Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011606.20ON1131113156960.0
Suva_13.1606.20ON1090109914391e-180
Smik_13.1576.20ON1090110414061e-175
Skud_13.1526.20ON1090111713811e-171
ZYRO0C07810g6.20ON1099111313661e-169
TDEL0G044906.20ON1093112912801e-157
Sklu_YGOB_Anc_6.20b6.20ON1088111512191e-148
CAGL0L07634g6.20ON1130113211781e-142
Kwal_56.224246.20ON1089113011431e-137
ACR006C6.20ON1071111810911e-130
Sklu_YGOB_Anc_6.20singletonOFF84977510581e-127
Kpol_1037.256.20ON1105103610471e-123
KLTH0C11242g6.20ON109772610431e-123
NCAS0H008206.20ON1146115010291e-120
Ecym_30246.20ON10797209791e-114
YML002W6.20ON7377159041e-106
TPHA0J003306.20ON11077239061e-103
NDAI0D008006.20ON119311008881e-100
KLLA0D01133g6.20ON10677268584e-97
TBLA0A072606.20ON12047777242e-78
KAFR0L004006.20ON9429096002e-63
YML003WsingletonOFF2902873589e-37
ACR224C8.28ON129567781.9
CAGL0J00275g5.289ON30391752.6
NCAS0A026104.274ON104568754.4
TDEL0B004508.876ON44462736.0
CAGL0K01749g3.175ON124983729.4
KLTH0E12452g8.537ON51564719.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01160
         (1131 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6...  2198   0.0  
Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML00...   558   e-180
Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML00...   546   e-175
Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML00...   536   e-171
ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] ...   530   e-169
TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {...   497   e-157
Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1...   474   e-148
CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa]...   458   e-142
Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML00...   444   e-137
ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON} ...   424   e-130
Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF} A...   412   e-127
Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON} (56141...   407   e-123
KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa] ...   406   e-123
NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6....   400   e-120
Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to...   381   e-114
YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative p...   352   e-106
TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.2...   353   e-103
NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6....   346   e-100
KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some ...   335   4e-97
TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON} Anc_...   283   2e-78
KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20...   235   2e-63
YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative p...   142   9e-37
ACR224C Chr3 complement(744590..748477) [3888 bp, 1295 aa] {ON} ...    35   1.9  
CAGL0J00275g Chr10 complement(19390..20301) [912 bp, 303 aa] {ON...    33   2.6  
NCAS0A02610 Chr1 (496591..499728) [3138 bp, 1045 aa] {ON} Anc_4....    33   4.4  
TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876...    33   6.0  
CAGL0K01749g Chr11 complement(155385..159134) [3750 bp, 1249 aa]...    32   9.4  
KLTH0E12452g Chr5 complement(1102014..1103561) [1548 bp, 515 aa]...    32   9.6  

>KNAG0M01160 Chr13 (207940..211335) [3396 bp, 1131 aa] {ON} Anc_6.20
            YML002W
          Length = 1131

 Score = 2198 bits (5696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1072/1131 (94%), Positives = 1072/1131 (94%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL
Sbjct: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG
Sbjct: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
            FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT
Sbjct: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180

Query: 181  PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRKTI 240
            PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRKTI
Sbjct: 181  PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRKTI 240

Query: 241  DKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRFI 300
            DKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRFI
Sbjct: 241  DKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRFI 300

Query: 301  SLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILS 360
            SLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILS
Sbjct: 301  SLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILS 360

Query: 361  KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAI 420
            KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAI
Sbjct: 361  KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAI 420

Query: 421  STLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFRYR 480
            STLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFRYR
Sbjct: 421  STLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFRYR 480

Query: 481  NGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEI 540
            NGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEI
Sbjct: 481  NGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEI 540

Query: 541  TEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQT 600
            TEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQT
Sbjct: 541  TEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQT 600

Query: 601  PLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISF 660
            PLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISF
Sbjct: 601  PLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISF 660

Query: 661  LLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQYPNTKSAPI 720
            LLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQYPNTKSAPI
Sbjct: 661  LLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQYPNTKSAPI 720

Query: 721  LSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEAFEXXXXXXXXXX 780
            LSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEAFE          
Sbjct: 721  LSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEAFELKNLKALFRL 780

Query: 781  XXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSSFCSKVLKKLTYCLDSMVEMELLPTA 840
               QHPFTFFP            KTASSRSLMKSSFCSKVLKKLTYCLDSMVEMELLPTA
Sbjct: 781  LLKQHPFTFFPLEELLDELSVVEKTASSRSLMKSSFCSKVLKKLTYCLDSMVEMELLPTA 840

Query: 841  ALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTII 900
            ALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTII
Sbjct: 841  ALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTII 900

Query: 901  ELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVF 960
            ELR                 NIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVF
Sbjct: 901  ELRKFSILSKLKSKDISESKNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVF 960

Query: 961  QIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNN 1020
            QIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNN
Sbjct: 961  QIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNN 1020

Query: 1021 VGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYC 1080
            VGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYC
Sbjct: 1021 VGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYC 1080

Query: 1081 IFINFQSKFIHSAMLEKWVXXXXXXXXXXXXXXXXXRIRKEAVRSKASDNS 1131
            IFINFQSKFIHSAMLEKWV                 RIRKEAVRSKASDNS
Sbjct: 1081 IFINFQSKFIHSAMLEKWVKLNINLLKKSLLDSKEKRIRKEAVRSKASDNS 1131

>Suva_13.160 Chr13 (253437..256709) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  558 bits (1439), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 385/1099 (35%), Positives = 578/1099 (52%), Gaps = 87/1099 (7%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP+  L  Y D  TK PLHEL
Sbjct: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFANLQTRRFILLAPPSHLLLNYHDVKTKLPLHEL 65

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++ +F++SHIL      +N  I+T L      R+  + T +GK +   +    ++T +G
Sbjct: 66   CYNADFINSHILL---TTENSYINTTL------RDDHYETLDGKTVVVQWKNNVIHTLNG 116

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
            F  R   +IL  + L +F +Y +G+  F ++YIDQPL      +  + L CF N    T+
Sbjct: 117  FPLRRRLKILDTKILPNFNDYFKGAEYFAILYIDQPL--GCEFVPNDYLHCF-NSYEETS 173

Query: 181  PSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQ---SESMLIPGF 236
             + R+  NL       +R+   N + IH  +  +   +F NYR+       S+ M    F
Sbjct: 174  KTARNAPNLLMDTSQLERSSFENILHIHPAWLTQLGQLFSNYRRAALNDDPSKKM----F 229

Query: 237  RKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESS 294
             + +++ +DG+  D+ F     +  LI +Y E N+Y+D+W  L          E  +E+ 
Sbjct: 230  EELVEQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYEDIWSRLTIHFKG---YEVNTENC 286

Query: 295  DIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVE 354
            + F   S++QL TD+Y   F  F L DI  +E+ +S A+K F+ L+++H+Y EK ++LVE
Sbjct: 287  EYF---SVNQLLTDYYSKDFESFKLSDITFIERRVSVASKHFQKLALSHSYAEKSKILVE 343

Query: 355  TLQILS--------KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQ 406
            TLQ LS        KP    G   + + ADTL+SLF+L++ R++ K+IR HLYYLQNF  
Sbjct: 344  TLQHLSGTTDMGSHKPDLSNGFNNLTMDADTLISLFVLVVCRSEQKHIRSHLYYLQNFSN 403

Query: 407  DENSIKFGLLGYAISTLEAVICYLETIETDKER-----LDCIEKNDANLEEFLTLLTRSK 461
            + +S KFG+LGYAISTLEAV+CY E    +        L CI+  D        LL +  
Sbjct: 404  NSSSSKFGILGYAISTLEAVVCYFENFNKNNNNVAKANLLCIKTRD--------LLDKLS 455

Query: 462  C--VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLE 519
            C   +NE  DL+ Y     YRN  G S LSLCI N KNDI  ++LSE YE+ F  ED+LE
Sbjct: 456  CENPTNEVNDLATYKDILAYRNEQGQSILSLCITNNKNDILLDVLSE-YEALFPIEDILE 514

Query: 520  DQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQ 579
            D+T +G+TLL++S++  N E T+ L  IML N T+EEL  Y  K DKY R++ HY+  + 
Sbjct: 515  DETIDGSTLLIESIKVGNLEATKILIRIMLFNCTDEELVTYVNKTDKYARSVAHYLTHEM 574

