct: 59  GKKLPELLASAPSSGG----VSGEPVKVHIPVEDAAAKAKAEELKLQGNKAMAAKKFDEA 114

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           +EKYT AI++ P+NAVY++NRAAAY++ + Y++AVKDAE+AI++DP YSKG+SRL +AKY
Sbjct: 115 IEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDPTYSKGFSRLGFAKY 174

Query: 181 VQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
                EE+L+AYKKVL+IEG+ AT+V KR YETAKK+VE S+NLEKS  + S+   ++ +
Sbjct: 175 ALNKPEEALDAYKKVLDIEGEKATDVMKRDYETAKKKVETSMNLEKSSTSASSEDVSDKS 234

Query: 241 AGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXX--XXXGAMEKI-------QSMMQNPAI 291
           A  G    +  +      L                    A EK+       Q MM NPA+
Sbjct: 235 ATEGPGAGAGGLPDLSSLLGGGGLGGGLGALLNNPQVMQAAEKMMQNPGLMQDMMSNPAM 294

Query: 292 QQMAEQF-KGGNTPDFSEMMNNPAVRNMASSLFSG 325
           +QMA QF  GG  PD S+MMN+P++R+MA ++F G
Sbjct: 295 KQMANQFSSGGGMPDLSQMMNDPSIRDMAKNMFGG 329

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score =  236 bits (601), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 136/325 (41%), Positives = 203/325 (62%), Gaps = 12/325 (3%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M  SNKE+++LI+ +L+   S  +V  + +DSLNVAIDC+ E F +E++  +  +   +N
Sbjct: 1   MPGSNKEIAALIVQFLS--TSTKDVQEEYVDSLNVAIDCIAEAFEIEREDSNEIVSKAYN 58

Query: 61  GKSLTELLDA-ASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYDL 119
           G+ L +L+ + AS+   ++ E        + P+                    A+KD++ 
Sbjct: 59  GRGLVDLVKSGASEPTLSSSEPTGNNTDAHAPEVAERAENLKLEGNKA----FAAKDFEG 114

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           AV+KYTEAI+++P NAV++ NRAAAY++ + ++EAV+DAE A++++P+YS+GYSRL  AK
Sbjct: 115 AVKKYTEAIELMPNNAVFYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSRLGLAK 174

Query: 180 YVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNP 239
           Y     EE++EAYKKVL+IEGD+ATE  KR YE+AKK+VEESLNLE ++P       +  
Sbjct: 175 YALGKPEEAMEAYKKVLDIEGDNATEAMKRDYESAKKKVEESLNLE-ALPKGEEQQTSEG 233

Query: 240 AAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQF- 298
           ++ GGFPD SS++ GGL GL                  AM   Q MM NPAI+QMA+ F 
Sbjct: 234 SSAGGFPDLSSMLGGGLGGLLNNPQVMQAAQKMMQNPSAM---QEMMNNPAIKQMAQNFA 290

Query: 299 KGGNTPDFSEMMNNPAVRNMASSLF 323
            GG TP+  +MM +P +++MA   F
Sbjct: 291 SGGGTPNLGDMMKDPNIKDMAGKFF 315

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score =  222 bits (565), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 141/338 (41%), Positives = 198/338 (58%), Gaps = 29/338 (8%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGV---EKDTLSATIES 57
           M+ SNK++++LI+D+L    S   V  D  DSL VAIDC+TE F +   E DTL   +  
Sbjct: 1   MSPSNKDIAALIVDFL--TTSAKTVGEDYEDSLKVAIDCITEAFELGPGEADTL---VSE 55

Query: 58  KFNGKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDY 117
           K  G+SL++LL     +  +  E K    ++                       +A+KDY
Sbjct: 56  KCGGRSLSQLLTTGMAHTSDAGEPKVAAEELK---------KEAEALKLEGNRAMAAKDY 106

Query: 118 DLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAY 177
           + A++KYT AI++LPT+AVY+ANRAAAY++ Q Y++AV+DAE+A K+D +YSKG+SRL Y
Sbjct: 107 ETAIQKYTAAIEVLPTDAVYYANRAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSRLGY 166

Query: 178 AKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVP-TESAGGQ 236
           AKY     EE+LEAYK+VL+IEGD+ATE  +R YE+AK++VEES+N++++   TES    
Sbjct: 167 AKYALGRHEEALEAYKRVLDIEGDNATEAMRRDYESAKRKVEESINMDRNAEVTESGDSA 226

Query: 237 TNPAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXGAME----------KIQSMM 286
              A G G PD +S+  GG  G                    M+           IQ MM
Sbjct: 227 AGSAGGSGLPDLASMFGGGGLGGGLGGGLGGGLGGLLNNPQVMQAAQKMMQNPSAIQEMM 286

Query: 287 QNPAIQQMAEQFKGGN-TPDFSEMMNNPAVRNMASSLF 323
            NPAI++MAE F  GN +    ++M +PAVRNMAS  F
Sbjct: 287 SNPAIKKMAENFASGNGSSGLGDLMADPAVRNMASKFF 324

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score =  190 bits (483), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/330 (34%), Positives = 179/330 (54%), Gaps = 12/330 (3%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ +NK+  +LI++YL+K++   EVS D+ +SLNVAIDC+++VF ++  +    I   FN
Sbjct: 1   MSLNNKDFGALIVNYLHKIIDGKEVSEDNAESLNVAIDCISDVFELDPTSEEKIINDVFN 60

Query: 61  GKSL--TELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYD 118
              L    L     QN  +  E + +  +I                       ++ K+Y 
Sbjct: 61  KSDLKTITLKGLGLQNVSDVVELEVKNEEI-----SEDKKKEAEALKLEGNKQMSLKNYK 115

Query: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178
            A++KY++AI+I P+N  Y++NRAAAY   +++  AV DA  AIKLDP YSK YSRL  A
Sbjct: 116 SAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNAVLDANTAIKLDPTYSKAYSRLGAA 175

Query: 179 KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTN 238
           K  + N E+++ A+KKVLE+EGD +TEV K  YE AKK V+  + L K+VP  S     N
Sbjct: 176 KLAEGNNEDAVHAFKKVLELEGDKSTEVMKNDYENAKKLVQTFVTLNKNVPDPSGPPPLN 235

Query: 239 PAAGGGFPDFSSLMSGGLEGLXXXXXXXXXXXXXXXXXG--AMEKIQSMMQNPAIQQMAE 296
                   D ++++      L                     M++++ +MQNP ++Q AE
Sbjct: 236 --TTDVLTDIATVLGSSFGSLMNNTQMMQRAQQMMQTQNPEMMQQVEGLMQNPVVRQFAE 293

Query: 297 QFKGGNTP-DFSEMMNNPAVRNMASSLFSG 325
               GN P   S+++NNP+V+ +A+ L +G
Sbjct: 294 NVANGNGPGGLSDVLNNPSVKEVANGLMNG 323

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score =  138 bits (348), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 104/376 (27%), Positives = 172/376 (45%), Gaps = 77/376 (20%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M  +++E++S+I+DY NK ++  +++ D++DSLNVAIDC+ +VF V+KD +S  +++ + 
Sbjct: 1   MNTTDQEIASIIVDYFNKCITSGKLNQDNVDSLNVAIDCIADVFDVDKDLISNILKTAYR 60

Query: 61  GKSLTELLDAASQNAGNTDECKTETVK---------------------INIP-------- 91
              L   L    ++A N D+ K  T+                      IN+P        
Sbjct: 61  SNDLLTYLPNGKRSALNLDK-KNTTINVSVQTKDKINAYNDLSRNKDDINVPVKVIEDIE 119

Query: 92  -----QXXXXXXXXXXXXXXXXXXXVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYT 146
                +                   + +K Y  A+  Y++AIK+ PTN  Y+ NRA AY 
Sbjct: 120 ETKETKVSNDDMKKAEKLKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYI 179

Query: 147 NSQNYDEAVKDAEEAIKLD----PAYSKGYSRLAYAKYVQENFEESLEAYKKVLEI--EG 200
            + N+D A+ DA ++I++D    P   K Y RL  AKY   ++E SL A+K+++EI  E 
Sbjct: 180 KANNFDHAIIDANKSIEIDSKIHPTNFKAYYRLGLAKYEIGDYEGSLAAFKRMIEIAQEN 239

Query: 201 DSATEVTKR---GYETAKKRVEE--SLNLEKSVPTESAGGQTN--PAAGGGFPDFSSLMS 253
           +   E+TK+    YE AK++V+E   + + KS   E +G   N  P       D  ++  
Sbjct: 240 NKGDEITKQMDADYEKAKEKVQELFFMQITKSTGKEGSGNSVNDGPKRKVTLNDILNMAG 299

Query: 254 GGLEGLXXXXXXXXXXXXXXXXXGAMEKIQSMMQNPAIQQMAEQFKGGN---TPDFSEMM 310
             L                            +M NP  +++ EQ    N      F  +M
Sbjct: 300 NNL--------------------------NIIMSNPLFKEVVEQLLASNPQAKQQFDNVM 333

Query: 311 NNPAVRNMASSLFSGA 326
           N+P VR M  ++ S +
Sbjct: 334 NDPRVRQMKENVNSDS 349

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score =  129 bits (323), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 88/338 (26%), Positives = 155/338 (45%), Gaps = 36/338 (10%)

Query: 4   SNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFNGKS 63
           ++K+V+ LI+++L  V+SK E+S D+IDSLNVAIDC+ + + + +  +S+++  KF+   
Sbjct: 7   NDKDVACLIVNFLENVISKKEISQDNIDSLNVAIDCIQQCYNLNEAYISSSLILKFSKSD 66

Query: 64  LTELLD----------------------------AASQNAGNTDECKTETVKINIPQXXX 95
           LT +L+                            +  +N  N      E + IN+     
Sbjct: 67  LTSILNNFAKNNYKNITSTKETTPLTLEPSSLNESVKKNQSNISNDNNEKISINLNDTSK 126

Query: 96  XXXXXXXXXXXXX-----XXXVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQN 150
                                + S+DY  A+E YT AI   P + +Y++NR+ AY    +
Sbjct: 127 NNFSDKDKQIADTFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVND 186

Query: 151 YDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG 210
           Y+ A+ DA   I +D  +SK Y RLA  K  Q  + ++L+ YKK +E+  DS  E   R 
Sbjct: 187 YESAINDANFCISIDANFSKAYIRLANIKVQQHQYIDALDYYKKFIELNKDSVPEKITRE 246

Query: 211 YETAKKRVEESLNLEK--SVPTESAGGQTNPAAGGGFPDFSSLMSGGLEGLXXX-XXXXX 267
           +E  K +V+  ++L +  +  + +   + +  +    PD  S++  G   L         
Sbjct: 247 FEDLKLKVQTDISLREISNDHSNNNYNENSYNSTKNSPDIGSILGDGFAALLSNPMLQQM 306

Query: 268 XXXXXXXXXGAMEKIQSMMQNPAIQQMAEQFKGGNTPD 305
                     A + I  ++ NPA++ + + FK G+  D
Sbjct: 307 IFKIIQNNPDAAKNIGYVLANPAMKNLLQNFKNGSAFD 344

>NCAS0D02670 Chr4 complement(512529..513584) [1056 bp, 351 aa] {ON}
           Anc_6.21 YOR007C
          Length = 351

 Score =  118 bits (296), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 132/243 (54%), Gaps = 33/243 (13%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDT-----LSATI 55
           M+ SNKE++S I+ YL+ ++   +V+ D  +S++VAI+C+ + F ++++      L+  +
Sbjct: 1   MSLSNKEIASRIVSYLSSLIRTGQVTEDYAESISVAIECIRDSFDLQEEVSADSDLATVL 60

Query: 56  ESKFNGKSLTELLDAASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASK 115
            +  N +   +L +   +          + +K+ +                     V  +
Sbjct: 61  LANLNLEPEPKLSEKERELVNE------QAIKLKL----------------EGNKAVERE 98

Query: 116 DYDLAVEKYTEAIKILPTNAV-----YFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           +Y  A++KYT AI +L  N +     Y +N++ A T S  Y+EA  DA   IK+DP +SK
Sbjct: 99  NYKDAIDKYTRAIDLLKKNGLPVDRGYLSNKSLALTKSGRYEEACDDALACIKIDPTFSK 158

Query: 171 GYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPT 230
           GYSRLA AK  Q  +E+++ AYK+VL++EG+ AT+  KR +E  K++  E+LN    + +
Sbjct: 159 GYSRLAEAKIGQNKYEDAMNAYKQVLDLEGNKATDTMKRDFEITKQKF-ETLNFSTHIDS 217

Query: 231 ESA 233
            SA
Sbjct: 218 GSA 220

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score =  107 bits (267), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 118/222 (53%), Gaps = 24/222 (10%)

Query: 1   MAYSNKEVSSLIIDYLNKVVSKAEVSADDIDSLNVAIDCLTEVFGVEKDTLSATIESKFN 60
           M+ + ++ +SLII YL+ + +   +  D  +SL VAI C+ E F ++ D L  +++ +  
Sbjct: 1   MSLTKEQTASLIISYLSYLTNNNVLDEDKKESLRVAITCIGESFSLDGDILPTSLKERTL 60

Query: 61  GKSLTELLDA--ASQNAGNTDECKTETVKINIPQXXXXXXXXXXXXXXXXXXXVASKDYD 118
              L E L+   A+Q   N +    E +K                        +    Y+
Sbjct: 61  KTILQENLNTLEATQKIHNEE---AEALK------------------KEGNEAMIEGQYE 99

Query: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178
            A++KYTEAI+    N  Y++NR+ AY+    Y++AV DA  AI +DP++SK YSRL YA
Sbjct: 100 EAIKKYTEAIQ-FSKNVAYYSNRSLAYSKLGRYEDAVNDATLAINIDPSFSKAYSRLGYA 158

Query: 179 KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           K  Q+  E+ + AYK+ +++EG +A++     YE A+ + E+
Sbjct: 159 KCCQDKLEDGMTAYKRAIDLEGTNASKTLYDDYEDARFKYEQ 200