Query: 580  TLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCF 639
             +L+ IG YI W  K+ +GQTPL  IFRSYDQ  Y+ MV+ +F IA  WY    N+ F +
Sbjct: 575  DILKSIGSYINWKQKNSSGQTPLFSIFRSYDQPNYEEMVKVAFNIASSWYQR-HNTSFGY 633

Query: 640  RDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699
             DHTD+KGN+LLH++K ++S LLQ   ++IN  N +GL+PL     Y R  N++A+ KD 
Sbjct: 634  SDHTDNKGNSLLHVLKTDVSILLQLTKLNINGENYKGLTPLMVYVKYKRLSNIDAITKDH 693

Query: 700  RLIFSSFD---FLKQYPNTKSAPILSHYC--LDNEAPFRNIIASHFDFRISNKRSVV-LT 753
            RLI        F   +   K   +LS       N++ F  +I  H   R  N  + V +T
Sbjct: 694  RLILEKVQNSTFFTCFDYAKDRLVLSKIGERGANDSIF-GLIYLH-SLRYHNLNATVNVT 751

Query: 754  SRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMK 813
            S SK   +E   +                  +PFTF P            +  S  +++ 
Sbjct: 752  SVSK--TEEPFVTAVINMKTIQGLLRSIVKDNPFTFLPIDNYIDGISHLNR--SDLTIIG 807

Query: 814  SSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD--K 871
             +    +L KLT C + ++ ++ +P       A +   +   ++       K  SKD  K
Sbjct: 808  KADVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASV---LYWMRINTSRRNQKPPSKDNPK 864

Query: 872  KMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVS 931
             M+PE I  I +FL++  + +L  K ++  LR                   +  +G +V+
Sbjct: 865  TMEPEEINMIQSFLRFNFDEILSFKASLNILRKILIFLSLKSSDFEDAYASLLKMGTKVT 924

Query: 932  SKKIGRAMVRYSTI--DNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWK 989
            +   G+A   ++TI  ++K   + S D L+  + F E C   + NSI  +L  +IP WWK
Sbjct: 925  N---GKAADAFTTIIKNHKMFSDLSLDELLEHVQFLEECTIQLFNSIQTILFDRIPNWWK 981

Query: 990  CYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQER 1049
             YG+ L L K         +  K  P+A   V   +T  TS    LG FIE KR ++++R
Sbjct: 982  HYGEFLTLHK---------NYRKAFPSA---VKPKSTAGTSSHIPLGGFIETKREQSEQR 1029

Query: 1050 TRAAISDLQRRLKLLDNEI 1068
                I    + LK L +EI
Sbjct: 1030 LSVQIKASSKILKELGSEI 1048

>Smik_13.157 Chr13 (254644..257916) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  546 bits (1406), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 374/1104 (33%), Positives = 577/1104 (52%), Gaps = 97/1104 (8%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP+  L  Y D  TK PLHEL
Sbjct: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFATLKTCRFILLAPPSEYLLNYHDVKTKLPLHEL 65

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++ EF++SHIL      +N  I+T+       R++ + T +GK +   +    ++  +G
Sbjct: 66   CYNAEFINSHILLM---TENSFINTN------SRDSHYETLDGKTVVIQWKNNVIHALNG 116

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCED-----LDCFPNL 175
            F  R   +IL  + L +F +Y +G++ F++IYI+QPL        CE      L CF + 
Sbjct: 117  FQVRRRLKILGTKILPNFNDYFEGATDFVIIYIEQPL-------SCESVPNDYLQCFHSY 169

Query: 176  TINTTPSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQSESMLIP 234
                  S  S+ NLS      +R+   N + IH     +   +F NYR  +  S+     
Sbjct: 170  K-KIPKSVYSVHNLSLDSSQQERSSFENILHIHPTRLTQLGEMFSNYRT-LAPSDDPSEK 227

Query: 235  GFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLIN--RNNAEGEKEKQ 290
             F   + + ++G+  D+ F   P +  LI EY E N+YDD+W  L +  ++   G +E  
Sbjct: 228  IFECIVQQAFEGMKSDSLFKKFPNLYDLIHEYFELNLYDDIWSRLTSHFKSYEVGTEE-- 285

Query: 291  SESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCR 350
                  +++ S++ L  DFY   F +F L+D+  +EK +  A+K F+ L++TH+Y EK +
Sbjct: 286  ------YKYFSINHLLADFYSKDFREFKLQDVTFIEKRVHLASKHFQKLTLTHSYTEKSK 339

Query: 351  VLVETLQILSKPVKRVGGYQ--VP-------ITADTLVSLFILLIKRTKMKNIRCHLYYL 401
            +LVETLQ LS     +G +Q  VP       + ADTL+SLF+L+I R++ K+++ HLYYL
Sbjct: 340  ILVETLQELSGTTD-MGSHQLDVPGRLNNLAMDADTLISLFVLVICRSEQKHLKSHLYYL 398

Query: 402  QNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSK 461
            QNF  + +S KFG+LGYA+STLEAV+CY E     K+  D + K +  L++   L+    
Sbjct: 399  QNFSNNSSSSKFGILGYAVSTLEAVVCYFEDF---KKNSDNMAKANVLLQKTKRLVNMLS 455

Query: 462  C--VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLE 519
            C  V+N+  +L+ Y     YRNG G S LS+CI N KN I  ++LSE Y+S F  EDLLE
Sbjct: 456  CENVTNKVENLATYKDILPYRNGQGQSILSICISNNKNHILLDILSE-YDSIFPLEDLLE 514

Query: 520  DQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQ 579
            D+T +G+TLL++S++  N E  + L  IM+ N TEEEL  Y  + DKY R + HY+  + 
Sbjct: 515  DETIDGSTLLIESIKSGNLEAAKILIRIMMLNCTEEELISYINRTDKYSRTVAHYLTHEI 574

Query: 580  TLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCF 639
             +L+ IG Y+ W  K+  GQTPL  IFRSYDQ  Y+ MV+ +F IA  WY   +N  F +
Sbjct: 575  DILKSIGNYVDWKRKNSGGQTPLFSIFRSYDQPNYEAMVKIAFNIANTWYRK-QNRSFDY 633

Query: 640  RDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699
            RDHTD+KGN LLH++K + S LLQ   +DIN  N +GL+PL     Y R  N+EA++KD 
Sbjct: 634  RDHTDNKGNDLLHVLKTDASILLQLTKLDINGENYKGLTPLMVYVKYKRLNNIEAIIKDQ 693

Query: 700  RLI---------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSV 750
            RL+         F+ FD+ K +  T  + +      D+      +I  H   R  N  + 
Sbjct: 694  RLVLEKIQKSTFFTCFDYAKDH--TVLSKVGERGAKDS---LFGLIYFH-SLRYHNLNAA 747

Query: 751  VLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRS 810
            V  + +  D ++   +                  +PFTF P            +  S  +
Sbjct: 748  VNITFA-SDTEKPFSNTVINMKTIQGLLRSILKDNPFTFLPLNIYIDEISQLSR--SDVT 804

Query: 811  LMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD 870
            ++  +    +L KL+ C + ++ ++ +P +     A +   +   ++   +   K+ SK+
Sbjct: 805  IIGKADVMSLLHKLSNCFNVLLFLKKVPKSLFTDEASI---LYWMRINTSKRNQKQPSKE 861

Query: 871  --KKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGA 928
              K M+PE I  I +FL++  + +   K ++  LR                 + +  +G 
Sbjct: 862  NYKTMEPEEINMIQSFLRFNFDEISSFKASLSILRKILIFISLKSNDFKDVNDNLNEMGK 921

Query: 929  EVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWW 988
             + + K   A     T  N F  + S   L+  + F E C   + N +  +L  KIP WW
Sbjct: 922  SIYNAKAADAFAGNLTNHNMF-NDYSLAKLLEHVRFLEECTIQLSNLVQLILLEKIPNWW 980

Query: 989  KCYGQLLELSKED----PSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRI 1044
            K YG+L+ L K      PSV+  +               STTD TSG   LG FIE KR 
Sbjct: 981  KHYGELITLHKNYRKAFPSVVKPK---------------STTD-TSGHIQLGGFIETKRE 1024

Query: 1045 KNQERTRAAISDLQRRLKLLDNEI 1068
            ++++R    I    + LK L +EI
Sbjct: 1025 QSEQRLAVQIKVSSKSLKELGSEI 1048

>Skud_13.152 Chr13 (249372..252644) [3273 bp, 1090 aa] {ON} YML002W
            (REAL)
          Length = 1090