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 68/90 (75%), Gaps = 1/90 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           SKD++ A+E +T+AI++ PT N V ++NR+AAYT+++ + EA+ DA E +K++P +SKGY
Sbjct: 18  SKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVKINPTWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDS 202
           +RL  A++   N EE+ + YK+ L+++ ++
Sbjct: 78  NRLGAAEFGLGNLEEAEKNYKEALKLDNNN 107

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ Y+E IK  P +A  ++NRAAA +   ++ EA+KD + AIK DP + + Y R 
Sbjct: 404 DWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPNFVRAYIRK 463

Query: 176 AYAKYVQENFEESLE 190
           A A+   + +  +L+
Sbjct: 464 ATAQIAIKEYANALD 478

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 61/120 (50%), Gaps = 10/120 (8%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY---S 169
           +D A+E+Y +A   L  +  Y  NR+AA     +++ A+    EA+    +L   Y   +
Sbjct: 271 FDEAIEQYNKAW-ALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQGRELRADYKIIA 329

Query: 170 KGYSRLAYAKYVQENFEESLEAYKKVL--EIEGDSATEVTKRGYETAKKRVEESLNLEKS 227
           K ++R+  A + + + ++S++ Y+K L      D  T++     E  K+  E+ ++ EK+
Sbjct: 330 KSFARIGNAYHKKGDLKKSIDYYQKSLTEHRTADILTKLRNCEKELKKQEAEQYIDPEKA 389

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 71/100 (71%), Gaps = 3/100 (3%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY  A++ +T+AI++  T N V ++NR+A Y +++ ++EA+KDAEE +K+ P++SKGY
Sbjct: 16  AKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECVKISPSWSKGY 75

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYE 212
           +R+  A++     +E+ ++YK+ LE+  DS+ +  K G E
Sbjct: 76  NRVGAAQFGLSQLDEAEKSYKRALEL--DSSNKAAKDGLE 113

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE +K  P +A  F+NRAAA     ++ EA++D  +A+ +DP + + Y R 
Sbjct: 395 DWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFPEAIEDCNKAVSIDPNFVRAYIRK 454

Query: 176 AYAKYVQENFEESLE 190
           A A+   + F  ++E
Sbjct: 455 ATAQIAVKEFAAAIE 469

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++ ++ A+E Y +A + L  +  Y  NR+AA     +YD A+K   +A+    +L   Y 
Sbjct: 259 ARQFEEAIEHYNKAWE-LHKDITYLNNRSAAEFEKGDYDTAIKTLNDAVEQGRELRADYK 317

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             +K ++R+  A Y  ++  +++E Y + L
Sbjct: 318 TIAKSFARIGNAYYKLKDLRKAIEHYNRSL 347

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 76.3 bits (186), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 113 ASKDYDLAVEKYTEAIKIL-PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           A+KD++ A+E +T+AI++    N V ++NR+A YT+++ +++A++DA++ + ++PA+SKG
Sbjct: 15  AAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVNINPAWSKG 74

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           Y+R+  A +   + +E+ + YKK LE+  DSA +  + G E   K
Sbjct: 75  YNRVGAAHFGLGDLDEAEQGYKKALEL--DSANKAAQDGLEQVHK 117

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 42/75 (56%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA +   ++ EA+KD   AI  DP + + Y R 
Sbjct: 408 DWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDPNFIRAYIRK 467

Query: 176 AYAKYVQENFEESLE 190
           A A+     F   +E
Sbjct: 468 ATAQIAVREFVSVIE 482

 Score = 34.7 bits (78), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 48/90 (53%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++ +D A+E Y++A + L  +  Y  NRAAA      Y+ A+K   EA+    +L   Y 
Sbjct: 272 ARKFDEAIEHYSKAWE-LHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYK 330

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             SK ++R+  + +     ++++E Y+K L
Sbjct: 331 VISKSFARIGNSYHKLNELKKAIEFYQKSL 360

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 71/104 (68%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KD++ A E +++AI+   T N V ++NR+A YT+ + + EA++DAEE +K++P +SKGY
Sbjct: 16  AKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECVKINPTWSKGY 75

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +R+  A+Y   N +++ + YKK LEI  DS+ +  + G E  +K
Sbjct: 76  NRVGAAQYGLGNLDDAEKEYKKALEI--DSSNKAAQEGLEQVQK 117

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 58/107 (54%), Gaps = 5/107 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV  YTE IK  P +A  ++NRAA      ++ +A+KD + AI  DP + + Y R 
Sbjct: 416 DWPSAVSAYTEMIKRAPEDARGYSNRAAVLAKLMSFPDAIKDCDVAISKDPNFVRAYIRK 475

Query: 176 AYAKYVQENFEESLE----AYKKVLEI-EGDSATEVTKRGYETAKKR 217
           A A+     F  ++E    A  K LEI +G +A E+ +   + +++R
Sbjct: 476 ASAQIAVREFAPAMETLDAARAKDLEINKGANAREIEQLYVKASQQR 522

 Score = 34.3 bits (77), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 49/90 (54%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++ +D A+E Y +A   L  +  Y  NR+AA     +Y++A+K   EA+    ++   Y 
Sbjct: 280 ARKFDEAIEHYNKAWD-LHRDVTYLNNRSAAEYEKGDYEQAIKTLTEAVDQGREMRADYK 338

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             SK ++R+  A    ++ ++++E Y++ L
Sbjct: 339 LISKSFARIGNAYLKMDDLKKAIEFYQRSL 368

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 70/102 (68%), Gaps = 7/102 (6%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +K+YD A+EK+T+AI++  T N V ++NR+A YT+ + + + ++DA E +K++P +SKGY
Sbjct: 18  AKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVKINPTWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEG------DSATEVTK 208
           +R+  A +   + +E+ +AYKK LE++       D  ++VT+
Sbjct: 78  NRVGAAHFGMGDLDEAEKAYKKALELDSSNKAAHDGLSQVTR 119

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE I   P++A  ++NRAAA +   ++ EA+ D   AI+ DP + + Y R 
Sbjct: 404 DWPNAVKAYTEMIARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKDPNFIRAYIRK 463

Query: 176 AYAKYVQENFEESLE 190
           A A+   ++F  ++E
Sbjct: 464 ATAQIAIKDFVPAIE 478

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 71/105 (67%), Gaps = 3/105 (2%)

Query: 113 ASKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           A+K YD AV+ +T+AI++  T N V ++NR+A+Y + Q ++EA+KDA E  K++P+++KG
Sbjct: 17  AAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTKINPSWAKG 76

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           Y+R   A +   N +++  +YKK LE+  D+  ++ K G E  ++
Sbjct: 77  YTREGAAHFGMGNLDDAEASYKKALEL--DANNKIAKEGIEQIQR 119

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 62/109 (56%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA +   ++ +A+ D  +AI+ DP + + Y R 
Sbjct: 400 DWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPDAISDCNKAIEKDPNFVRAYIRK 459

Query: 176 AYAKYVQENFEESLE----AYKKVLEIEGDS-ATEVTKRGYETAKKRVE 219
           A A+   ++F  ++E    A  K  E+ G + A E+ +   + A++R +
Sbjct: 460 ATAQIAVKDFSYAIETLDAARTKDAEVNGGANAREIDQLYMKAAQQRFQ 508

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++++D A+  Y +A + L  N  Y  NR+AA      YD A+    EAI    ++   Y 
Sbjct: 264 ARNFDEAIACYNKAWE-LDNNITYLNNRSAAEFEKGEYDTAINTLNEAIEKGREMRADYK 322

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             +K ++R+  A     N +E++  Y+K L
Sbjct: 323 IIAKSFARIGNAYVKMGNLKEAINHYQKSL 352

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 75.5 bits (184), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 73/109 (66%), Gaps = 4/109 (3%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY+ A++ +++AI++  T N V+++NR+A Y + + + EA+ DAEE +K++P +SKGY
Sbjct: 17  AKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALNDAEECVKINPTWSKGY 76

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEES 221
           +RL  A     + +E+  +YKK LE++G  + +  K G +   KR +ES
Sbjct: 77  NRLGAAHLGLGDLDEAEGSYKKALELDG--SNQAAKDGLDQV-KRTQES 122

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA +   ++ EA++D  +AI+ DP + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIEDCNKAIEKDPNFIRAYIRK 464

Query: 176 AYAKYVQENFEESLE 190
           A A+   + F  ++E
Sbjct: 465 ATAQIAVKEFAAAIE 479

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 75.1 bits (183), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 73/108 (67%), Gaps = 3/108 (2%)

Query: 113 ASKDYDLAVEKYTEAIKILP-TNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           ++K+Y+ AV+ +++AI++ P  N V ++NR+A YT+ + + +A+ DA E  K++P +SKG
Sbjct: 17  SAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTKINPTWSKG 76

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVE 219
           Y+R+  A Y   + +E+ ++YKK LE+  D++ +V + G E  K+  E
Sbjct: 77  YNRVGAAHYGLGDLDEAEKSYKKALEL--DASNKVAQEGLEQVKRTQE 122

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 49/87 (56%), Gaps = 4/87 (4%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           AV+ YTE I   P +A  ++NRAAA +   ++ EA+ D E+A++ DP + K Y R A A+
Sbjct: 411 AVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDPNFVKAYIRKATAQ 470

Query: 180 YVQENFEESLEAYKKVLEIEGDSATEV 206
              + +  +LE     L+I     TE+
Sbjct: 471 IAIKEYSSALE----TLDIARSKDTEL 493

 Score = 33.5 bits (75), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 51/123 (41%), Gaps = 7/123 (5%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176
           +D A+E Y +A + L  +  Y  N+AAA     +Y+  +K  E+AI+        Y  +A
Sbjct: 274 FDEAIEHYDKAWE-LHNDITYLNNKAAAQYEKGDYETTIKTLEDAIEKGRELRADYKIIA 332

Query: 177 YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQ 236
            A     N  E L   KK  E    S TE       T  +      +LEK +  + A   
Sbjct: 333 KAFTRMGNAYEKLNDLKKAAEFFNKSLTEFRTPATLTKLR------SLEKKIKVQEAEAY 386

Query: 237 TNP 239
            NP
Sbjct: 387 INP 389

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 69/99 (69%), Gaps = 3/99 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           ASKDY  A+E +T+AI++    N V F+NR+A Y +++++ +A+ DA E +K++P+++KG
Sbjct: 15  ASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECVKINPSWAKG 74

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG 210
           Y+RL  A Y   + +E+ ++YKK LE+  DSA +  + G
Sbjct: 75  YNRLGAAHYGLGDLDEAEQSYKKALEL--DSANKAAQDG 111

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 47/75 (62%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AVE YTE IK  P +A  ++NRAAA +   ++ +A++D ++AI+ DP + + Y R 
Sbjct: 404 DWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDPNFVRAYIRK 463

Query: 176 AYAKYVQENFEESLE 190
           A  +   +++  ++E
Sbjct: 464 ATGQIAIKDYAGAIE 478

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 69/107 (64%), Gaps = 3/107 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY+ A E + +AI +    N V ++NR+A YT+ + + E +KDAEE +K++P +SKGY
Sbjct: 17  AKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKDAEECVKINPGWSKGY 76

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVE 219
           +R+  A++   N E++ ++Y+K LE+  DSA +  K G +   K  E
Sbjct: 77  NRVGAAQFGLNNLEDAEKSYQKALEL--DSANKAAKEGLDQVLKTRE 121

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (58%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+ D + AI+ DP + + Y R 
Sbjct: 397 DWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPNFIRAYIRK 456

Query: 176 AYAKYVQENFEESLE 190
           A A+   + F  ++E
Sbjct: 457 ASAQIAVKEFAAAVE 471

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 73.9 bits (180), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 66/91 (72%), Gaps = 1/91 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY  A++ +T+AI++  T N V ++NR+AAYT+S+ Y++A+ DA+E IK++P+++KGY
Sbjct: 18  AKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIKINPSWAKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSA 203
           +R   A      +EE+ + Y + L+I+ ++A
Sbjct: 78  TRKGAALQGLHKYEEAEQCYNETLKIDPNNA 108

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 44/75 (58%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ +A+ D  +AI+ DP++ + Y R 
Sbjct: 400 DWPNAVKSYTEMIKRAPDDARGYSNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRK 459

Query: 176 AYAKYVQENFEESLE 190
           A  +   + F  ++E
Sbjct: 460 ATCQIAVKEFAGAIE 474

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 73.9 bits (180), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDYD A+E +T+AI++  T N V ++NR+A YT+ + + +A+ DA E +K++P++SKGY
Sbjct: 18  AKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVKINPSWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +RL  A     + +E+   YKK LE+  D++ +  K G +   +
Sbjct: 78  NRLGAAHLGLGDLDEAESNYKKALEL--DASNKAAKEGLDQVHR 119

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+ D  +AI+ DP + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 176 AYAKYVQENFEESLE----AYKKVLEI-EGDSATEVTKRGYETAKKRVE 219
           A A+   + +  +LE    A  K  E+  G SA E+ +  Y+ +++R +
Sbjct: 471 ATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQLYYKASQQRFQ 519

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 71/109 (65%), Gaps = 4/109 (3%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDYD A++ +++AI +    N V ++NR+A YT+ + +  A+KDAEE +K++P++SKGY
Sbjct: 18  AKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVKINPSWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEES 221
           +R+  A +   + +E+   YKK LE+  D++ +  + G E    R +ES
Sbjct: 78  NRVGAAHFGMGDLDEAEAGYKKALEL--DASNKAAQEGLEQV-HRTQES 123

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAA  +   ++ EA+ D  +AI+ DP + + Y R 
Sbjct: 412 DWPNAVKAYTEMIKRAPEDARGYSNRAAVLSKLMSFPEAIDDCNKAIEKDPNFVRAYIRK 471

Query: 176 AYAKYVQENFEESLE 190
           A A+     F  +LE
Sbjct: 472 ATAQIAVREFSSALE 486

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 47/90 (52%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++ +D AV KY EA +    +  Y  NR+AA     +Y+ ++K  EEA+    ++   Y 
Sbjct: 276 ARQFDEAVAKYNEAWEAH-NDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYK 334