 Score =  536 bits (1381), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 366/1117 (32%), Positives = 579/1117 (51%), Gaps = 87/1117 (7%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPL++A+FNC + E SPL+K++++L    FILL PP   L  Y D  TK PLHEL
Sbjct: 6    LPTLLNPLINAIFNCPEPEKSPLKKLFANLKTRRFILLAPPLRFLLNYHDVKTKLPLHEL 65

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++ +F++SHIL      +N  ++T L      R++ + T +GK +   +    ++  +G
Sbjct: 66   CYNVDFINSHILL---TTENSYLNTTL------RDSHYETLDGKAVVIQWKNNIIHALNG 116

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPL---IDTNRLLKCEDLDCFPNLTI 177
            F  R   +IL+ + L +F +Y +G++ F +++IDQPL   +  N  LKC   D +  +  
Sbjct: 117  FPIRQRLKILETKVLPNFNDYFEGAADFAILFIDQPLNCEVAPNDYLKC--FDSYEEVPK 174

Query: 178  NTTPSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQSESMLIPGF 236
            N     +S++NL       +R+   N + IH+    +   +F NYR+ +  ++      F
Sbjct: 175  NA----QSVSNLPVNSYEQERSSFDNILHIHSARLAQLGQLFSNYRR-LAPNDDPSKKMF 229

Query: 237  RKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINR-NNAEGEKEKQSES 293
               + + +DG+  D+ F     +  LI +Y E N+YDD+W  L+      E + EK    
Sbjct: 230  EDIVQQSFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRLVTHFKGYEVDTEK---- 285

Query: 294  SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353
               +++ S++QL  DF+   F +F L DI  +E+ ++ A+K F+ L++TH+Y EK ++LV
Sbjct: 286  ---YKYFSVNQLLADFFSKDFKEFKLSDITFIERRVNVASKHFQKLTLTHSYAEKSKILV 342

Query: 354  ETLQILSKPVKRVGGYQ--------VPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFH 405
            ETLQ LS P +     Q        + + ADTL+SLF+L++ R++ K+++ HLYYLQNF 
Sbjct: 343  ETLQQLSGPTEISSHQQELPNGLNSLTMDADTLLSLFVLVVCRSEQKHLKSHLYYLQNFS 402

Query: 406  QDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSN 465
             + +S KFG+LGYAISTLEAV+CY E  + + E L     +     E L  L+ S+  +N
Sbjct: 403  NNPSSTKFGILGYAISTLEAVVCYFEDFDKNNENLAKANVSYQKTRELLDKLS-SENPTN 461

Query: 466  EGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEG 525
            E  +L+ Y  N +YRN  G S LS+CI N KN I  ++L+E YE  F  ED+LED+T +G
Sbjct: 462  EIENLATYEDNLQYRNEQGQSILSICITNTKNCILLDVLTE-YEDLFPMEDILEDETLDG 520

Query: 526  TTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKI 585
            +TLL++S++  N E  + L  IML N +E EL  Y  K DKY R + HY+  +  +L+ I
Sbjct: 521  STLLIESIKTGNIEAAKILIGIMLLNCSEGELVSYVNKADKYARTVAHYLTHEMDILKSI 580

Query: 586  GKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDS 645
            G Y+ W  K+ +GQTPL  IFR+YDQ  Y+ MV+ +F IA  WY    NS F + DHTDS
Sbjct: 581  GSYVDWKRKNSSGQTPLFSIFRTYDQPNYEEMVKIAFNIANSWYQK-HNSSFDYLDHTDS 639

Query: 646  KGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI--- 702
            KGN+LLHI+K ++S LLQ   +DIN  N +GL+PL     Y R  N++A+ KD RLI   
Sbjct: 640  KGNSLLHILKSDVSILLQLSKLDINGRNYKGLTPLMIYVKYKRISNIDAITKDSRLILEK 699

Query: 703  ------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVV-LTSR 755
                  F+ FD+ K +  +  + I      D+      ++  H   R  N  +   +T+ 
Sbjct: 700  VQNSTFFTCFDYAKDH--SVLSKIGERGARDS---LFGLVYLH-SLRYHNLNATTNITTA 753

Query: 756  SKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSS 815
            S  D   L  +                  + FTF P            +  S  +++  +
Sbjct: 754  SNTDKPFL--TTVINMKTIQGLLRSILKDNQFTFLPLNSYIDEISHLNR--SDLTIIGKA 809

Query: 816  FCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKD--KKM 873
                +L KLT C + ++ ++ +P       A +   +   ++   +   K  SKD  K M
Sbjct: 810  DVRSLLHKLTNCFNVLLFLKKVPQNLFTDEASV---LYWMRINTSKRNQKPPSKDNPKTM 866

Query: 874  QPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSK 933
            +PE I  I +FL++  + +   K ++  LR                 + +  +G ++ + 
Sbjct: 867  EPEEINMIQSFLRFNFDEISSFKASLNILRKILIFLSLKSNDFEDTYDSLREMGRKIING 926

Query: 934  KIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQ 993
            +   A  R  T  N F  + +   L+  + F E C   +   +  +L  KI +WWK YG+
Sbjct: 927  EAADAFARIFTNHNMF-SDLALAELLEHVSFLEQCTIQLSTFVQTILFDKITKWWKHYGE 985

Query: 994  LLELSKED----PSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQER 1049
             L L K      PSV+  +S             T T  H      LG+FIE KR ++++R
Sbjct: 986  FLALQKNYRKAFPSVVKPKS------------ATDTPSHIP----LGSFIETKREQSEQR 1029

Query: 1050 TRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQ 1086
                I    + LK L +EI T +  +  E   ++ F+
Sbjct: 1030 LAVQIKASSKILKELGSEIFTAHEKLAEELSNYMEFR 1066

>ZYRO0C07810g Chr3 complement(591035..594334) [3300 bp, 1099 aa] {ON}
            similar to uniprot|Q04257 Saccharomyces cerevisiae
            YML003W/YML002W Hypothetical ORF
          Length = 1099

 Score =  530 bits (1366), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 354/1113 (31%), Positives = 572/1113 (51%), Gaps = 61/1113 (5%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPLV++VFNC +   S  +K++  L    FILLVPPT  L Y+ D  +   +++L
Sbjct: 5    IPVLLNPLVNSVFNCSNPSDSQFKKLFGKLKTERFILLVPPTEKLLYHVDAESGSSMNDL 64

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C + +FV+SHIL        +   +D     +  + ++ T N K +    S   + TT+G
Sbjct: 65   CQNYDFVASHILLL-----QQDTYSDGGFNLSASQTEYKTLNDKRVAVRSSSGEILTTEG 119

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLD-CFPNLTINT 179
            F  R   RI   E + +F +YL GS  F L++ID PLI T  L++  D+         N 
Sbjct: 120  FPLRRRARIQNVELITNFNDYLNGSEKFALVHIDHPLIGT--LIRKIDIPRGLAQGNFNG 177

Query: 180  TPSTRSLA-NLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRK 238
              +  SL  +L+        N L    +H  ++      F  YR     +E      FR 
Sbjct: 178  VDAKGSLVRDLTQKSWSSFENIL---RLHPDWSNILNGYFNRYR-STPLTEGPYEELFRM 233

Query: 239  TIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDI 296
             + +++  +  D  F  IP +  LI +YVE N++DDVW  ++N         K    ++ 
Sbjct: 234  IVKQVHAKMVNDELFRKIPHLYDLIFDYVELNLFDDVWIRIVN------SYRKDEIDTEP 287

Query: 297  FRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETL 356
             +F+S+++L+T+ Y+ K+ KF L+D+  +EKNI  A  SF  L +THT+ EK   L+ TL
Sbjct: 288  LKFLSINELETELYQKKYEKFRLQDVTTMEKNIDLAINSFVGLPLTHTHAEKADCLINTL 347

Query: 357  QILSKPVKRVGGYQ-VPIT--ADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413
            Q LS   ++    Q +PIT  ADTL+S F+L++ RT++KNI+ HL+YL+ F +DENSIKF
Sbjct: 348  QSLSNTREQDMDIQTLPITMDADTLISFFVLVVCRTQVKNIKSHLFYLKKFSKDENSIKF 407

Query: 414  GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473
            G+LGYAISTLEAV+ Y + ++  K +L  ++ +D+N  + L +L   K      LD+S++
Sbjct: 408  GILGYAISTLEAVVFYFDGLKGTK-KLQKLQ-DDSNKAKELYILISDKSTGQAVLDISQF 465