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             +K ++R+        + +++++ YKK L
Sbjct: 335 VIAKSFARMGNCYTKLNDLKKAIDFYKKSL 364

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 72.0 bits (175), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/118 (38%), Positives = 71/118 (60%), Gaps = 7/118 (5%)

Query: 113 ASKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           ASKD+  A+E +TEAI    T N V ++NR+A YT+ + + EA+ DA++ +K++P +SKG
Sbjct: 16  ASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCVKINPDWSKG 75

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVP 229
           Y+R+  A     + +++   YKK LE+  DS  +    G E    RV+ES    KS P
Sbjct: 76  YNRMGAAHLGLGDLDDAESNYKKALEL--DSNNKAASEGLEQV-HRVQES---RKSRP 127

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/109 (36%), Positives = 64/109 (58%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+KD E+AI+ DP + + Y R 
Sbjct: 405 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPNFVRAYLRK 464

Query: 176 AYAKYVQENFEESL----EAYKKVLEI-EGDSATEVTKRGYETAKKRVE 219
           A A+   ++F ++L    EA KK  E+  G S+ E+ K   +  ++R +
Sbjct: 465 ATAQIAIKDFVKALETLEEAKKKDDEVNNGASSNEIMKLQMKATQERFQ 513

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 10/123 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           S  +D A+ +Y +A   L  +  Y  NR+AA     +++ A+    EA+    +L   Y 
Sbjct: 269 SHKFDEAIAEYNKAWD-LHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGRELRADYK 327

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL--EIEGDSATEVTKRGYETAKKRVEESLNL 224
             +K ++R+  A   Q+N ++++E Y+K L      D  T++     E  K+ +EE +N 
Sbjct: 328 LIAKSFARMGNAYSKQKNLKKAIEYYQKSLTEHRTADILTKLRTCEKELKKQEIEEYINP 387

Query: 225 EKS 227
           EK+
Sbjct: 388 EKA 390

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 68/104 (65%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY+ A E +T+AI+     N V ++NR+A +T+ + ++EA+ DA E +K++PA+SKGY
Sbjct: 16  AKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECVKINPAWSKGY 75

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +R+  A +     +E+ + YKK LEI  D++ +  + G E  +K
Sbjct: 76  NRVGAAYFGLGKLDEAEQGYKKALEI--DTSNKAAQDGLEQVQK 117

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE  K  P +A  ++NRAAA     ++ EA+KD + AI  DP + + Y R 
Sbjct: 416 DWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDPNFIRAYIRK 475

Query: 176 AYAKYVQENFEESLE 190
           A A+     F  ++E
Sbjct: 476 ATAQIAVREFASAIE 490

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 50/90 (55%), Gaps = 8/90 (8%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY- 168
           ++ +D A+E Y +A   L  +  Y  NR+AA     +Y++A+K   EA+    ++   Y 
Sbjct: 280 ARKFDEAIEHYNKAWD-LHKDVTYLNNRSAAEYEKGDYEQAIKTLTEAVEQGREMRADYK 338

Query: 169 --SKGYSRLAYAKYVQENFEESLEAYKKVL 196
             SK ++R+  A    E+F++++E Y+K L
Sbjct: 339 LISKSFARIGNAYLKLEDFKKAIEFYQKSL 368

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +K+YD A+E +T+AI++  T + V F+NR+A YT+ + + +A+ DA E +K++P++SKGY
Sbjct: 18  AKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVKINPSWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +RL  A     + +E+   YKK LE+  D+  +  K G E   +
Sbjct: 78  NRLGAAHLGLGDLDEAESDYKKALEL--DANNKAAKDGLEQVHR 119

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 63/109 (57%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+ D  +AI+ DP + + Y R+
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRM 470

Query: 176 AYAKYVQENFEESLE----AYKKVLEI-EGDSATEVTKRGYETAKKRVE 219
           A A+   + F  +LE    A  K  E+ +G SA E+ +  Y+ +++R +
Sbjct: 471 AAAQIAVKEFAAALETLDVARTKDAEVNKGASAKEIDQLYYKASQQRFQ 519

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 67/104 (64%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDYD A+E +T+AI++  T N V ++NR+A Y + + + +A+ DA+E I ++P++SKGY
Sbjct: 18  AKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECININPSWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +RL  A     + +E+   YKK LE+  D++ +  K G +   +
Sbjct: 78  NRLGAAHLGLGDLDEAENNYKKALEL--DASNKAAKDGLDQVHR 119

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 58/109 (53%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+ D  +AI+ DP + + Y R 
Sbjct: 411 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 470

Query: 176 AYAKYVQENFEESLEAYKKVLEIEGD-----SATEVTKRGYETAKKRVE 219
           A A+   + +  +LE        + D     S+ E+ +  Y+ +++R +
Sbjct: 471 ATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQLYYKASQQRFQ 519

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/113 (34%), Positives = 73/113 (64%), Gaps = 7/113 (6%)

Query: 113 ASKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           A+KD++ A+E + +AI++    N V ++NR+A Y + + + EA+ DA+E +++ P +SKG
Sbjct: 16  AAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALADAQECVRIKPDWSKG 75

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGY----ETAKKRVEE 220
           ++RL  A Y   + +E+ E+YKK LE+  DS+ +  + G      T ++R+E+
Sbjct: 76  HNRLGAAHYGLGDLDEAEESYKKALEL--DSSNKAAQDGLAQVQATQQQRMEQ 126

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ +A+KD + AI+ DP + + Y R 
Sbjct: 403 DWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRK 462

Query: 176 AYAKYVQENFEESLE 190
           A A+   + +  ++E
Sbjct: 463 ATAQIAVQEYAAAIE 477

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY-- 168
           + +D A+  Y +A   L  +  Y  NRAAA     +Y+ A+K  E+A+    +L   Y  
Sbjct: 268 RQFDEAIANYEKAWD-LHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEGRELRADYKV 326

Query: 169 -SKGYSRLAYAKYVQENFEESLEAYKKVL 196
            +K ++RL  A Y   + ++++E Y+K L
Sbjct: 327 IAKSFARLGNAHYKLADLKKAIEYYEKSL 355

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 114 SKDYDLAVEKYTEAIK-ILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KD+  AVE +T AI+     N V ++NR+ AY + + +DEA+ DA E +K+   +SKG+
Sbjct: 17  AKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSDATECVKIKADWSKGH 76

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYE 212
           +RL  A +   N +E+ E+YKK LE+  D+  +  K G E
Sbjct: 77  NRLGAAHFGLGNLDEAEESYKKALEL--DATNKAAKDGLE 114

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 48/75 (64%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ Y+E I   P +A  ++NRAAA +   ++ +A+KD ++AI++DP++ + Y R 
Sbjct: 407 DWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPSFVRAYIRK 466

Query: 176 AYAKYVQENFEESLE 190
           A A+   + +  ++E
Sbjct: 467 ATAQIAVQEYSAAIE 481

 Score = 37.0 bits (84), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 47/89 (52%), Gaps = 8/89 (8%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI----KLDPAY-- 168
           + +D A+ KY EA   L  +  Y  NRAAA     +Y+ A+K   EA+    +L   Y  
Sbjct: 272 RKFDEAIAKYEEAWN-LQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQGRELRADYKV 330

Query: 169 -SKGYSRLAYAKYVQENFEESLEAYKKVL 196
            +K ++RL  A Y  +  ++++E Y+K L
Sbjct: 331 IAKSFARLGNAYYKLDEVKKAVEYYEKSL 359

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 66/104 (63%), Gaps = 3/104 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPT-NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           +KDY  A++ +T+AI++    N V ++NR+A YT+ + + +A+ DA E +K++P++SKGY
Sbjct: 18  AKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVKINPSWSKGY 77

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKK 216
           +RL  A     + +++   YKK LE+  D+A +  K G +   +
Sbjct: 78  NRLGAAHLGLGDLDDAESNYKKALEL--DAANKAAKDGLDQVHR 119

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 61/109 (55%), Gaps = 5/109 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+  AV+ YTE IK  P +A  ++NRAAA     ++ EA+ D  +AI+ DP + + Y R 
Sbjct: 408 DWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPNFVRAYIRK 467

Query: 176 AYAKYVQENFEESLE----AYKKVLEI-EGDSATEVTKRGYETAKKRVE 219
           A A+   + F  +LE    A  K  E+  G SA E+ +  Y+ +++R +
Sbjct: 468 ATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQLYYKASQQRFQ 516

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  K +  A+EKYTEAI +  T ++YF+NRA A+    N+  A+ D +EAIKLDP   K 
Sbjct: 23  VKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKA 82

Query: 172 YSRLA 176
           Y R A
Sbjct: 83  YHRRA 87

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 48/99 (48%), Gaps = 5/99 (5%)

Query: 140 NRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIE 199
           N    +   +++ +A++   EAI LD   S  +S  A+A +  +NF+ +L    + ++++
Sbjct: 17  NEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLD 76

Query: 200 GDSATEVTKRGYETAK----KRVEESLN-LEKSVPTESA 233
             +     +R          K+ ++ LN L K+ P +SA
Sbjct: 77  PKNIKAYHRRALSCMALLEFKKAKKDLNVLLKAKPKDSA 115

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 41/65 (63%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  K +  A+EKYTEAI +  T ++YF+NRA A+    N+  A+ D +EAIKLDP   K 
Sbjct: 23  VKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLDPKNIKA 82

Query: 172 YSRLA 176
           Y R A
Sbjct: 83  YHRRA 87

 Score = 30.4 bits (67), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 5/99 (5%)

Query: 140 NRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEIE 199
           N    +   +++ +A++   EAI LD   S  +S  A+A +  +NF+ +L    + ++++
Sbjct: 17  NEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEAIKLD 76

Query: 200 GDSATEVTKRGYETAK----KRVEESLN-LEKSVPTESA 233
             +     +R          K+  + LN L K+ P + A
Sbjct: 77  PKNIKAYHRRALSCMALLEFKKARKDLNVLLKAKPNDPA 115

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 2/109 (1%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           + ++DY  A+E YTEAIK+  T ++YF+NRA  +    N+   + D ++A+++DP   K 
Sbjct: 23  IKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDKALEIDPKNIKA 82

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R   +      F+ + +  K VL  + + AT   KRG +  +K + E
Sbjct: 83  YHRRGMSYIGLLEFKNAQKDLKIVLASKPNDAT--AKRGLDVCEKFIRE 129

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 36/76 (47%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F NR      +Q+Y  A++   EAIKLD   S  +S  A      +NF+  +    K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 195 VLEIEGDSATEVTKRG 210
            LEI+  +     +RG
Sbjct: 72  ALEIDPKNIKAYHRRG 87

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 40/65 (61%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  K +  A+EKYTEAI +  T  +YF+NRA ++    N+  A+ D +EAIKLDP   K 
Sbjct: 23  VKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKLDPKNIKA 82

Query: 172 YSRLA 176
           Y R A
Sbjct: 83  YHRRA 87

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  K +  A+EKYT+AI +  T ++YF+NRA A+    N+  A+ D +EA+KLDP   K 
Sbjct: 23  IKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDEALKLDPKNIKA 82

Query: 172 YSRLA 176
           Y R A
Sbjct: 83  YHRRA 87

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/106 (22%), Positives = 49/106 (46%), Gaps = 5/106 (4%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           NA+   N    +   +++ +A++   +AI LD   S  +S  A+A +  +NF+ +L    
Sbjct: 11  NALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCD 70

Query: 194 KVLEIEGDSATEVTKRGYETA-----KKRVEESLNLEKSVPTESAG 234
           + L+++  +     +R          KK  ++   L K+ P + AG
Sbjct: 71  EALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVLLKAKPNDPAG 116

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 72/146 (49%), Gaps = 13/146 (8%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           VASKDY  A+E YT+AI++    +++F+NRA A      +  A++D+ +AI+LD +  KG
Sbjct: 20  VASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSKAIELDSSNVKG 79

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATE----------VTKRGYETAKKRV--- 218
           Y R   A    ++F  +    + VL ++   AT           + +  +E A +     
Sbjct: 80  YHRRGMAYAGLQDFISAKRDLEVVLRVKPGEATAKRTLLACERMIRRERFEKAIRASGGN 139

Query: 219 EESLNLEKSVPTESAGGQTNPAAGGG 244
           EE   L K++  E   G T+    GG
Sbjct: 140 EEQQRLCKTLSLEMFAGNTDVGKYGG 165

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 6/111 (5%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           + S+DY  A+E YT+AI++  T++++++NRA A+    N+  A+ D  +AIKLD    K 
Sbjct: 23  IKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNNNIKA 82

Query: 172 YSR--LAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R  LAY   ++  F ++      +L+ + + AT   KRG E  +  + E
Sbjct: 83  YHRRGLAYVGLLE--FRKAKNDLTILLKYKPNDAT--AKRGLEMCESFIRE 129

 Score = 37.7 bits (86), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F +    Y  SQ+Y +A++   +AI+LD   S  YS  A A    +NF+ +L     
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 195 VLEIEGDSATEVTKRG 210
            ++++ ++     +RG
Sbjct: 72  AIKLDNNNIKAYHRRG 87

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 58.9 bits (141), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 63/111 (56%), Gaps = 6/111 (5%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  +D+  A++ YT+AI +  T ++YF+NRA A+    N+  ++ D +EA+KLDP  +K 
Sbjct: 23  IKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDEALKLDPKNAKA 82

Query: 172 YSR--LAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R  L+Y   ++  F+++    + VL+ +   AT    R  +  +K + E
Sbjct: 83  YHRRGLSYIGLLE--FKKAKNDLQIVLKAKPGDAT--ASRALDVCEKFIRE 129

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 36/76 (47%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+   N    +   Q++ +A+    +AI LD   S  +S  A A    +NF+ SL    +
Sbjct: 12  ALKLKNEGNIFIKKQDFTKAIDLYTKAIGLDSTQSIYFSNRALAHLKLDNFQSSLNDCDE 71