Query: 474  SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533
              N  +R   G S LS CIIN KN + +ELL +NYE  F  ED+L+D+T +G+TLL+Q+L
Sbjct: 466  RSNLEFRTPQGESVLSQCIINDKNGLLYELL-KNYEDIFPLEDILDDETVDGSTLLIQAL 524

Query: 534  QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDS 593
            +  N E  + + +++  + TE+EL  Y  + DK +R + HY+  +  +L+ IGKYI W S
Sbjct: 525  KCDNSEAAQMIVEVLQNSCTEQELREYVNRADKNRRTVAHYLTHEMNILESIGKYINWKS 584

Query: 594  KDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHI 653
            +D  G TPL  IFR YDQ  Y+ M+  +F  AV WY       F F DH D+KGNTLLHI
Sbjct: 585  QDSNGHTPLFTIFRCYDQQNYEAMISAAFRSAVRWYQA-NGEDFQFSDHEDNKGNTLLHI 643

Query: 654  IKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFD---FLK 710
            IK N+S LL   +VDIN  N +GL+PL     Y+R +NV+ +++D R+I        FL 
Sbjct: 644  IKNNVSILLDYDNVDINCTNKKGLTPLMIYTRYNRFDNVKTIIRDQRIILDKLQHPSFLN 703

Query: 711  QYPNTKSAPILSHYCLD--NEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQELIGSEA 768
             +   ++  +L            F      H  +  +      +T +    A E   +  
Sbjct: 704  SFDYARNPLVLKELVSQAIKTTAFELAFVHHLKYE-APSWFFHITVKIGAGADEEYKTVK 762

Query: 769  FEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKT-ASSRSLMKSSFCSKVLKKLTYC 827
                            H  +F P            K+   S + +++ +       LT C
Sbjct: 763  LHIKTLQNLFQVLLKMHFASFLPLEKALEDLSNLYKSRMPSIAKLETLY---FFYMLTDC 819

Query: 828  LDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKY 887
             D ++  + L    L+   L+    +++K   + +KL+   K K ++PE IG + +FL++
Sbjct: 820  FDVLLRHDNLNKLVLRESRLVSWIRSQDKKCNNSKKLQ---KQKNVEPEEIGIMASFLRF 876

Query: 888  ILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVRYSTIDN 947
                L  +K  ++ ++                   +   G E +  +  R + +   I+ 
Sbjct: 877  NRGELSAVKLKLMTMKKLLIFLKLKNTDLTHSYQFLSLFGTEYNLAQ-DRLLFKDLEINC 935

Query: 948  KFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLAR 1007
               GE++    V +I F E+C   +++ ++ LL + IPEWWK YG +LE+ K        
Sbjct: 936  CAFGEEATMTFVREIAFLENCTGKLLDRVEQLLSVDIPEWWKLYGDVLEMHKV------- 988

Query: 1008 ESDHKQT-PNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDN 1066
               +KQ  PN S N         SG G++ +F EGKR K + +  + ++D ++R++ + +
Sbjct: 989  ---YKQKFPNISRN--------DSGTGIIASFFEGKREKMESKLSSDLADCKKRMRRVGD 1037

Query: 1067 EIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
             I + + ++  E   ++ F+S F  + +L + V
Sbjct: 1038 RISSTHEILAEELSKYMEFKSNFFINGILRRAV 1070

>TDEL0G04490 Chr7 complement(814781..818062) [3282 bp, 1093 aa] {ON}
            Anc_6.20 YML002W
          Length = 1093

 Score =  497 bits (1280), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 358/1129 (31%), Positives = 550/1129 (48%), Gaps = 98/1129 (8%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPLV+AVFNC +   S L+K++S+L D  FILLVPP   L   +D+ +  PL EL
Sbjct: 5    LPVLLNPLVNAVFNCPNPSTSNLKKLFSNLKDRKFILLVPPCDRLLDCNDKLSGSPLQEL 64

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAV---REAKFCTFNGKIINGLFSKQSLYT 117
            C+S EFV+SH+L          ID   +         + KF T NGK +      + + T
Sbjct: 65   CYSYEFVASHVLL---------IDEQNAEYMTTAPPSQVKFDTLNGKKVIVRSQNRIILT 115

Query: 118  TDGFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTI 177
            +DGF  +    I K +   +F  YL     F ++ ID+P+             C  ++  
Sbjct: 116  SDGFQVKKRCHITKTDLFVNFNEYLLQEYKFPILCIDEPI-------------CAESVRT 162

Query: 178  NTTPSTRSLANLSSAEVPPQRNPLLNS------------MIHAQYNWKFRAVFQNYRKEI 225
                 +++L +    E     +P L+S             IH  +  KF  +F  YR   
Sbjct: 163  QRVQISQTLGS-GKRETKDGSSPTLDSSQGSKSSFDNILRIHPDWALKFNELFAEYR-ST 220

Query: 226  TQSESMLIPGFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNA 283
             + +   I  F   I + Y  +  D  F ++P +  LI +YVE N+YDD+W V I  +  
Sbjct: 221  PEGDDPHIELFHDIIRRAYSAMRSDALFASMPDLSDLIYDYVELNLYDDIW-VRITHHFK 279

Query: 284  EGEKEKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTH 343
            + E E     S+  R++SL QL+T  Y  KF +F LK +V +E NI  A  SF  L + H
Sbjct: 280  DSEVE-----SNGLRYLSLHQLETGLYPDKFEEFNLKSVVSMENNIELAMNSFSRLPLAH 334

Query: 344  TYVEKCRVLVETLQILSKPVKRVGGYQ-VPITADTLVSLFILLIKRTKMKNIRCHLYYLQ 402
             + +K   L++TL+ LS+  K +     V I ADTL+SLF+L+I RT+++N++  L+YLQ
Sbjct: 335  AHADKAMYLIDTLRNLSRVDKSIQEVSPVAIGADTLLSLFVLVICRTQLRNLKGQLFYLQ 394

Query: 403  NFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKC 462
            NF ++E SI FG+LGYAISTLEA +CY + ++  K ++  +E    N    +  L+    
Sbjct: 395  NFAKNETSITFGVLGYAISTLEAAVCYFDELKGSK-KMSRLESECENARSLVDKLSSE-- 451

Query: 463  VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQT 522
              +  ++L  Y     YR   G S LS+CI N KNDI  ELLS+  E  F  ED+LEDQT
Sbjct: 452  --SSSVNLIHYQKTLSYRTEQGESLLSICIANGKNDILQELLSD--ERSFPLEDILEDQT 507

Query: 523  TEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLL 582
            TEG TLLMQSL+  N +    + D++  + T+EE++ Y  + DK KR   HY+  +  +L
Sbjct: 508  TEGCTLLMQSLKCGNGDAASLIVDLIKSSCTQEEMFAYFNRSDKDKRTAAHYLTHEINIL 567

Query: 583  QKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDH 642
            ++IG +  WD KD +G T L  IFRSYDQ  YD M+  SF  A EWY+  +   FCF  H
Sbjct: 568  EQIGNFFDWDVKDSSGHTALFTIFRSYDQPNYDDMIRASFRCAAEWYA-CRMRPFCFTVH 626

Query: 643  TDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI 702
             D K NTLLHI+K +IS LL+   VD+N  N +GL+PL   A Y+R +N +++L D R+I
Sbjct: 627  EDRKENTLLHILKRSISILLEYESVDVNARNRKGLTPLMVYAKYNRLDNTKSILTDKRVI 686

Query: 703  FSSFDFLKQYP------NTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSRS 756
                    Q+P      +    P++ H  +  ++         F   +  + S  L + +
Sbjct: 687  LGKI----QHPLLLCSIDYAKNPLILHE-IAKQSAMDTAFGKCFVHTLKYESSSWLVNIT 741

Query: 757  -KEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSS 815
             + D +    +  F                P TF P            K   S      +
Sbjct: 742  VQADRKGNFETVEFHLKTVQNFFRTVLRTCPMTFLPLDSTLNQLASLGKARLSSIGKLET 801

Query: 816  FCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQP 875
             C   L+ LT C + ++  + LP   L + + L   I  +            S  KK++P
Sbjct: 802  VC--YLRSLTNCFNVLINSQELPKDILANESKLLSWIKVQYKAFRNGTTHIFS--KKVEP 857