Query: 195 VLEIEGDSATEVTKRG 210
            L+++  +A    +RG
Sbjct: 72  ALKLDPKNAKAYHRRG 87

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 58.5 bits (140), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +   DYD A+E Y++AI +  T ++YF+NRA A+    N+  AV D + A+KLDP   K 
Sbjct: 23  IKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDNALKLDPKNIKA 82

Query: 172 YSR 174
           Y R
Sbjct: 83  YHR 85

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F N+   Y    +YD A++   +AI LD   S  +S  A A   Q+NF  ++     
Sbjct: 12  ALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNFYSAVVDCDN 71

Query: 195 VLEIEGDSATEVTKRG 210
            L+++  +     +RG
Sbjct: 72  ALKLDPKNIKAYHRRG 87

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 62/110 (56%), Gaps = 8/110 (7%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +++Y  A++ YTE IK  PT+ V + NRAA +       + + D ++AI +DP+Y K Y 
Sbjct: 442 NREYFKAMKCYTEMIKTNPTSPVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYV 501

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLN 223
           R  +A+  + + +E+LE ++      GD+A    K+ +   K  + ESL+
Sbjct: 502 RKGFAQITERDLDEALETWE-----SGDAA---NKKYHGNEKNELLESLH 543

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 52/85 (61%), Gaps = 1/85 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTN-AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           K Y+ AV  +T A+    TN  + ++NRAAA+   ++Y EA++D +  ++L P + KGYS
Sbjct: 22  KGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCVELAPNWDKGYS 81

Query: 174 RLAYAKYVQENFEESLEAYKKVLEI 198
           R+  A    +  +E+ E +KK L++
Sbjct: 82  RVGVAYLGLQKLDEAEENFKKALQL 106

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 66/128 (51%), Gaps = 5/128 (3%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  +D+  A E YT+AI+  PT +++++NRA A     N+  A+ D   AI+L+ +  K 
Sbjct: 20  LKQQDFQRANELYTKAIETDPTQSIFYSNRALANLKLDNFMNALNDCTNAIELNSSNLKA 79

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV--P 229
           Y R   A     NF+ +   +  VL+ + +    + K G++T +K + E    +K++   
Sbjct: 80  YHRRGLANIGLLNFKSARNDFNIVLKYKPNDI--IAKNGFDTCEKVIREE-RFKKAIGGS 136

Query: 230 TESAGGQT 237
            E  GG T
Sbjct: 137 DEKTGGAT 144

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  K Y  AVE YT+AI++  T +++F+NRA A     N+   + D   A++LDP   K 
Sbjct: 24  IKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNSALELDPKNIKA 83

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R   ++    +F+++      VL+ +   AT   KR  +  +K + E
Sbjct: 84  YHRRGLSQLGLLHFKKAKNDLSIVLKAKPSDAT--AKRALDMCEKVIRE 130

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 36/76 (47%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+   N    Y   + Y +AV+   +AI+LD   S  +S  A A+   +NF+  L+    
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 195 VLEIEGDSATEVTKRG 210
            LE++  +     +RG
Sbjct: 73  ALELDPKNIKAYHRRG 88

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 56/109 (51%), Gaps = 2/109 (1%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  +DY  A+EKY +AI++  T +VYF+NRA  +    N+  A +D ++A+ LDP   K 
Sbjct: 20  VKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKA 79

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R   A      F+++      VL+ +   A    KR  +  +K + E
Sbjct: 80  YHRRGLACVGLLEFKKARADLTVVLKAKPSDAA--AKRALDICEKVIRE 126

 Score = 30.8 bits (68), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 51/105 (48%), Gaps = 7/105 (6%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ + N   A    Q+Y +A++  ++AI+LD   S  +S  A      +NF+ + +   K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 195 VLEIEGDSATEVTKRG------YETAKKRVEESLNLEKSVPTESA 233
            L ++  +     +RG       E  K R + ++ L K+ P+++A
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVVL-KAKPSDAA 112

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +KD++ A+E YT AI  L  + V+++NR+AAY +  N+++ V+D   A+KL P YSK + 
Sbjct: 117 AKDFEKAIEYYTLAIS-LKEDPVFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWL 175

Query: 174 RLAYA 178
           R A A
Sbjct: 176 RRASA 180

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 2/75 (2%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  K++  A E Y++AI++  T ++YF+NRA A+    N+  A+ D  +AI+LDP   K 
Sbjct: 23  IKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNKAIELDPKNVKA 82

Query: 172 YSR--LAYAKYVQEN 184
           Y R  L+Y   ++ N
Sbjct: 83  YHRRGLSYIGLLEFN 97

 Score = 36.6 bits (83), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F N+   +   +N+ +A +   +AI+LD   S  +S  A+A    +NF+ +L    K
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 195 VLEIEGDSATEVTKRG 210
            +E++  +     +RG
Sbjct: 72  AIELDPKNVKAYHRRG 87

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 39/63 (61%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  ++Y  A+E Y++AI++ PT +++F+NRA A     N+   + D + A++LDP   K 
Sbjct: 23  IKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDVALRLDPKNIKA 82

Query: 172 YSR 174
           Y R
Sbjct: 83  YHR 85

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 37/76 (48%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           AV F N    Y   QNY +A++   +AI+LDP  S  +S  A A+   +NF+  +     
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIELDPTQSIFFSNRALAQLKLDNFQSCMNDCDV 71

Query: 195 VLEIEGDSATEVTKRG 210
            L ++  +     +RG
Sbjct: 72  ALRLDPKNIKAYHRRG 87

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 2/109 (1%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  ++Y  A+E YT+AI++ P  +++++NRA A     N+  A  D  EA+ LD    K 
Sbjct: 23  IKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKA 82

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEE 220
           Y R   A      F+ +      VL+ +   AT +  R     ++ + E
Sbjct: 83  YHRRGLANVGLLEFKRARNDLNVVLKAKPSDATAL--RALNVCERFIRE 129

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 43/94 (45%), Gaps = 4/94 (4%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           AV F N    +   QNY +A++   +AI+LDP  S  YS  A A+   +NF+ +     +
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNE 71

Query: 195 VLEIEGDSATEVTKRGYETAK----KRVEESLNL 224
            L ++  +     +RG         KR    LN+
Sbjct: 72  ALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNV 105

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 38/68 (55%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V +KDY  AVE YT AI+   T +++F+NRA A      +  A++D+  AI+LD    K 
Sbjct: 49  VKAKDYARAVEAYTRAIEADGTQSIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKA 108

Query: 172 YSRLAYAK 179
           Y R   A 
Sbjct: 109 YHRRGLAH 116

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 63/112 (56%), Gaps = 8/112 (7%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  +D+  A E YT+AI++  T +++F+NRA A+    N+  ++ D ++A++LD    K 
Sbjct: 23  VKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDKALELDSKNIKA 82

Query: 172 YSR--LAYAKYVQENFEESLEAYKKVLEIE-GDSATEVTKRGYETAKKRVEE 220
           Y R  L+Y   ++  F+++    K VL+ + GD A +   R  +  +K + E
Sbjct: 83  YHRRGLSYVGLLE--FKKARTDLKTVLKSKPGDVAAD---RALQICEKFIRE 129

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ + ++   +   Q++ +A +   +AI+LD   S  +S  A A   Q+NF+ SL    K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 195 VLEIEGDSATEVTKRG 210
            LE++  +     +RG
Sbjct: 72  ALELDSKNIKAYHRRG 87

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 68/132 (51%), Gaps = 7/132 (5%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  K Y  AVE Y++AI++  T ++YF+NRA +     N+  A +D ++AI LDP   K 
Sbjct: 21  VKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDKAIALDPKNIKA 80

Query: 172 YSR--LAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVP 229
             R  L+Y   ++  F ++ +  + VL+++ +  + +  +  E  +K + E     K++ 
Sbjct: 81  IHRRGLSYVGLLE--FFKARKDLRVVLQVKPNEQSAL--KALEVCEKFIREE-KFRKAIG 135

Query: 230 TESAGGQTNPAA 241
               G + N  A
Sbjct: 136 GGDDGVKINVCA 147

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 40/76 (52%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F N+  AY   + Y EAV+   +AI+LD   S  +S  A+++   +NF  + E   K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 195 VLEIEGDSATEVTKRG 210
            + ++  +   + +RG
Sbjct: 70  AIALDPKNIKAIHRRG 85

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 59/105 (56%), Gaps = 9/105 (8%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           +  K Y  AVE Y++AI++  T +++F+NRA +     N+  A++D  ++I+LDP   K 
Sbjct: 23  IKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNKSIELDPKNIKA 82

Query: 172 YSR--LAYAKYVQENFEESLEAYKKVLEIEGD-----SATEVTKR 209
             R  L+Y   ++  F ++ +  K +L+++ +      A EV +R
Sbjct: 83  IHRRGLSYVGLLE--FSKARKDLKTILQVKPNEQSALKALEVCER 125

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ F N+  A+   + Y EAV+   +AI+LD   S  +S  A+++   +NF  +LE   K
Sbjct: 12  ALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDNFLTALEDCNK 71

Query: 195 VLEIEGDSATEVTKRG 210
            +E++  +   + +RG
Sbjct: 72  SIELDPKNIKAIHRRG 87

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 52/88 (59%), Gaps = 1/88 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           SK++D A++ Y  AI++ P + V+++N +A Y ++ + ++ V+   +A+++ P +SK   
Sbjct: 138 SKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALL 197

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 198 RRASANESLGNFTDAMFDL-SVLSLNGD 224

 Score = 37.4 bits (85), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 39/76 (51%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           AV   ++   +  S+N+D+A+K  + AI+LDP     YS ++       +  + +E   K
Sbjct: 125 AVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDPVFYSNMSACYISTGDLNKVVEYTTK 184

Query: 195 VLEIEGDSATEVTKRG 210
            LEI+ D +  + +R 
Sbjct: 185 ALEIKPDHSKALLRRA 200

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 38/75 (50%), Gaps = 3/75 (4%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176
           Y+  +E   E  KI   N   FANRAA     +NY   + D + A+ L+P   K Y R+ 
Sbjct: 103 YNKGIEIKCENDKI---NEALFANRAACQLELKNYRSCINDCKHALTLNPKNIKCYYRMG 159

Query: 177 YAKYVQENFEESLEA 191
            A Y+  N EE+ E+
Sbjct: 160 KAFYLLNNIEEAKES 174

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 115 KDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           K Y  A E Y + I+I       N   F+NRAA     +NY   V D  +A++ +P   K
Sbjct: 92  KRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCRQALQFNPTNIK 151

Query: 171 GYSRLAYAKYVQENFEESLEAYKKVLEIEGDSA 203
            + R+A A ++ +  E++ EA +  L+++ +SA
Sbjct: 152 CFYRIARAFFLLDKCEDAKEAIEFGLKLDSESA 184

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 45/76 (59%), Gaps = 1/76 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K YD A++ Y+ AI++   + V+++NR+A Y +    ++ V+D   A+KL P YSK   
Sbjct: 108 NKKYDEAIQYYSWAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLL 166

Query: 174 RLAYAKYVQENFEESL 189
           R A A     NF +++
Sbjct: 167 RRASANESLGNFADAM 182

>CAGL0K09240g Chr11 complement(914042..914470) [429 bp, 142 aa] {ON}
           weakly similar to uniprot|P25638 Saccharomyces
           cerevisiae YCR060w
          Length = 142

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 19/39 (48%), Positives = 28/39 (71%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEA 154
           +YDLA+E+Y + I + PTNAV ++N A AY  ++  DEA
Sbjct: 50  EYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEA 88

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 43/86 (50%), Gaps = 6/86 (6%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           N   +ANRAA     +NY   + D ++A++L+P   K Y R+A A    E  +E+LE+  
Sbjct: 118 NESLYANRAACELEIKNYRRCINDCKQALQLNPKNIKCYYRIAKAFTALERLDEALES-- 175

Query: 194 KVLEIEGDSATEVTKRGYETAKKRVE 219
               IE     + T +  +T K  +E
Sbjct: 176 ----IEFGEKIDNTNKSLKTLKLHIE 197

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 3/117 (2%)

Query: 112 VASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           V  K Y  A E YT+AI+  P N + ++NRA       N+  ++ DA+ AI+LD    K 
Sbjct: 24  VKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLDNFQSSLDDAKRAIELDNNNLKA 83

Query: 172 YSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSV 228
           Y R A + Y+     E  +A K ++ +      E+T +       +V +  N EK++
Sbjct: 84  YHRRAMS-YI--GLLEFRKARKDLIIVLKFKPNELTAKNALAICDKVIQKENFEKAI 137

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 42/86 (48%), Gaps = 1/86 (1%)

Query: 125 TEAIKIL-PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           TE +K   P  A+   N    +   + Y +A +   +AI+ DP  +  YS  A+     +
Sbjct: 2   TEEVKACNPEKALELKNEGNKFVKEKLYAKAAEYYTKAIEHDPENTILYSNRAFTNLKLD 61

Query: 184 NFEESLEAYKKVLEIEGDSATEVTKR 209
           NF+ SL+  K+ +E++ ++     +R
Sbjct: 62  NFQSSLDDAKRAIELDNNNLKAYHRR 87

>Ecym_4031 Chr4 complement(73900..75966) [2067 bp, 688 aa] {ON}
           similar to Ashbya gossypii ADR230W
          Length = 688

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 53/121 (43%), Gaps = 15/121 (12%)

Query: 132 PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAY----------AKYV 181
           P   +   NRAA++    N  +A+ DA+  IK+D    KGY R             A YV
Sbjct: 67  PRYLILLDNRAASWERINNLGKALIDADRMIKVDAYNLKGYIRKGKILQKMAQDKEALYV 126

Query: 182 -QENFEESLEAYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGGQTNPA 240
            +E   ++ EAY+   E       E+     E  K  V + LNL+K  PT  A  +T+  
Sbjct: 127 YREGLSKAKEAYQLHFEKPPSKFVEIV----EHQKNEVIKRLNLQKLTPTTGASKRTHIE 182

Query: 241 A 241
           A
Sbjct: 183 A 183

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 50/87 (57%), Gaps = 2/87 (2%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           KDYD A++ Y  A+  L  + V+++N +A Y +    D+ V+++ +A++L P YSK   R
Sbjct: 120 KDYDNALKYYDYAL-TLKKDPVFYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLR 178

Query: 175 LAYAKYVQENFEESLEAYKKVLEIEGD 201
            A A    EN+ +++     VL + GD
Sbjct: 179 RASANESLENYPDAMFDL-SVLSLNGD 204

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%)

Query: 122 EKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYV 181
           E + +AIK+ P NA  + +R   Y  +  Y++A +D ++A +L+      Y +LA   Y 
Sbjct: 371 EFFDKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYR 430

Query: 182 QENFEE 187
           +  F++
Sbjct: 431 ENKFDD 436

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 51/87 (58%), Gaps = 2/87 (2%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           KDYD A++ Y  A+ ++  + V+++N +A Y +    D+ V+++ +A++L P YSK   R
Sbjct: 115 KDYDNALKYYNYAL-VVKKDPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLR 173

Query: 175 LAYAKYVQENFEESLEAYKKVLEIEGD 201
            A A    EN+ +++     VL + GD
Sbjct: 174 RASANESLENYADAMFDL-SVLSLNGD 199

>NDAI0C05130 Chr3 (1193350..1195122) [1773 bp, 590 aa] {ON}
           Anc_8.470
          Length = 590

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 3/97 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           ++ D+D  +E +  A+KI P + + +    A+  NS   +EA+K   +AI L P++ +  
Sbjct: 453 SNDDFDKTLECFQNALKINPNDELMWNRLGASLANSNRSEEAIKAYHKAINLKPSFVRAR 512

Query: 173 SRLAYAKYVQENFEES---LEAYKKVLEIEGDSATEV 206
             LA A      ++E+   L    K+ ++ G   T V
Sbjct: 513 YNLAVASMNIGCYQEAAGHLLTVLKMHQVHGQDNTSV 549

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 50/88 (56%), Gaps = 2/88 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +KDY  A++ Y  A+  L  + ++++N +A Y +    D+ ++ + +A++L+P YSK   
Sbjct: 135 AKDYTNAIKYYNLALD-LNKDPIFYSNISACYVSLGQLDKVIESSTKALELNPNYSKALL 193

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A    EN+ ++L     VL + GD
Sbjct: 194 RRASANESLENYSDALFDL-SVLSLNGD 220

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 45/89 (50%), Gaps = 4/89 (4%)

Query: 115 KDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           K +  A E YT+ IK+       N   FANRAA     +NY   V D ++A++++P   K
Sbjct: 99  KRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQKAMEINPMNLK 158

Query: 171 GYSRLAYAKYVQENFEESLEAYKKVLEIE 199
            + R+  A      F+E+ +A    L+I+
Sbjct: 159 CFYRMGKAFLALGKFKEAHDAVSFGLKID 187

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 1/75 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           KDY+ A++ Y  A+ IL  + V+++N +A Y +    D+ ++ + +A++L P YSK   R
Sbjct: 122 KDYENALKFYDFAL-ILKKDPVFYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLR 180

Query: 175 LAYAKYVQENFEESL 189
            A A    EN+ +++
Sbjct: 181 RATANEQLENYSDAM 195

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 41/64 (64%), Gaps = 1/64 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           KD++ A++ YT A+  L  + VY++N +A Y++  NY++ ++ A +A+ L P YSK   R
Sbjct: 109 KDFENAIKYYTFALS-LKEDPVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVR 167

Query: 175 LAYA 178
            A A
Sbjct: 168 RANA 171

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 58/111 (52%), Gaps = 8/111 (7%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           Y +A+K+   NA  + +R   Y  +Q Y++A +D ++A +LDP     Y +LA   Y + 
Sbjct: 363 YEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYREN 422

Query: 184 NFE--ESL--EAYKKV---LEIEGDSATEVTKRG-YETAKKRVEESLNLEK 226
            F+  E+L  EA +K     E+    A  +  +G ++ A K  E ++ LEK
Sbjct: 423 KFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEK 473

>NCAS0B02560 Chr2 complement(427447..429183) [1737 bp, 578 aa] {ON}
           Anc_8.470
          Length = 578

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 3/107 (2%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A  D+D  +E + E++KI P + V +    A+  NS   ++A++    A+ L P++ +  
Sbjct: 443 AEDDFDKTIECFKESLKINPNDEVMWNRLGASLANSNKPEDAIQAYHRALNLKPSFVRAR 502

Query: 173 SRLAYAKYVQENFEESLEAYKKVL---EIEGDSATEVTKRGYETAKK 216
             LA A      ++E+ E    VL   ++EG +  E      E  K+
Sbjct: 503 YNLAVASMNIGCYKEAGEHLLTVLRMHQVEGVNNVETDNNVLEILKR 549

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 50/88 (56%), Gaps = 1/88 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K +  A++ Y  AI++ P + V+++N +A Y ++ + D+ V+   +A+++ P +SK   
Sbjct: 144 AKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALL 203

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 204 RRASANESLGNFTDAMFDL-SVLSLNGD 230

 Score = 30.4 bits (67), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 39/76 (51%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           AV   ++   +  ++++ +A+K  + AI+LDP     YS ++       + ++ +E   K
Sbjct: 131 AVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDPVFYSNISACYISTGDLDKVVEYTTK 190

Query: 195 VLEIEGDSATEVTKRG 210
            LEI+ D +  + +R 
Sbjct: 191 ALEIKPDHSKALLRRA 206

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           AV   NR   +  ++N++EA+K  + AI+LDP     YS ++       + E+ +E   K
Sbjct: 127 AVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTK 186

Query: 195 VLEIEGDSATEVTKRG 210
            LEI+ D +  + +R 
Sbjct: 187 ALEIKPDHSKALLRRA 202

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K+++ A++ Y  AI++ P   V+++N +A Y ++ + ++ ++   +A+++ P +SK   
Sbjct: 140 AKNFNEAIKYYQYAIELDPNEPVFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALL 199

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 200 RRASANESLGNFTDAMFDL-SVLSLNGD 226

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           + +A+ + P     + +R   Y   Q+Y  A +D ++A  L+P     Y +LA   Y Q 
Sbjct: 401 FQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQG 460

Query: 184 NFEESLEAYKKVLEIEGDSATEV--------TKRG-YETAKKRVEESLNLEK 226
            F ES EA+    +++  +  EV        T RG ++TA K+ + +  LE+
Sbjct: 461 KFTES-EAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEE 511

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 40.0 bits (92), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 120 AVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           A E Y +AI +       N   +ANRAA     +NY   + D + A+ L+P   K Y R+
Sbjct: 93  ARELYNKAIDVKCDDDKINESLYANRAACELELKNYRRCINDCKMALSLNPKNIKCYFRM 152

Query: 176 AYAKYVQENFEESLEA 191
           A A    E F++  EA
Sbjct: 153 AKAFLAIEKFDDCKEA 168

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 39.7 bits (91), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 61/123 (49%), Gaps = 11/123 (8%)

Query: 115 KDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           K Y  A E YT+ I +       N   +ANRAA     +N+ + ++D ++A+  +    K
Sbjct: 88  KQYRDAREVYTKGIDVKCDDDKINESLYANRAACELELKNFRKCIEDCKKALSFNVKNIK 147

Query: 171 GYSRLAYAKYVQENFEESLEAYKKVLEIEGDSAT------EVTKRGYETAKKR-VEESLN 223
            Y R+  A    + F+ES E+ +  L+I+ ++ +       + KR  E  +++ +E  + 
Sbjct: 148 CYYRMGKAFLSVDRFDESKESIEFGLKIDSENKSLKNLLQAIEKRQLEIQRRKDMEMKIK 207

Query: 224 LEK 226
           LEK
Sbjct: 208 LEK 210

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score = 39.7 bits (91), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 34/63 (53%), Gaps = 6/63 (9%)

Query: 122 EKYTEAIKI------LPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           ++Y EAIK       L  + V+++NR+A Y      ++ V+D   A+KL P YSK   R 
Sbjct: 109 QRYEEAIKFYDCALKLKEDPVFYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRR 168

Query: 176 AYA 178
           A A
Sbjct: 169 ATA 171

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 38/67 (56%)

Query: 122 EKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYV 181
           + + +A+++ P ++  + +RA      Q +D+A KD ++A + DP+    Y +LA   Y 
Sbjct: 360 QNFEKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYR 419

Query: 182 QENFEES 188
           ++ F++ 
Sbjct: 420 EKKFDDC 426

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 47/86 (54%), Gaps = 7/86 (8%)

Query: 122 EKYTEAIKI------LPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           +KY +A+K       L  + V+++N +A Y +  N ++ V+ + +A++L P YSK   R 
Sbjct: 113 QKYEDALKYYNYALDLKQDPVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRR 172

Query: 176 AYAKYVQENFEESLEAYKKVLEIEGD 201
           A A    ENF E++     VL + GD
Sbjct: 173 ASANENLENFAEAMFDL-SVLSLNGD 197

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 43/75 (57%), Gaps = 1/75 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           K Y+ A++ Y+ A++ L  + V+++NR+A +      ++ V+D   A++L P YSK   R
Sbjct: 112 KKYEEAIKYYSCALR-LKKDPVFYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLR 170

Query: 175 LAYAKYVQENFEESL 189
            A A     NF +++
Sbjct: 171 RATANESLGNFADAM 185

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 39/71 (54%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           N + F N+AA     +NY   + D ++A+  +P   K Y R+A A    E ++ES E+ +
Sbjct: 111 NELLFVNKAACELEMKNYRSCINDCKKALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE 170

Query: 194 KVLEIEGDSAT 204
             L+++  +++
Sbjct: 171 FGLKVDSRNSS 181

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 61/125 (48%), Gaps = 17/125 (13%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           K ++ A+E Y  AIK L  + V+ +N +A Y +  + D+ V+ +  A++L P YSK   R
Sbjct: 107 KRFEDAIEFYNHAIK-LHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLR 165

Query: 175 LAYA-----KYVQENFEESLEAYKKVLEIEGD----SATEVTKRGYETAKKRV-EESLNL 224
            A A     +Y    F+ S      VL + GD    S   + +R       RV +E + +
Sbjct: 166 RASAYENMGRYQDAMFDIS------VLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGI 219

Query: 225 EKSVP 229
           + SVP
Sbjct: 220 DASVP 224

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 3/67 (4%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           S+DY    EK   AI + P NA  + +R   Y  +QNY++A +D +++ + DP     Y 
Sbjct: 362 SEDYFSYFEK---AIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESDPKNIFPYI 418

Query: 174 RLAYAKY 180
           +LA   Y
Sbjct: 419 QLACLAY 425

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 38.9 bits (89), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 65/134 (48%), Gaps = 29/134 (21%)

Query: 116 DYDLAVEKYTEAIKILPT----NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDP----- 166
           DY  A + Y +++  LP       V F+N          Y EA+ DA  A+KL P     
Sbjct: 340 DYHAAFQNYEKSLNSLPLTHPLRVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMN 399

Query: 167 ----------AYSKGYSRLAYAKYVQ----ENFEESLEAYKKVLEIEGDSATEVTKRGYE 212
                      Y + +S++   K V     EN+E++LE Y++++E  G ++++V +    
Sbjct: 400 SNIPNLNPPKTYKEFWSKIMNNKAVAFERVENYEKALETYQQLIEA-GVTSSKVLE---- 454

Query: 213 TAKKRVEESLNLEK 226
            A+++ ++++ LEK
Sbjct: 455 -ARRQCQKAIALEK 467

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 38.1 bits (87), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 13/120 (10%)

Query: 114 SKDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           +K +  A E Y + I+I       N   FAN AA     +N+   +   ++A++ +P   
Sbjct: 91  AKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQKALQFNPKNM 150

Query: 170 KGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG---------YETAKKRVEE 220
           K Y R+A A Y     +E+ E+ K  L I+ ++ +  T  G         +E   KR+EE
Sbjct: 151 KCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENKSLQTLEGVIDRKQQELHEAEVKRLEE 210

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 38.1 bits (87), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%)

Query: 136 VYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEA 191
           +   NRAA     +NY   + D  EA+KL+P   K + R+  A    +  EE+ EA
Sbjct: 116 LLLLNRAACELELKNYRRCINDCREALKLNPKNPKAFFRIGKAFLQLDKLEEAAEA 171

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 51/88 (57%), Gaps = 1/88 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K++  A++ Y  AI++ P + V+++N +A Y ++ + ++ ++   +A+++ P +SK   
Sbjct: 137 TKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYTTKALEIKPDHSKALL 196

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 197 RRASANESLGNFTDAMFDL-SVLSLNGD 223

 Score = 37.4 bits (85), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%)

Query: 133 TNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAY 192
           T AV   N+   +  ++N+ EA+K  + AI+LDP     YS ++       +  + LE  
Sbjct: 122 TYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSNISACYISTGDLNKVLEYT 181

Query: 193 KKVLEIEGDSATEVTKRG 210
            K LEI+ D +  + +R 
Sbjct: 182 TKALEIKPDHSKALLRRA 199

>SAKL0H10934g Chr8 complement(945834..946976) [1143 bp, 380 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 380

 Score = 38.1 bits (87), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 45/94 (47%), Gaps = 4/94 (4%)

Query: 114 SKDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           ++ Y  A E Y + +++       N   F NRAA     +N+   + D +EA++ +P   
Sbjct: 93  ARRYKDARELYNKGVEVHCDDDAINESLFLNRAACELELKNHRRCINDCKEALRYNPKNV 152

Query: 170 KGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSA 203
           K + R+  A +     EE+ EA +  L  + ++A
Sbjct: 153 KCFYRMGRAFFSLNKLEEAKEAIEFGLRFDSNNA 186

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score = 38.1 bits (87), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K ++ A++ Y+ AI++   + V+++NR+A Y +    ++ V+D   A+KL P YSK   
Sbjct: 109 NKQFEDALKYYSLAIEV-KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLL 167