Query: 876  ESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKI 935
            E +  I  FL++    L  L+  +  ++                  ++  LG+E      
Sbjct: 858  EEMSIIQGFLRFNQAELSTLRSKLHVMKKLAIFLRLKSSDVEQSVELLLPLGSE------ 911

Query: 936  GRAMVRYSTIDNKF-----LGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKC 990
            G   + Y   D+KF      G  S  LLV  I     C   + + I++LL +KIPEWWK 
Sbjct: 912  GMGDL-YPLTDHKFSCTTVYGNDSMILLVEDIDLMLKCTIRLYDHINNLLQVKIPEWWKL 970

Query: 991  YGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERT 1050
            YG+LL   K+           +  P+   N G ++TD     G++G  +EGK+ K ++R 
Sbjct: 971  YGELLNFRKQYA---------QNFPHLVKN-GETSTD----AGIIGKILEGKKEKLEKRL 1016

Query: 1051 RAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
              +I++ +R +      I  ++  +  +   F+ F+  +I   ++++WV
Sbjct: 1017 SFSIAETRRSMNQAGAIIAHDHESLAEQLSKFMEFKGAYICRGVIKRWV 1065

>Sklu_YGOB_Anc_6.20b Chr5 (89924..92470,92474..93193) [3267 bp, 1088
            aa] {ON} ANNOTATED BY YGOB -
          Length = 1088

 Score =  474 bits (1219), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 340/1115 (30%), Positives = 559/1115 (50%), Gaps = 76/1115 (6%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPLV++VFNC     SPL+K+++SL D  FIL+VP    L +Y D +T   L +L
Sbjct: 5    LPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQDL 64

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++ EFV++HI+     KD+K  D +           F T NGK +        + T DG
Sbjct: 65   CYTYEFVANHIIIL--KKDSKYSDQE-----------FKTLNGKTVLIRSQNGIVLTGDG 111

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
            F  +   +I   E   +F +YL+GS  F LI+ID+PL+  +  +K ++L  F   + NT+
Sbjct: 112  FPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLM--SDAVKNDELQVFGVRSTNTS 169

Query: 181  PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEIT---QSESMLIPGFR 237
                S  +L+  EV           +H Q   +F  +F+  R+EI    +    L+  F 
Sbjct: 170  SLPLS-TDLTQREVSSFEQLF---RLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFD 225

Query: 238  KTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESS- 294
            K   + ++ +  +  F     + Q +  YVE N+YDD+W+ +      +  ++ + E++ 
Sbjct: 226  KFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQI-----TQLYRDDEIEATY 280

Query: 295  --DIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVL 352
              ++ ++I++ Q+ T FY  K SKF LK +   EK++ +AT  F+ L+ + ++ EK +++
Sbjct: 281  DYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKII 340

Query: 353  VETLQILS--KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENS 410
            ++TLQ L+            V I ADTL+ L +L++ R+++KN++ HL+YLQNF  DEN+
Sbjct: 341  MDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENT 400

Query: 411  IKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDL 470
            IKFG++ YA+STLEAV+CY E  E +  ++  +E N    ++F   L+  K VS + L  
Sbjct: 401  IKFGVVAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLS-CKAVSFDSL-- 456

Query: 471  SKYSHNFRYRNGDGNSTLSLCII--NFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTL 528
              Y    R R   G S LS+CI   NF      E L +N+E     ED+L+DQT  G+TL
Sbjct: 457  KSYRDILRIRTAGGESCLSVCIQKGNFSG---IECLLQNFEHELPLEDILDDQTINGSTL 513

Query: 529  LMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKY 588
            LMQ+L+  N  + + L +I+ ++ T  EL  Y  +R+++KR   HY+     +  KIG +
Sbjct: 514  LMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIF 573

Query: 589  IKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGN 648
              W++KD +G TPL  IFRSYD   Y  MV  +F  A +WY  ++   F F  H D+KGN
Sbjct: 574  FDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYE-IRGENFNFSAHKDTKGN 632

Query: 649  TLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFD- 707
            TLLH++K NI  LL+  ++D+N+VN +GL+PL     Y+R +NV+ +L+D RLI      
Sbjct: 633  TLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQK 692

Query: 708  --FLKQYPNTKSAPILSH--YCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKEDAQEL 763
              FL  +   K+  I +   +    +  F  ++A    FR  N R  +  +   +D +  
Sbjct: 693  SLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAH--TFRFENNRWFLWITLKGKDRETD 750

Query: 764  IGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSSFCSKVLKK 823
              +                 ++P +F P            KT    S+ K     + L +
Sbjct: 751  FQTVKHNIRAIQGLLQVYLRRNPMSFLPIDAVLEDLHEIGKTGLV-SVGKLE-VHRFLCE 808

Query: 824  LTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITT 883
            LT  L  + + E    A     + L   I        E   KR +  ++++PE I +I +
Sbjct: 809  LTLVLKLICQKEEFKKALYLPASDLVNWIR-------ESGRKRTNVSRRIEPEEINSIQS 861

Query: 884  FLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVRYS 943
            FL++ L  L  ++  I  L+                  ++ +    +    I +A    S
Sbjct: 862  FLRFNLSELSLIRDKISILQKLSIFSELKAQDINQARCMLFSQSVRLEDTAISQAF-GIS 920

Query: 944  TIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPS 1003
             +  K   + S  +L   I F + C + ++  ID LL  K+  WWK Y +LL+       
Sbjct: 921  GLSEKDSEDLSATILTSNIDFLKECTNKLVGKIDQLLQGKLTRWWKLYAELLD------- 973

Query: 1004 VLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKL 1063
              AR   +K  PN+   V     D+    G+ GT++EGKR K +E+  A I     RL+ 
Sbjct: 974  --ARNQYNKNFPNS---VKPHLDDNK---GLFGTYVEGKRSKLEEKLSAQIKSCLERLQT 1025

Query: 1064 LDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKW 1098
            L  E+   +  +  E  I++ F++ ++ + +++ +
Sbjct: 1026 LTYEVKQEHEALAEELSIYLEFKTNYLRTGIIQDF 1060

>CAGL0L07634g Chr12 complement(840409..843801) [3393 bp, 1130 aa] {ON}
            some similarities with uniprot|Q04257 Saccharomyces
            cerevisiae YML002w and some similarities with
            uniprot|Q04257 Saccharomyces cerevisiae YML003w
          Length = 1130

 Score =  458 bits (1178), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 339/1132 (29%), Positives = 571/1132 (50%), Gaps = 89/1132 (7%)

Query: 11   AVFNCQDVEASPLRKVYSSL-HDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSS 69
            A+ NC +  +SPL+K+Y+ L     +++LVPPT  L YY D+ +   LH+LC++P F S+
Sbjct: 19   AICNCGEPNSSPLKKLYTQLGKKDKYLILVPPTELLLYYSDKESNSELHDLCYTPNFASA 78

Query: 70   HIL------TRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTD--GF 121
            HIL      T  +  D   +  ++ +   V   K    + K IN  +  + +Y  +  G 
Sbjct: 79   HILLLDATDTEVNNGDEAVLIKNIEKRYDVHFIKAMDQSWKFIN--WKNRVIYEFNKLGD 136

Query: 122  SFRSTRRILKYETLDHFQNYLQGS-STFILIYIDQPLIDTNRLLKCE---DLDCFPNLTI 177
              ++  +IL  E++  F NY++ + +T  ++YID   +  N  L+C    D+D   + ++
Sbjct: 137  QIKNRAKILDIESIPIFNNYMKTTDNTITIMYIDDVFL--NGTLECNLRSDIDLLRSPSM 194

Query: 178  NTTPSTR--SLANLSSAEVPPQRN-PLLNSMIHAQYNW--KFRAVFQNYRKEITQSESML 232
             + P+ +  SL N  S +    ++    +S++    +W  KF   FQ +R  +   + + 
Sbjct: 195  RSIPTAKRPSLINKKSTDYENSKSKATFDSILRVNKHWSSKFEQHFQKFRL-LANQDDLP 253

Query: 233  IPGFRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQ 290
            I  F   I+++++ +  DN F  I  +R +I EYVE N++DD+W++++ R N E E +  
Sbjct: 254  IDVFHNIIEEMHEEMVSDNLFKNIVDLRNIIYEYVELNLFDDIWKMIL-RMNKEVEIDLN 312