Query: 174 RLAYA 178
           R A A
Sbjct: 168 RRASA 172

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLA 176
           ++ A++ Y  AI+ L  N ++++N +A Y +    +E +K   +A++L P YSK   R A
Sbjct: 127 FEEAIKYYNWAIE-LKENPIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRA 185

Query: 177 YAKYVQENFEESLEAYKKVLEIEGD 201
            A    EN+ +++     VL + GD
Sbjct: 186 NANEKLENYADAMFDL-SVLSLNGD 209

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score = 37.7 bits (86), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 37/56 (66%), Gaps = 1/56 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           KDY+ A+  Y  A++ L  + V+++N AA Y + ++  EA++   +A++L+P YSK
Sbjct: 100 KDYENAINYYKFALQ-LKNDPVFYSNMAACYISLEHNKEAIEACSKALELNPDYSK 154

 Score = 30.8 bits (68), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 141 RAAAYTNSQNYDEAVKDAEEAIKL--DPAYSKGYSRLAYAKYVQENFEESLEAYKKVLEI 198
           R  AY   ++Y+ A+   + A++L  DP +   YS +A      E+ +E++EA  K LE+
Sbjct: 92  RGNAYFKVKDYENAINYYKFALQLKNDPVF---YSNMAACYISLEHNKEAIEACSKALEL 148

Query: 199 EGDSATEVTKRG--YETAKKRVEESLNL 224
             D +  + KR   YE   K  +  L+L
Sbjct: 149 NPDYSKVLLKRAAVYENIGKFADALLDL 176

>KLTH0E10934g Chr5 (981831..983537) [1707 bp, 568 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 568

 Score = 37.7 bits (86), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 50/106 (47%), Gaps = 5/106 (4%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           DYD  V+ +  A+ + P + + +    A+  NS   +EA++   +A++L P + +    L
Sbjct: 434 DYDKTVDCFRAALAVKPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 493

Query: 176 AYAKYVQENFEESLEAYKKVL---EIEG--DSATEVTKRGYETAKK 216
           A +      F+E+ E     L   E+EG   S T  +    ET K+
Sbjct: 494 AVSCMNMGCFKEAAEYLLTALSMHEVEGILPSETPASSNLIETLKR 539

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score = 37.7 bits (86), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           A++ Y  A+K L  + +Y++N +A Y +   Y++ ++ A +A+KL P +SK   R A A 
Sbjct: 129 AIKYYHYALK-LKDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAY 187

Query: 180 YVQENFEESL 189
               NF +++
Sbjct: 188 EAMGNFGDAM 197

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 61/123 (49%), Gaps = 8/123 (6%)

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
           ++ + +A+++ P N   + +R  +Y  +Q Y++A KD ++  +LD      Y +LA   Y
Sbjct: 374 LQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLAY 433

Query: 181 VQENFE--ESL--EAYKKV---LEIEGDSATEVTKRG-YETAKKRVEESLNLEKSVPTES 232
            +  F+  E+L  EA +K     E+    A  +  RG  E A K  ++++ LE   P E 
Sbjct: 434 RESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELEAKTPEEI 493

Query: 233 AGG 235
             G
Sbjct: 494 HVG 496

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 30/54 (55%)

Query: 138 FANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEA 191
           FAN+AA     +N+   + D + A++L+P   K Y R+  A +  +  EE+ E+
Sbjct: 118 FANKAACELELKNFRRCINDCKNALQLNPKNVKCYFRMTRAFFALDKLEEAKES 171

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.4 bits (80), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 27/48 (56%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKL 164
           Y  A+  Y   I I P+N + ++N+A A   +  +DEA+   E+ ++L
Sbjct: 19  YSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQL 66

>Kwal_27.11737 s27 (926622..928349) [1728 bp, 575 aa] {ON} YDR244W
           (PEX5) - 1:1 [contig 27] FULL
          Length = 575

 Score = 37.4 bits (85), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 12/114 (10%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           DYD  V+ +  A+ + P + + +    A+  NS   +EA++   +A++L P + +    L
Sbjct: 441 DYDKTVDCFRAALAVRPDDELMWNRLGASLANSNRSEEAIQAYRKALQLKPTFVRARCNL 500

Query: 176 AYAKYVQENFEESLEAYKKVL---EIEG---------DSATEVTKRGYETAKKR 217
           A +      ++E+ E     L   E+EG         ++  E  KR +   ++R
Sbjct: 501 AVSCMNMGCYKEAAEYLLTALSMHEVEGILPSETPASNNLIETLKRAFIGMERR 554

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 37.4 bits (85), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           + +A+K+ P N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 386 FDKALKLNPNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 184 NFEE 187
            F++
Sbjct: 446 KFDD 449

 Score = 34.3 bits (77), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K YD A++ Y  A++ L  + V+++N +A Y +  +  + V+ + +A+++ P YSK   
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLL 170

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 171 RRASANEGLGNFADAMFDL-SVLSLNGD 197

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 37.0 bits (84), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 4/79 (5%)

Query: 114 SKDYDLAVEKYTEAIKI----LPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           +K +  A E YT+ I +       N   FANRAA     +NY   ++D  +A+ ++P   
Sbjct: 96  AKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCSKALTINPKNI 155

Query: 170 KGYSRLAYAKYVQENFEES 188
           K Y R + A +     EE+
Sbjct: 156 KCYYRTSKAFFSLSKLEEA 174

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 36.6 bits (83), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 40/79 (50%), Gaps = 4/79 (5%)

Query: 114 SKDYDLAVEKYTEAIKI----LPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           +K +  A E YT+ + +       N   FANRAA     +NY + V+D  +A+ ++P   
Sbjct: 96  AKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCGKALTINPKNI 155

Query: 170 KGYSRLAYAKYVQENFEES 188
           K Y R++ + +     EE+
Sbjct: 156 KCYYRISKSFFQLRKLEEA 174

>CAGL0K11209g Chr11 (1089300..1091072) [1773 bp, 590 aa] {ON}
           similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244w PAS10 peroxisomal targeting signal receptor
          Length = 590

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 50/99 (50%), Gaps = 3/99 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A+ ++D  ++ +  A+K+ P + + +    A+  NS   +EA++    A++L P++ +  
Sbjct: 436 ANDEFDRTIDCFQAALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 495

Query: 173 SRLAYAKYVQENFEESLEAYKKVL---EIEGDSATEVTK 208
             LA +      ++E+ E     L   ++EG+   + T+
Sbjct: 496 YNLAVSSMNIGCYKEAAEHLLTALSMHDVEGEFEVQSTR 534

>AFR453W Chr6 (1251460..1253169) [1710 bp, 569 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR244W (PEX5)
          Length = 569

 Score = 36.6 bits (83), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 43/91 (47%), Gaps = 3/91 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A++D+D  ++ +  A+ + P +   +    A+  NS   +EA++    AI+L P + +  
Sbjct: 429 ANEDFDKTIDCFRAALAVRPDDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPTFVRAR 488

Query: 173 SRLAYAKYVQENFEESLEAYKKVL---EIEG 200
             LA +      + E+ E     L   E+EG
Sbjct: 489 YNLAVSSMNIGCYREAAEHLLTALSMHEVEG 519

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score = 36.2 bits (82), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           K +D A++ Y  A++ L  + V+++NR+A Y +    ++ V+D   A+KL   YSK   R
Sbjct: 116 KKFDDAIKYYNLALE-LKKDPVFYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLR 174

Query: 175 LAYA 178
            A A
Sbjct: 175 RASA 178

 Score = 31.2 bits (69), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 58/120 (48%), Gaps = 20/120 (16%)

Query: 121 VEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKY 180
            E + +A+++ P  A  + +R   Y  +Q Y+ A KD ++A + +      Y +LA   Y
Sbjct: 366 FENFDKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAY 425

Query: 181 VQENFE--ESLEA---------------YKKVLEIEGDSATEVTKRGYETAKKRVEESLN 223
            +  FE  E+L +               Y ++L  +GD A    K+ YE A+K +E++L+
Sbjct: 426 RENKFEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLAN--AKKQYEIARK-LEDALD 482

>Ecym_1396 Chr1 (820413..822134) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AFR453W
          Length = 573

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 44/91 (48%), Gaps = 3/91 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A+ ++D  ++ +  A+ + P +   +    A+  NS   +EA++    AI+L PA+ +  
Sbjct: 433 ANDEFDKTIDCFKAALHVRPNDECMWNRLGASLANSNRSEEAIQAYHRAIQLKPAFVRAR 492

Query: 173 SRLAYAKYVQENFEESLEAYKKVL---EIEG 200
             LA +      ++E+ E     L   E+EG
Sbjct: 493 YNLAVSSMNIGCYKEAAEQLLTALSMHEVEG 523

>Suva_2.410 Chr2 (729992..731827) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+D  ++ +  A+K+ P + + +    A+  NS   +EA++    A++L P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 A 176
           A
Sbjct: 532 A 532

>Skud_4.506 Chr4 (905143..906978) [1836 bp, 611 aa] {ON} YDR244W
           (REAL)
          Length = 611

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+D  ++ +  A+K+ P + + +    A+  NS   +EA++    A++L P++ +    L
Sbjct: 472 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 A 176
           A
Sbjct: 532 A 532

>KAFR0E02820 Chr5 (570013..571701) [1689 bp, 562 aa] {ON} Anc_8.470
           YDR244W
          Length = 562

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A+ D+D  +E +  A+   PT+ + +    AA  NS   ++++K   +AI+L P++ +  
Sbjct: 418 ANDDFDKTIECFKAALNENPTDELMWNRLGAALANSNRSEDSIKAYYKAIQLKPSFVRAR 477

Query: 173 SRLAYAKYVQENFEESLEAYKKVLEIE 199
             LA A      ++E+ E     L + 
Sbjct: 478 YNLAVACMNIHCYKEAAEHLLTALSMH 504

>SAKL0H11946g Chr8 complement(1020512..1022233) [1722 bp, 573 aa]
           {ON} similar to uniprot|P35056 Saccharomyces cerevisiae
           YDR244W PEX5 Essential for import of proteins with SKL-
           like import signal into peroxisomal matrix 69-kDa
           protein containing tetratricopeptide repeat (TPR)
          Length = 573

 Score = 35.8 bits (81), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 35/64 (54%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A++DYD  ++ +  A+ + P + + +    A+  NS   +EA++    A++L P++ +  
Sbjct: 434 ANEDYDKTIDCFKAALTVKPDDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRAR 493

Query: 173 SRLA 176
             LA
Sbjct: 494 YNLA 497

>Smik_4.491 Chr4 (895429..897267) [1839 bp, 612 aa] {ON} YDR244W
           (REAL)
          Length = 612

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/61 (24%), Positives = 33/61 (54%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+D  ++ +  A+K+ P + + +    A+  NS   +EA++    A++L P++ +    L
Sbjct: 473 DFDKTIDCFESALKVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 532

Query: 176 A 176
           A
Sbjct: 533 A 533

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 29/55 (52%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEES 188
           N   FAN+AA     +NY   ++D  +A+ ++P  +K Y R + A +     EE+
Sbjct: 120 NESLFANKAACELELKNYRRCIEDCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.4 bits (80), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K YD A++ Y  A++ L  + V+++N +A Y +  +  + V+ + +A++L P YSK   
Sbjct: 112 NKKYDDAIKYYNWALE-LKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLL 170

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 171 RRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 33.9 bits (76), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           + +A+K+   N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 184 NFEE 187
            F++
Sbjct: 446 KFDD 449

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/88 (30%), Positives = 49/88 (55%), Gaps = 2/88 (2%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K YD A++ Y  A++ L  + V+++N +A Y +  +  + V+ + +A++L P YSK   
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLL 170

Query: 174 RLAYAKYVQENFEESLEAYKKVLEIEGD 201
           R A A     NF +++     VL + GD
Sbjct: 171 RRASANEGLGNFADAMFDL-SVLSLNGD 197

 Score = 33.5 bits (75), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           + +A+K+   N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 386 FDKALKLDLNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 184 NFEE 187
            F++
Sbjct: 446 KFDD 449

>YDR244W Chr4 (950563..952401) [1839 bp, 612 aa] {ON}
           PEX5Peroxisomal membrane signal receptor for the
           C-terminal tripeptide signal sequence (PTS1) of
           peroxisomal matrix proteins, required for peroxisomal
           matrix protein import; also proposed to have
           PTS1-receptor independent functions
          Length = 612

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 33/61 (54%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           D+D  ++ +  A+++ P + + +    A+  NS   +EA++    A++L P++ +    L
Sbjct: 472 DFDKTIDCFESALRVNPNDELMWNRLGASLANSNRSEEAIQAYHRALQLKPSFVRARYNL 531

Query: 176 A 176
           A
Sbjct: 532 A 532

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 35.0 bits (79), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 4/79 (5%)

Query: 114 SKDYDLAVEKYTEAIKI----LPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           +K +  A E Y + I+I       N   +ANRAA     +NY   + D + A++ +P   
Sbjct: 91  AKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKTALQYNPKNL 150

Query: 170 KGYSRLAYAKYVQENFEES 188
           K Y R+  A    E  EE+
Sbjct: 151 KCYYRMGKAFLALELLEEA 169

>NDAI0I00440 Chr9 complement(89650..90036) [387 bp, 128 aa] {ON}
           Anc_6.328 YCR060W
          Length = 128

 Score = 33.5 bits (75), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 30/55 (54%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           DY  A   Y + IK+ PTN + ++N+A +     N+  AV+  +E +K   + +K
Sbjct: 18  DYAQANGYYDQCIKLEPTNPIGYSNKAMSLIKQGNHGLAVETCQEGLKYTSSSTK 72

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 33.1 bits (74), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 32/63 (50%), Gaps = 2/63 (3%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIK--LDPAYSKGYSR 174
           Y  AV+ Y + I   P N V ++N+A A      Y  A++  +E ++  L P ++   S+
Sbjct: 24  YREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRYALGPEHAAIRSK 83

Query: 175 LAY 177
           L Y
Sbjct: 84  LQY 86

>KLLA0D09020g Chr4 (758818..760410) [1593 bp, 530 aa] {ON} similar
           to uniprot|P20424 Saccharomyces cerevisiae YPR088C SRP54
           Signal recognition particle (SRP) subunit (homolog of
           mammalian SRP54) contains the signal sequence- binding
           activity of SRP interacts with the SRP RNA and mediates
           binding of SRP to signal receptor contains GTPase domain
          Length = 530

 Score = 34.7 bits (78), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/23 (56%), Positives = 19/23 (82%)

Query: 279 MEKIQSMMQNPAIQQMAEQFKGG 301
           M+ I  MMQ+P++Q+MA+QF GG
Sbjct: 507 MQDIMGMMQDPSMQEMAKQFSGG 529

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 34.3 bits (77), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 5/70 (7%)

Query: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYA 178
           LAVE   ++I     N   +ANRAA     +NY   ++D  +A+ ++P   K Y R + A
Sbjct: 110 LAVECEDKSI-----NESLYANRAACELELKNYRRCIEDCSKALTINPKNVKCYYRTSKA 164

Query: 179 KYVQENFEES 188
            +     EE+
Sbjct: 165 FFQLNKLEEA 174

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 39/151 (25%), Positives = 62/151 (41%), Gaps = 31/151 (20%)

Query: 116 DYDLAVEKYTEAIKILPTNA----VYFANRAAAYTNSQNYDEAVKDAEEAIKLDPA---- 167
           DY  A+E+Y +++  LP +     + ++N  AA      Y   VK A++A+KL P     
Sbjct: 372 DYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKALKLFPKENLK 431

Query: 168 -----------------YSKGYSRLAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG 210
                            +SK   R A A    ENFE + + Y  ++E        V    
Sbjct: 432 WNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIE------NNVFSDK 485

Query: 211 YETAKKRVEESLNLEKSVPTESAGGQTNPAA 241
               K+R ++ LN E +  T+     + PAA
Sbjct: 486 IMDGKRRCQKVLNPEIAKKTQQKPSSSKPAA 516

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 44/94 (46%), Gaps = 4/94 (4%)

Query: 115 KDYDLAVEKYTEAIK----ILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSK 170
           K +  A E YT+ I+    +   N   +ANRAA     +N+   + D + A+  +P   K
Sbjct: 92  KRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCKTALTYNPKNIK 151

Query: 171 GYSRLAYAKYVQENFEESLEAYKKVLEIEGDSAT 204
            Y R+  A      FE + E+ +   +I+ D+ +
Sbjct: 152 CYFRMGKAFTAINKFESARESIEFGQKIDNDNKS 185

>ZYRO0D10186g Chr4 complement(856401..858308) [1908 bp, 635 aa] {ON}
           similar to uniprot|Q06677 Saccharomyces cerevisiae
           YDR320C SWA2 auxilin-like protein
          Length = 635

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 35/136 (25%), Positives = 61/136 (44%), Gaps = 31/136 (22%)

Query: 116 DYDLAVEKYTEAIKILPT----NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG 171
           DY  A+++Y ++   LP       + ++N  A+   +  Y E++  A  A+KL P  +  
Sbjct: 360 DYVAALQEYEKSANTLPHGHPLRIISYSNLMASQLKTGQYKESLHVASMALKLFPEDTTQ 419

Query: 172 YSRL------------AYAKYVQ---------ENFEESLEAYKKVLEIEGDSATEVTKRG 210
           +++L             + K VQ         ENF+E+  AY+ +  IE +  T     G
Sbjct: 420 WTQLIQNSEPSKTYRDMWPKIVQRRAEAFEHSENFQEAFNAYQSL--IEKNFCTNKIMDG 477

Query: 211 YETAKKRVEESLNLEK 226
               K+R ++ LN EK
Sbjct: 478 ----KRRCQKVLNPEK 489

>TBLA0B08680 Chr2 (2070444..2073188) [2745 bp, 914 aa] {ON} Anc_3.32
           YNL313C
          Length = 914

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 1/88 (1%)

Query: 119 LAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS-KGYSRLAY 177
           LA E ++  + +  TNA+ ++N +AAY N     EA      A + D   + + +     
Sbjct: 664 LAAEAFSRCVSLDDTNAMAWSNLSAAYVNQGKLKEAFSCLNRATRTDSQKNWRIWENYMI 723

Query: 178 AKYVQENFEESLEAYKKVLEIEGDSATE 205
             +    ++E L + KK+++I  D A E
Sbjct: 724 VAFKLREWDEVLLSCKKLIDINKDRAGE 751

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 9/92 (9%)

Query: 130 ILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESL 189
           +L  N   + N AA     +NY   +    EA+KL+    K + R+  A      FE+SL
Sbjct: 103 VLSINESLYLNLAACELEIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

Query: 190 EAYKKVLEIEGDS---------ATEVTKRGYE 212
           EA +  L ++ ++         ATE  KR  E
Sbjct: 163 EAVQVGLAVDPENGALKSIQSKATEKLKRKKE 194

>TBLA0A01690 Chr1 complement(404419..406407) [1989 bp, 662 aa] {ON}
           Anc_8.470 YDR244W
          Length = 662

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 40/88 (45%), Gaps = 3/88 (3%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           DYD  ++ +  A+ + P + + +    A+  NS   +EAV     A+ L P++ +    L
Sbjct: 508 DYDKTIDCFKTALTVNPNDELMWNRLGASLANSNRSEEAVAAYHRALTLKPSFVRARYNL 567

Query: 176 AYAKYVQENFEESLEAYKKVL---EIEG 200
           A +      F+E+ E     L   EI G
Sbjct: 568 AVSSINIGCFKEAAEHLLTALSMHEING 595

>ADR230W Chr4 (1103275..1105332) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR080W (DIA2)
          Length = 685

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 36/73 (49%), Gaps = 4/73 (5%)

Query: 132 PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE--NFEESL 189
           P   V   NRAA +      D A+ DA   I +D    KGY R    K +Q+   +EE+L
Sbjct: 67  PRFFVLLDNRAATFEKLNKLDRALADAAYMITVDAYNLKGYIR--RGKVLQKLGRYEEAL 124

Query: 190 EAYKKVLEIEGDS 202
           + Y+  L+  G++
Sbjct: 125 QVYENGLKQAGEA 137

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score = 34.3 bits (77), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 38/65 (58%), Gaps = 1/65 (1%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           SKD + A++ Y  A++ L  + V+++N +A Y      D+ ++ + +A++L P YSK   
Sbjct: 171 SKDNENAIKYYEYALR-LDQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALL 229

Query: 174 RLAYA 178
           R A A
Sbjct: 230 RRANA 234

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 33.9 bits (76), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 41/70 (58%), Gaps = 1/70 (1%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           A++ Y  A++    + V++AN +A Y +  ++++ +++  +A++L P YSK   R A   
Sbjct: 125 AIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTY 183

Query: 180 YVQENFEESL 189
              ENF +++
Sbjct: 184 ENMENFADAM 193

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score = 33.9 bits (76), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (52%), Gaps = 12/93 (12%)

Query: 114 SKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYS 173
           +K YD A++ Y  A++ L  + V+++N +A Y +  +  + V+ + +A++L P YSK   
Sbjct: 112 NKKYDDAIKYYNWALE-LKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLL 170

Query: 174 RLAYA-----KYVQENFEESLEAYKKVLEIEGD 201
           R A A     K+    F+ S      VL + GD
Sbjct: 171 RRASANEGLGKFADAMFDLS------VLSLNGD 197

 Score = 33.9 bits (76), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 124 YTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQE 183
           + +A+K+   N+  + +R       QNYD+A KD ++A +LDP     Y +LA   Y + 
Sbjct: 386 FDKALKLDSNNSSVYYHRGQMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYREN 445

Query: 184 NFEE 187
            F++
Sbjct: 446 KFDD 449

>CAGL0E01573g Chr5 complement(149084..151798) [2715 bp, 904 aa] {ON}
           similar to uniprot|P42842 Saccharomyces cerevisiae
           YNL313c
          Length = 904

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 45/89 (50%), Gaps = 1/89 (1%)

Query: 118 DLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS-KGYSRLA 176
           ++A E +T    + PT+A+ ++N +AAY       EA    ++AI  D   + + +    
Sbjct: 650 EIAAEAFTRCTALDPTHAMSWSNLSAAYVQQGKLKEAHSCLKQAISSDSQKNWRIWENFL 709

Query: 177 YAKYVQENFEESLEAYKKVLEIEGDSATE 205
                 + +E+ L A K+++EI+ D + E
Sbjct: 710 LVSVKLDEWEDVLAACKQLIEIKKDKSGE 738

>Kpol_1031.64 s1031 (161135..162958) [1824 bp, 607 aa] {ON}
           (161135..162958) [1824 nt, 608 aa]
          Length = 607

 Score = 33.5 bits (75), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 35/64 (54%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           ++ ++D  ++ +  A+K+ P + + +    A+  NS   +EA++   +A+ L P++ +  
Sbjct: 462 SNNEFDKTIDCFKAALKVSPNDELLWNRLGASLANSNRSEEAIQAYHKALNLKPSFVRAR 521

Query: 173 SRLA 176
             LA
Sbjct: 522 YNLA 525

>KLLA0E08009g Chr5 (720700..722865) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 33.5 bits (75), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 56/118 (47%), Gaps = 12/118 (10%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEA---VKDAEEAIKLDPAYSKGY 172
           D  LA E +  A  + PT+ +        Y   QNY +A   +K A +AIK   + SK +
Sbjct: 515 DLSLAEEYFMMAYDMCPTDPLLLNELGVIYFKRQNYIKAKKYMKRAHDAIKNMKSESKAW 574

Query: 173 SRLA------YAKYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETAK-KRVEESLN 223
             +       Y K  ++  E +++ +K VLE    +AT     G+   + K++E++++
Sbjct: 575 ISIVINLGHTYRKLGED--ERAIKCFKTVLESSKPTATLWCSLGFLYLRMKKIEKAID 630

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 37/82 (45%), Gaps = 4/82 (4%)

Query: 114 SKDYDLAVEKYTEAIKIL----PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYS 169
           +K Y  A E Y   I I       N   F+NRAA     +NY   V D + A++ +    
Sbjct: 91  AKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCKRALQYNVKNI 150

Query: 170 KGYSRLAYAKYVQENFEESLEA 191
           K Y R+A A  +    E++ +A
Sbjct: 151 KCYYRIAKAFLLLNKLEDAKQA 172

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 47/96 (48%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           KD++ A+E + +A KI P  A  +  +    +++ ++D A K   +AI  DP +   Y  
Sbjct: 565 KDHEDAIEAFEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYG 624

Query: 175 LAYAKYVQENFEESLEAYKKVLEIEGDSATEVTKRG 210
           +        +++E+L  ++K  +I   +A  +   G
Sbjct: 625 MGIYSMKLGHYDEALLYFEKARQIYPINAVLICCCG 660

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 30.8 bits (68), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 28/48 (58%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIK 163
           +Y  A++ Y + I+I P N + ++N+A A   +    EAV+  ++ +K
Sbjct: 18  NYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGLK 65

 Score = 29.3 bits (64), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 43/99 (43%), Gaps = 8/99 (8%)

Query: 137 YFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR----LAYAKYVQENFEESLEAY 192
           +F      Y    NY  A+K  E+ I+++P    GYS     L  A   QE      +  
Sbjct: 5   HFKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

Query: 193 KKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTE 231
           K+V   + D+  E  ++  E   +  E++LN  K VP E
Sbjct: 65  KRV--SKNDATHETIQKKLEYRLELAEKALN--KEVPKE 99

>KLTH0F18150g Chr6 (1462613..1464682) [2070 bp, 689 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 689

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/105 (24%), Positives = 49/105 (46%), Gaps = 22/105 (20%)

Query: 140 NRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQ---------ENFEESLE 190
           NRAA +    +  +A+KDA  A + +P   K Y R    K +Q         EN+EE ++
Sbjct: 76  NRAATWEKIGDLKKALKDANRATRFEPYNLKCYLR--RGKILQKLRMDGQALENYEEGVK 133

Query: 191 AYKKVLEIEGDSATEVTKRGYETAKKRVEESLNLEKSVPTESAGG 235
           A +           ++T++ +    K++ E+L  +K++ +    G
Sbjct: 134 AIR-----------DMTRKYHLDPPKKLYEALEYQKNLVSRRLKG 167

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 47/87 (54%), Gaps = 2/87 (2%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           +D++ A++ Y  A+  L  + V+++N +A Y +    ++ V+ + EA+KL   YSK   R
Sbjct: 119 QDFENALKYYNYAL-TLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLR 177

Query: 175 LAYAKYVQENFEESLEAYKKVLEIEGD 201
            A A     N+ +++     VL + GD
Sbjct: 178 RASAYESLANYVDAMVDL-SVLSLNGD 203

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 35/66 (53%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           +++ +  AI +  TNA  + +R   Y  +Q Y++A  D ++A +LD +    Y +LA   
Sbjct: 368 SIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDESNILPYIQLACLA 427

Query: 180 YVQENF 185
           Y +  F
Sbjct: 428 YKENKF 433

>ZYRO0E03300g Chr5 complement(259634..260827) [1194 bp, 397 aa] {ON}
           similar to uniprot|P47103 Saccharomyces cerevisiae
           YJR032W CPR7 Peptidyl-prolyl cis-trans isomerase
           (cyclophilin) catalyzes the cis-trans isomerization of
           peptide bonds N-terminal to proline residues binds to
           Hsp82p and contributes to chaperone activity
          Length = 397

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 6/100 (6%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           NA Y   ++  Y N    +E+V D    I      SK Y  L+   Y  +N++ES++   
Sbjct: 257 NAYYKYIKSLRYVNEFIPEESV-DKANRINFINLKSKLYLNLSLVLYYLQNYDESIKYAT 315

Query: 194 KVLEIE----GDSATEVTKRGYE-TAKKRVEESLNLEKSV 228
            +LE+E     D A  + +RG   +AK++ EE+L   KS 
Sbjct: 316 YLLEMENIPDADQAKALYRRGNSYSAKRKWEEALKDYKSC 355