Query: 291  SESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCR 350
                  F  IS+ Q+D++F   ++SKF+L++++  E+NI +A+KS + +     Y  K  
Sbjct: 313  P-----FGNISIYQVDSEFLSTEYSKFFLENVITAERNIKEASKSLQKIESASNYKSKAN 367

Query: 351  VLVETLQILSKPVKRVGGYQ------------VPITADTLVSLFILLIKRTKMKNIRCHL 398
            +L+ TL+ L+   K   GY             + I AD L++LF+L+  R ++KN++CHL
Sbjct: 368  ILILTLRTLTGN-KENDGYSSKNDDGNLSFFPLAIDADRLMNLFVLVTCRAQIKNLKCHL 426

Query: 399  YYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLT 458
             YLQNF+ +++  KFG+LGYA+STLEAV+CY E ++  +     I+  ++N      L +
Sbjct: 427  SYLQNFYNNDSDTKFGILGYALSTLEAVVCYFEQLKEKENYRKLIDFCNSNERLVKVLSS 486

Query: 459  RSKCVSNEGLD-LSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDL 517
              K  +N  L  L KY  + RYR+  G S L+LCII+ +ND  + +L+E YE+ F  EDL
Sbjct: 487  TKKYETNAALYFLRKYEGSLRYRDSLGQSLLALCIIHGRNDFLYHILNE-YETLFPIEDL 545

Query: 518  LEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICG 577
            L D++ +G+TLL+Q+++H N      L +I+  N TE EL  Y  + D  KR  GH++  
Sbjct: 546  LADESIDGSTLLIQAVKHDNQYSASLLLNILKDNCTEIELIAYINRHDINKRTAGHFLTN 605

Query: 578  QQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKF 637
            +  +L+ +GKYI W  KD  GQTPL  IFRSYDQ  YD MV  S   A  WY  +    F
Sbjct: 606  ELEVLKLMGKYINWVQKDNAGQTPLFTIFRSYDQDNYDEMVSQSMEYATNWYG-LNGKNF 664

Query: 638  CFRDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLK 697
             + DH D KGNTLLHI+KCN+  LL    +++N  N  G +PL  +  Y R EN+  LL 
Sbjct: 665  NYLDHVDKKGNTLLHILKCNLPILLADKHINVNATNRSGQTPLMTSIRYKRTENIRDLLC 724

Query: 698  DPRL---------IFSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKR 748
            DPRL           ++FDF K   + +   +L  + L N +P+  + A    +  +++ 
Sbjct: 725  DPRLRVDITQKNNALTAFDFSK---DDEITHLLGEHELLN-SPWLAVYAHTLKY-TNSRW 779

Query: 749  SVVLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASS 808
            ++ LT + K+  +    +  F               +   F P            +   S
Sbjct: 780  NLSLTVKLKDAPK----TTNFTLKTLRGILRVVIKNNMTVFLPVQELVEDLISFNRIRFS 835

Query: 809  RSLMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRS 868
              LM+     ++L  +++CL ++V +++L     Q+    E  I   K+    +K   ++
Sbjct: 836  E-LMRIKVL-EMLPFISFCLSALVHIKVLDLNVFQTE---ENAIKWVKMNGSVDKKTNQT 890

Query: 869  KDKKMQPESIGTITTFLKYILESLLKLKGTI-IELRXXXXXXXXXXXXXXXXXNIVCTLG 927
             D  + PE I  I  FLK+ +  + + K  + I  +                 N V T+ 
Sbjct: 891  SD--ITPEDISMIQNFLKFNITEIERTKNKLEIAEKLSLFSRLKSKDLLNSNENYV-TIV 947

Query: 928  AEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEW 987
            +++SSK+  R+ ++YS  D K L  ++   L+ +I + + C   + N I  +    I  W
Sbjct: 948  SQLSSKRF-RSTLKYSAEDTKLLSVRAEKALLSKITYLKICAQKLHNHILSITTTMISNW 1006

Query: 988  WKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQ 1047
            W  YG+LL             + HK    A   +   TT++   + +       KRIK +
Sbjct: 1007 WHIYGELL-------------NAHKHYTRAFPELANVTTEN-RDLALHRMISNPKRIKLE 1052

Query: 1048 ERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
            ER    I D+  +L  + ++I   + L   E   FI+ ++KF     L+ ++
Sbjct: 1053 ERLSEKIKDITEQLNSVGHDIKQMHELAAEEVSRFIDLKTKFTLEYALQSYL 1104

>Kwal_56.22424 s56 (121475..124744) [3270 bp, 1089 aa] {ON} YML002W -
            Hypothetical ORF [contig 185] FULL
          Length = 1089

 Score =  444 bits (1143), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 340/1130 (30%), Positives = 545/1130 (48%), Gaps = 112/1130 (9%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPL++AVFNC     S L+KV+S++  + F+L+ PPT  L  Y+D  +  PL +L
Sbjct: 5    LPVLLNPLINAVFNCPTPLNSSLKKVFSAIEKVRFVLIAPPTELLLEYEDLESGLPLQDL 64

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++  FVS HI+              L     ++E ++ T +GK I     +  ++T   
Sbjct: 65   CYATGFVSDHIVL-------------LDGREGLQEEEYKTLSGKTILLRSQQGIIFTAAA 111

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINT- 179
            F  R   RI + E L +F  YL+G +TF +I++D PL  T RL + ++  CF  +T N  
Sbjct: 112  FDTRRRCRIQRAELLTNFNEYLKGDTTFPIIHVDFPL--TGRLARRDEWQCF-RVTKNQE 168

Query: 180  -TPSTRSLANLSSAE----------VPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQS 228
             T   ++   LS  +          + P+    LN ++ AQ     R    +     T  
Sbjct: 169  HTNGPKNSGKLSHGDNNISLEQLLRINPEYGESLNDIVKAQ-----RISLNSSVTGTTHL 223

Query: 229  ESMLIPGFRKTIDKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKE 288
             S  +   +K +D +      +F  +P +   + EY+E N+YDD W  L N +  + E E
Sbjct: 224  ASHFVQTCKKALDVVRAY--PAFQVLPNLPICVHEYIELNLYDDYWAQLTN-SLRDSEIE 280

Query: 289  KQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEK 348
              S+ S + + IS+ Q+ +  Y +   KF L+ I Q EKN+  A +SF  ++VT+ +  K
Sbjct: 281  SSSDYS-LLKHISVSQVPSFLYPSNPEKFDLRLITQAEKNVKGAVESFRKIAVTNCHSAK 339

Query: 349  CRVLVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDE 408
             +V++ETLQ LS+ +  V    V I ADTLVSLF++++   ++K++R HL+YLQ F +D 
Sbjct: 340  AKVIIETLQTLSRSL-LVDDRAVTIDADTLVSLFVVVVCHAQVKDLRSHLFYLQEFTKDT 398

Query: 409  NSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKN-DANLEEFLTLLTRSKCVSNEG 467
            N + FG+L Y +STLEAV+CY E+     E++  +EK   ANL  +       K +S   
Sbjct: 399  NLVTFGILAYGMSTLEAVLCYFES----PEKVASLEKYCRANLSHW-------KSISEGS 447

Query: 468  LDLSK-----YSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQT 522
            +DL+           + R  DG S L++C+ + + +  FEL+    E++F  EDLL D+T
Sbjct: 448  IDLNADTTVPLDDLLKIRTSDGQSCLAVCLQHRRTE-EFELIKNTREAWFPLEDLLHDET 506

Query: 523  TEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLL 582
            T+G+ LL+  L+     +   L + ++ N T++EL  +    +KY+R+ GHY+     L+
Sbjct: 507  TDGSNLLIHMLESGCDRLAVMLINTLISNCTKDELIAFLNHTNKYQRSCGHYLMHAPQLI 566

Query: 583  QKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDH 642
              +G  + W+ +DC G TPL  I R+YD+  Y  MV  ++  AV   S V+NS+F   +H
Sbjct: 567  DLVGDILNWEQRDCNGHTPLFAIVRAYDRPDYFDMVSAAYRAAV-GQSKVRNSRFRVSNH 625

Query: 643  TDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI 702
            TD KGNTLLH+IK ++S LL  P +D+N  N++GL+PL     Y+R  NV  +L+D RLI
Sbjct: 626  TDDKGNTLLHVIKSDVSILLADPFIDVNATNAKGLTPLMVYVRYNRIGNVRTILQDQRLI 685

Query: 703  ---------FSSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLT 753
                      S FD++K     K     + Y      PF   I  H   R  ++  + +T
Sbjct: 686  IGKHQSGAYLSCFDYVKNPAVLKELGKYASYL-----PFEFSINVHSVKREGDEWVLWIT 740

Query: 754  SRSKEDAQELIGSEAFEXXXX--XXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSL 811
                E     +  + F+                HP TF P              + SR L
Sbjct: 741  VTGGEKQ---VPVKVFKRSLRFIQAFLTLFSDAHPMTFVPVDELLRELRAL---SQSRIL 794

Query: 812  MKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDK 871
            + +   +K   K      SMV  E      L + A  + ++                  K
Sbjct: 795  ILNKMDTKRFLKRCSVTLSMVSQE-----RLFADAFTDSNLNLSSSRGLGSSESFTQNMK 849

Query: 872  KMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVS 931
             M+PE + +I + LK+ L  +  LK  ++ ++                     T GA+  
Sbjct: 850  MMEPEEVRSIQSILKFNLSEISALKTAMLLMKKLAVFEGLKGKDLSEA---CMTFGAKCK 906

Query: 932  SKKIGRAMVRYSTIDNKFLGEQSFDLLVFQ-----IHFFESCLSSIINSIDHLLHLKIPE 986
                G    +  + D+ FL  Q+ +L  F+     I   E C S +   I  +L+  IP+
Sbjct: 907  YVTQG----KIQSFDH-FLNVQAPNLFDFEGIANNIALCELCSSLLCKHIGQVLNDDIPK 961

Query: 987  WWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKN 1046
            WW  YG+LL L +E      +       P+ S N            G+ G++IE KR K 
Sbjct: 962  WWHTYGELLSLRRE----YKKSFPDANRPHVSEN-----------SGLFGSYIETKRTKL 1006

Query: 1047 QERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLE 1096
            ++   A I+    RL  +  +I+ +N  + +E   FINF+++F+ SA+ E
Sbjct: 1007 EQSYAARINHTSVRLSEISTKINQDNERLAVELNNFINFKNEFLKSAIKE 1056

>ACR006C Chr3 complement(364436..367651) [3216 bp, 1071 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YML002W and
            YML003W; YML002W and YML003W represent one ORF in this
            genome
          Length = 1071

 Score =  424 bits (1091), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 332/1118 (29%), Positives = 541/1118 (48%), Gaps = 90/1118 (8%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            +P LLNPLV+AVFNC    ASPL+K++++  D  FIL+VP T  L  Y D  T  PL EL
Sbjct: 5    LPVLLNPLVNAVFNCPAPGASPLKKLFNNAKDKKFILVVPRTEVLLQYQDATTYVPLTEL 64

Query: 61   CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
            C++ EFV+SH L +            L   R V E +F T NGK +  +   QS   T  
Sbjct: 65   CYNYEFVASHTLVQ------------LQEAR-VTELEFQTINGKSV--VIRPQSGIITAQ 109

Query: 121  FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
             S +  R I + E L  F +YL G + F L+YID+PL+    L+    L  F        
Sbjct: 110  PSAKKCR-IQRCELLRSFNDYLLGRTAFALLYIDRPLVGEIELIT--PLRVF-------G 159

Query: 181  PSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKE---ITQSESMLIPGF 236
            P  + L      +      PL   + +H Q   +   VF++ ++    I  S   L+  F
Sbjct: 160  PQEQPLQYQRITQTADAPLPLEQFLRLHPQLGNQLDEVFKDAKERMRYIALSLKELVRLF 219

Query: 237  RKTIDKIY--DGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEK-QSES 293
             + ++K+Y    LD +F     + +++Q YVE N+Y+DVW+ L+  N   G+ E  +   
Sbjct: 220  HELVEKVYCLIKLDKNFRNYLNLLEMVQGYVELNMYEDVWRKLVQLN---GKNEPDRVPG 276

Query: 294  SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353
              I R ISL+QL T  Y  +  KF L  + ++EK + +AT+ F  L++T+++ EK R+L+
Sbjct: 277  YYITRSISLNQLSTSIYPEELDKFNLSPVTEIEKRVVQATECFSKLTLTNSHHEKARILI 336

Query: 354  ETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413
             T Q L+    +       I ADTL+ L ++++ R ++KN++ HL YL+ F Q+ + +KF
Sbjct: 337  STFQKLTTKTSQ-ATLDPMIDADTLLGLMVVVVCRAQVKNLKSHLDYLREFAQNSDDVKF 395

Query: 414  GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSN---EGL-- 468
            GLLGY++STLEAV+ Y +           I  +   LE  +T   R+K   N   +G+  
Sbjct: 396  GLLGYSLSTLEAVVGYFD-----------IGGSSIKLERLITQCQRNKIFWNLIEQGIPI 444

Query: 469  DLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTL 528
            +L ++      R     S LSLCI   + D+F+++++ NY+S+F  ED+L+D      +L
Sbjct: 445  NLKEHEEVLISRTPSCESVLSLCIQYGRQDVFYDIIA-NYQSHFTLEDILQDVNQSNCSL 503

Query: 529  LMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKY 588
            L+Q+LQ  N +ITE + D+++ N T  E+Y Y  K D   R +GHY+     ++ ++GK+
Sbjct: 504  LIQALQAGNKDITEAVIDLLIANCTNTEMYAYINKCDIAGRTVGHYLPQNYEIVDRLGKF 563

Query: 589  IKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGN 648
            + W  KD    TPL  + R+YD   Y  ++   F    ++YST +  +F F DH D  GN
Sbjct: 564  VDWKRKDLNMHTPLFTVCRAYDHPSYLELLSKCFQHCFDFYST-RGKRFSFADHEDPLGN 622

Query: 649  TLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSF-- 706
            TLLHIIK  I   L +P  ++NK N++G++PL   A Y+R EN+  +L D RLI S    
Sbjct: 623  TLLHIIKDGIQLALSTPGANVNKCNTRGMTPLMVYAKYNRIENIREILNDKRLILSKLQD 682

Query: 707  -DFLKQYPNTKSAPILSHYCLDNEAPFRN----IIASHFDFRISNKRSVVLTSRSKEDAQ 761
               LK     K+  IL+   L   A  +N     ++ H      N   + +TS    ++ 
Sbjct: 683  PQSLKAIDYVKNPIILN---LIGTAMAKNSLYGCLSVHNIKYEENAWYLWITSSLSPESY 739

Query: 762  ELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSSFCSKVL 821
            +   + ++              +HP +F P            K+     +   +  S +L
Sbjct: 740  K---TSSYALKDIQSLLQIYNKKHPMSFLPIDHHLETLKTLGKSGIISVINLEN--SMLL 794

Query: 822  KKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTI 881
            + LT+ L  + + E        + + L   +    V       ++ +K  K++PE I +I
Sbjct: 795  EALTFSLSIIQQREDYKNVFSYTESELSTWLRASMVK------QKPNKRDKIEPEEIHSI 848

Query: 882  TTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVR 941
              FLK+ L     L+     L+                  I+ + G E+ +  +    +R
Sbjct: 849  QNFLKFSLTEFNYLREKFTVLKKLIIFEHYKSHDIECSQRILYSQG-EIIASVVPSKRLR 907

Query: 942  YSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKED 1001
             S  DN+F      D     + F   CL S+ + I  +L  K+  WW  YG++  L KE 
Sbjct: 908  TSPFDNEF--NDGIDPFEQAVDFMCMCLDSLTSKIVEVLDSKVSTWWTLYGEITNLQKE- 964

Query: 1002 PSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRL 1061
                 R    K  PN++++  +         G   +++E KR K + + ++ +S     L
Sbjct: 965  ---YQRNFPEKGKPNSASSEDSK--------GFFVSYMEDKRQKLESKLQSRLSVCSENL 1013

Query: 1062 KLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
            + LD E+   + L+  E   FI+ ++    + M++ +V
Sbjct: 1014 QHLDAELKHCHELLAEEISFFISSKNFAYMNFMVKAYV 1051

>Sklu_YGOB_Anc_6.20 Chr5 (89924..92473) [2550 bp, 849 aa] {OFF}
           ANNOTATED BY YGOB -
          Length = 849

 Score =  412 bits (1058), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 267/775 (34%), Positives = 428/775 (55%), Gaps = 50/775 (6%)

Query: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
           +P LLNPLV++VFNC     SPL+K+++SL D  FIL+VP    L +Y D +T   L +L
Sbjct: 5   LPILLNPLVNSVFNCPTPSTSPLKKIFASLRDQRFILVVPNVNILLHYQDLDTGSSLQDL 64