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/90 (22%), Positives = 44/90 (48%), Gaps = 1/90 (1%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           N + + +    ++ ++++DEA+    +AI+LDP ++  Y+   +     + F+ +   ++
Sbjct: 491 NPIAWCSMGNLHSLNKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFR 550

Query: 194 KVLEIEGDSATEVTKRGYETAKK-RVEESL 222
           K L IE      +   G    K  + EE+L
Sbjct: 551 KALTIEKTHYNALYGLGMCCVKLGKFEEAL 580

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 41/84 (48%)

Query: 115 KDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           K++  A++ + +A ++ P  A  +  +   YT+S ++D A +   +AI  DP +   Y  
Sbjct: 542 KNHHEAIKAFEKATQVDPKFAYAYTLQGHEYTSSDSFDVAKRCYRKAIACDPGHYNAYYG 601

Query: 175 LAYAKYVQENFEESLEAYKKVLEI 198
           L         +EE+L  ++K   I
Sbjct: 602 LGMVSMKLGQYEEALLFFEKARSI 625

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 26/47 (55%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAI 162
           DY+ A+  Y +A  +  +N +YF+N A A    + + EAV   ++ +
Sbjct: 56  DYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>SAKL0G18348g Chr7 (1582267..1585422) [3156 bp, 1051 aa] {ON}
           similar to uniprot|P46970 Saccharomyces cerevisiae
           YJR132W NMD5 Karyopherin a carrier protein involved in
           nuclear import of proteins importin beta homolog
          Length = 1051

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 17/76 (22%)

Query: 25  VSADDIDSLNVAIDCLTEVFGV-------EKDTLSATIESKFNGKSLTELLDAAS----Q 73
           +S++DI+S ++ + CL+EVF         ++  L   I   F       LL+ AS    Q
Sbjct: 143 LSSNDINSAHIGLLCLSEVFRTYRWKENDDRQDLEVLIVQYFPA-----LLEFASSNLLQ 197

Query: 74  NAGNTDECKT-ETVKI 88
           N GNTD+ K  E +K+
Sbjct: 198 NGGNTDDPKVGEMIKL 213

>SAKL0E14542g Chr5 (1199439..1201511) [2073 bp, 690 aa] {ON} weakly
           similar to uniprot|Q7LGN4 Saccharomyces cerevisiae
           YOR080W DIA2 Protein of unknown function involved in
           invasive and pseudohyphal growth
          Length = 690

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 22/35 (62%)

Query: 140 NRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR 174
           NRAA++      D+A+KDA+  I+++P   K Y R
Sbjct: 76  NRAASWEKLGKLDKALKDAKNMIRVEPHNLKCYIR 110

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 21/106 (19%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           ++E +  +I++  ++   +     AY N    + ++K  ++ ++LD  +   +  LA A 
Sbjct: 688 SIEWFQSSIRVSSSDVESWVGLGQAYLNCGRVEASIKVFKKVLELDENHHFAWYFLAIAL 747

Query: 180 YVQENFEESLEAYKKVLEIEG--------------DSATEVTKRGY 211
                F+ S+E +++++  +               D ATE+  RGY
Sbjct: 748 SALGEFDRSIEIFERLVNTDDSEECFMVSEISTLIDYATELYSRGY 793

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 13/52 (25%), Positives = 31/52 (59%)

Query: 145 YTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKKVL 196
           ++ ++++DEA+K  ++A +LDP ++  Y+   +     + F+ +   Y+K L
Sbjct: 424 FSLNKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKAL 475

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 17/62 (27%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 117 YDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKG-YSRL 175
           Y +A E Y + + I P N + ++N+A A      Y E V+   + +   P  +   Y +L
Sbjct: 19  YKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTFTPNTTDTVYKKL 78

Query: 176 AY 177
            Y
Sbjct: 79  NY 80

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 30.0 bits (66), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 26/49 (53%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKL 164
           DY+ AV  Y +AI   P+N + ++N A      + + EAV    + +K+
Sbjct: 19  DYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGLKM 67

>TPHA0L01210 Chr12 (252106..253872) [1767 bp, 588 aa] {ON} Anc_8.470
           YDR244W
          Length = 588

 Score = 31.6 bits (70), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 14/64 (21%), Positives = 35/64 (54%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           ++ ++D  ++ +  A+ I P + + +    A+  NS   +EA++   +A++L P++ +  
Sbjct: 443 SNNEFDKTIDCFKTALVIHPEDELMWNRLGASLANSSRPEEAIQAYHKALQLKPSFVRAR 502

Query: 173 SRLA 176
             LA
Sbjct: 503 YNLA 506

>Smik_4.774 Chr4 complement(1365084..1366838) [1755 bp, 584 aa] {ON}
           YDR497C (REAL)
          Length = 584

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 5/38 (13%)

Query: 201 DSATEVTKRGY-----ETAKKRVEESLNLEKSVPTESA 233
           + ATEV KR Y     E  K++VEE + L +S+P +S 
Sbjct: 280 EKATEVLKRSYTDTSEEIIKRKVEELVTLNQSIPGKSV 317

>CAGL0H07095g Chr8 (700262..702247) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q06677 Saccharomyces cerevisiae YDR320c SWA2
          Length = 661

 Score = 31.6 bits (70), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 31/55 (56%), Gaps = 4/55 (7%)

Query: 116 DYDLAVEKYTEAIKILPTNA----VYFANRAAAYTNSQNYDEAVKDAEEAIKLDP 166
           DY  AVE+Y +++  LP       + ++N  A+      + ++V DA+EA+KL P
Sbjct: 377 DYASAVEEYEKSLNTLPMKHPLRIIAYSNIIASRIKIGQHSQSVVDAQEAMKLLP 431

>TDEL0B01660 Chr2 complement(295823..297472) [1650 bp, 549 aa] {ON}
           Anc_8.470 YDR244W
          Length = 549

 Score = 31.2 bits (69), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/93 (22%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A  ++D  ++ +  A+ + P + + +    A+  NS   +EA++   +A++L P++ +  
Sbjct: 408 ADSEFDKTIDCFKAALSVNPNDELMWNRLGASLANSNRSEEAIQAYYKALQLKPSFVRAR 467

Query: 173 SRLAYAKYVQENFEESLE---AYKKVLEIEGDS 202
             LA +      ++E+ E   +  K+ E+EG S
Sbjct: 468 YNLAVSSINIGCYKEAAEYLLSALKMHEVEGVS 500

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 31.2 bits (69), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 34/64 (53%)

Query: 135 AVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           A+ +      ++ ++++DEA+K  ++A  LDP ++  Y+   +     + F+ +   Y+K
Sbjct: 457 AITWCCLGNLFSLNRDHDEAIKALKKATNLDPRFAYAYTLQGHEYSNNDAFDNAKMCYRK 516

Query: 195 VLEI 198
            L I
Sbjct: 517 ALAI 520

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 30.8 bits (68), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 45/89 (50%)

Query: 116 DYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRL 175
           +Y+ A+  + +A  I P+NA+             N ++A+   E A ++ P  S    + 
Sbjct: 673 EYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSLAKFKR 732

Query: 176 AYAKYVQENFEESLEAYKKVLEIEGDSAT 204
           A+  Y    + ++L+A++++++I  + AT
Sbjct: 733 AHLLYSMAKYTQALDAFEELIKIAPEEAT 761

>Kpol_1043.60 s1043 (123502..125622) [2121 bp, 706 aa] {ON}
           (123502..125622) [2121 nt, 707 aa]
          Length = 706

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 40/98 (40%), Gaps = 11/98 (11%)

Query: 132 PTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEA 191
           P     + N +A Y   Q  D+A + +   I ++P   KGY R+      Q    E+ + 
Sbjct: 68  PKLVKLYDNLSATYEKLQELDKAYESSSRMIHIEPYNMKGYIRMGKVLQRQGKDPEAYKC 127

Query: 192 YKKVLEIEG-----------DSATEVTKRGYETAKKRV 218
           YKK L +             +   ++ K+  +  KKR+
Sbjct: 128 YKKGLLMSREMLQKFDIVVPEKFRDIIKQQRDIVKKRI 165

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 30.8 bits (68), Expect = 7.0,   Method: Composition-based stats.
 Identities = 19/77 (24%), Positives = 38/77 (49%)

Query: 120 AVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAK 179
           ++E +  A++I  ++   +     AY      + ++K  E A++L P +      LA + 
Sbjct: 679 SIEWFQSALRIDSSDVEAWIGLGQAYAACGRIEASIKVFERALELSPEHKYAGLFLAISL 738

Query: 180 YVQENFEESLEAYKKVL 196
                FE+SLEA +K++
Sbjct: 739 CQLSEFEKSLEALRKLV 755

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/65 (21%), Positives = 34/65 (52%)

Query: 134 NAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYK 193
           N + +      ++ ++++DEA+K  ++A  L+P ++  Y+   +     + F+ +   Y+
Sbjct: 437 NCITWCCLGNLFSLNRDHDEAIKALKKATSLNPQFAYAYTLQGHEYSNNDAFDNAKMCYR 496

Query: 194 KVLEI 198
           K L I
Sbjct: 497 KALAI 501

>KLLA0C15455g Chr3 (1341570..1343270) [1701 bp, 566 aa] {ON} similar
           to uniprot|P35056 Saccharomyces cerevisiae YDR244W PEX5
           Essential for import of proteins with SKL- like import
           signal into peroxisomal matrix 69-kDa protein containing
           tetratricopeptide repeat (TPR)
          Length = 566

 Score = 30.0 bits (66), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 20/118 (16%), Positives = 53/118 (44%), Gaps = 13/118 (11%)

Query: 113 ASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGY 172
           A++++   ++ +  A+++ P + + +    A+  NS   +EA++   +A+ L P++ +  
Sbjct: 428 ANEEFGKTIDCFRTALEVNPNDELMWNRLGASLANSNRSEEAIQAYHKALALKPSFVRAR 487

Query: 173 SRLAYAKYVQENFEESLEAYKKVLE-------------IEGDSATEVTKRGYETAKKR 217
             LA +      ++E+ E+    L              ++ ++  E  KR +    +R
Sbjct: 488 YNLAISSMNIGCYKEAAESLLSALSMHEVENVPITGSVVQSNNILETLKRSFVAMDRR 545

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 18/71 (25%), Positives = 35/71 (49%)

Query: 126 EAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENF 185
           E I   P  A  +      ++  +++DEA+K   +A +LDP ++  Y+   +     E+F
Sbjct: 485 ELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTLQGHEYASNESF 544

Query: 186 EESLEAYKKVL 196
           + +   Y+K L
Sbjct: 545 DTARTFYRKAL 555

>ACR258W Chr3 (809748..821999) [12252 bp, 4083 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR054C (DYN1)
          Length = 4083

 Score = 30.4 bits (67), Expect = 9.1,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 9/77 (11%)

Query: 159  EEAIKLDPAYSKGYSRLAYA----KYVQENFEESLEAYKKVLEIEGDSATEVTKRGYETA 214
            EE +K++    +  +RL  A    K +Q + E S  +Y K++        E+TK   E+ 
Sbjct: 3225 EEMVKVENEMLQNKARLMAAGEMIKELQTSIESSKVSYSKLIR-----EVEITKTEMESV 3279

Query: 215  KKRVEESLNLEKSVPTE 231
            + +VE S+ L +S+  E
Sbjct: 3280 QSKVERSIKLMESLTGE 3296

>KAFR0G00690 Chr7 (171473..183784) [12312 bp, 4103 aa] {ON} Anc_1.216
            YKR054C
          Length = 4103

 Score = 30.4 bits (67), Expect = 9.6,   Method: Composition-based stats.
 Identities = 25/77 (32%), Positives = 37/77 (48%), Gaps = 9/77 (11%)

Query: 159  EEAIKLDPAYSKGYSRLAYAKY----VQENFEESLEAYKKVLEIEGDSATEVTKRGYETA 214
            +EA KLD A  +  +RL  A+     +Q+N EES   Y  ++        EV K   E  
Sbjct: 3224 QEAAKLDDARLRAKARLMAAEEMVIDLQKNIEESKTNYSSLIR-----DVEVIKTQMERV 3278

Query: 215  KKRVEESLNLEKSVPTE 231
            +  +E S  L +S+ TE
Sbjct: 3279 EVSLERSTKLVQSLMTE 3295

>Kwal_23.5408 s23 (1146253..1150485) [4233 bp, 1410 aa] {ON} YPR189W
            (SKI3) - Contains 8 copies of the TPR domain [contig 8]
            FULL
          Length = 1410

 Score = 30.0 bits (66), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 37/73 (50%), Gaps = 9/73 (12%)

Query: 139  ANRAAAYTNSQNYDEAVKDAEEAIKLDPAYSKGYSR---------LAYAKYVQENFEESL 189
            A  A  Y   +NY+ A+++A+ ++ +   +    ++         +  A Y  ++F+ +L
Sbjct: 1165 AQLARVYLGMKNYEAAIENADLSLGILSEHDNEIAKKNVISNHVVMGLAFYFLDDFDSTL 1224

Query: 190  EAYKKVLEIEGDS 202
            E +K +LE  GDS
Sbjct: 1225 EHFKTILEYPGDS 1237

>NDAI0E04040 Chr5 (900685..903036) [2352 bp, 783 aa] {ON} Anc_7.412
           YBL084C
          Length = 783

 Score = 30.0 bits (66), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/50 (26%), Positives = 30/50 (60%)

Query: 145 YTNSQNYDEAVKDAEEAIKLDPAYSKGYSRLAYAKYVQENFEESLEAYKK 194
           ++  +++ EA+K  E+  KLDP ++ GY+  A+     ++F+ +   ++K
Sbjct: 575 FSLQKDHKEAIKAFEKVTKLDPTFTYGYTLQAHEYLSDDSFDLAKNYFRK 624

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.307    0.124    0.331 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 31,030,857
Number of extensions: 1164313
Number of successful extensions: 5062
Number of sequences better than 10.0: 219
Number of HSP's gapped: 4980
Number of HSP's successfully gapped: 343
Length of query: 339
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 229
Effective length of database: 40,868,139
Effective search space: 9358803831
Effective search space used: 9358803831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 66 (30.0 bits)