Query: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
           C++ EFV++HI+     KD+K  D +           F T NGK +        + T DG
Sbjct: 65  CYTYEFVANHIIIL--KKDSKYSDQE-----------FKTLNGKTVLIRSQNGIVLTGDG 111

Query: 121 FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
           F  +   +I   E   +F +YL+GS  F LI+ID+PL+  +  +K ++L  F   + NT+
Sbjct: 112 FPSKRRCKITNTELFINFNDYLKGSKYFPLIHIDKPLM--SDAVKNDELQVFGVRSTNTS 169

Query: 181 PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEIT---QSESMLIPGFR 237
               S  +L+  EV           +H Q   +F  +F+  R+EI    +    L+  F 
Sbjct: 170 SLPLS-TDLTQREVSSFEQLF---RLHPQLGDRFSGLFKEQRQEINANFKGLDSLVDFFD 225

Query: 238 KTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESS- 294
           K   + ++ +  +  F     + Q +  YVE N+YDD+W+ +      +  ++ + E++ 
Sbjct: 226 KFNYEAFELIRHERRFENHSKLHQTVHNYVELNLYDDIWKQI-----TQLYRDDEIEATY 280

Query: 295 --DIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVL 352
             ++ ++I++ Q+ T FY  K SKF LK +   EK++ +AT  F+ L+ + ++ EK +++
Sbjct: 281 DYNLLKYIAISQVPTPFYPEKQSKFSLKKVTHFEKSLEQATDCFKRLAFSSSHSEKTKII 340

Query: 353 VETLQILS--KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENS 410
           ++TLQ L+            V I ADTL+ L +L++ R+++KN++ HL+YLQNF  DEN+
Sbjct: 341 MDTLQTLTDYSEFPDADIEDVTIDADTLIGLMVLVVCRSQVKNLKSHLFYLQNFSLDENT 400

Query: 411 IKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDL 470
           IKFG++ YA+STLEAV+CY E  E +  ++  +E N    ++F   L+  K VS + L  
Sbjct: 401 IKFGVVAYALSTLEAVLCYFEDAE-NSGKIRSLEFNCRRNKQFWDHLS-CKAVSFDSL-- 456

Query: 471 SKYSHNFRYRNGDGNSTLSLCII--NFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTL 528
             Y    R R   G S LS+CI   NF      E L +N+E     ED+L+DQT  G+TL
Sbjct: 457 KSYRDILRIRTAGGESCLSVCIQKGNFSG---IECLLQNFEHELPLEDILDDQTINGSTL 513

Query: 529 LMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKY 588
           LMQ+L+  N  + + L +I+ ++ T  EL  Y  +R+++KR   HY+     +  KIG +
Sbjct: 514 LMQTLETGNTRMADVLLEILCQSCTINELREYLNRRNRWKRTAAHYLTQDLQMADKIGIF 573

Query: 589 IKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGN 648
             W++KD +G TPL  IFRSYD   Y  MV  +F  A +WY  ++   F F  H D+KGN
Sbjct: 574 FDWEAKDISGHTPLFAIFRSYDHPDYAQMVTNAFRTASKWYE-IRGENFNFSAHKDTKGN 632

Query: 649 TLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFD- 707
           TLLH++K NI  LL+  ++D+N+VN +GL+PL     Y+R +NV+ +L+D RLI      
Sbjct: 633 TLLHVMKTNIEILLEQENIDVNEVNKKGLTPLMVYVKYNRLDNVKCILRDNRLIMEKHQK 692

Query: 708 --FLKQYPNTKSAPILSH--YCLDNEAPFRNIIASHFDFRISNKRSVVLTSRSKE 758
             FL  +   K+  I +   +    +  F  ++A  F F  +N+  + +T + K+
Sbjct: 693 SLFLNCFDYVKNPVIQAELGFHAAEKTKFGEVVAHTFRFE-NNRWFLWITLKGKD 746

>Kpol_1037.25 s1037 (56141..59458) [3318 bp, 1105 aa] {ON}
            (56141..59458) [3318 nt, 1106 aa]
          Length = 1105

 Score =  407 bits (1047), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 305/1036 (29%), Positives = 509/1036 (49%), Gaps = 82/1036 (7%)

Query: 1    MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
            MP LLNPL++AVFNC D   SPLRK++  +    F+L+VPP   L +Y D      L EL
Sbjct: 8    MPVLLNPLINAVFNCPDPINSPLRKLFERIKYKNFMLIVPPNEILLHYRDPEKGLTLKEL 67

Query: 61   CHSPEFVSSHILT---------RYSGKD-NKPIDTDLSRLRAVREAKFCTFNGKIINGLF 110
            C+  EFV+SHI+          +  GK+ N+ +D   +R +++   +    N  II   F
Sbjct: 68   CYEFEFVASHIILDTDNSSNNLQVKGKNSNETLD---NRYKSLNNNQLLIKNNNIIPLDF 124

Query: 111  SKQSLYTTDGFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLD 170
            +  +         +   +I+  + L +F  YL GS  + +IY D P   +N  L   +++
Sbjct: 125  NNSTQ--------KKKYKIIDIKILPNFNEYLSGSEKYTIIYTDYPF--SNSWLPKIEIE 174

Query: 171  CFPNLTINTTPSTRSLANLSSAEVPPQRNPLLNSM-------------IHAQYNWKFRAV 217
             F         S +   N+ +A++   ++PL   +             IH ++N  F + 
Sbjct: 175  SF-------YISKKESNNIKAAQITNHKSPLSQDLAQKTKSSFRHIINIHKEWNNIFDSY 227

Query: 218  FQNYRKEITQSESMLIPGFRKTIDKIYDGLDN-----SFHTIPTIRQLIQEYVEQNVYDD 272
              +++ +     S+ I  FR+ +DK Y  +       SFH    +  LI EY+E + Y+ 
Sbjct: 228  IIDFKNKQLNLTSLPI-YFREIVDKAYQKMKFEEIFLSFHN--DLYNLIFEYLESSFYNS 284

Query: 273  VWQVLINRNNAEGEKEKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKA 332
            +W   I+RN  +     Q   +++  F+S+DQL+ + Y   F KF L +++++E+ +  A
Sbjct: 285  IWDH-IDRNMIDN----QFLHTEMMDFLSIDQLELELYNQNFQKFNLVNVIKVERCVKDA 339

Query: 333  TKSFENLSVTHTYVEKCRVLVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMK 392
            T  F+ +  + ++ EKC++L++ LQ L+     V    + + ADTL++LF+L+I R+K+ 
Sbjct: 340  TDQFKKIIDSKSHSEKCQILIDALQKLT-SYDDVHYEPLMVDADTLMNLFLLVICRSKVP 398

Query: 393  NIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIET----DKERLDCIEKNDA 448
             +R HLYYLQNF  DEN++KFGLLGY IST EA +CYL+  +     +K+ L+CI   + 
Sbjct: 399  FLRNHLYYLQNFSTDENNVKFGLLGYGISTFEATLCYLKDFQAGEKFNKQVLNCIRNKE- 457

Query: 449  NLEEFLTLLTR-SKCVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSEN 507
                   L+++ S    +    +  Y   F++RN  G S L+LCI + KN+  FE+L  N
Sbjct: 458  -------LISKISSEADHSTFQVKLYKDCFKFRNEMGESILALCIKHKKNETLFEILL-N 509

Query: 508  YESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKY 567
            +E  F  ED+L+D+  EGTTLLM++L+  N    + + D++  + +E+EL  Y  + D  
Sbjct: 510  FEDMFPLEDILDDEDIEGTTLLMKALKVENEVGAKLIVDVLQSSCSEDELIKYFNRTDNN 569

Query: 568  KRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVE 627
            +R   HYI  Q  +L++IG +  W  KD  G TPL  I R+YDQ  Y+ M+ET+F  A +
Sbjct: 570  QRIAAHYITNQIDVLKRIGLFFNWKIKDDKGYTPLTTICRTYDQECYEQMIETAFFEAQK 629

Query: 628  WYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYD 687
            WY   +N K  F+DH DSK NTLLHI+KC+I  LL+  +++IN  N + ++PL     Y+
Sbjct: 630  WYEN-RNQKLNFKDHNDSKENTLLHILKCDIQVLLKYDNININAHNLKYITPLMTYVKYN 688

Query: 688  RGENVEALLKDPRLIFSSFD---FLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRI 744
            R  N++ +++D RLI   +    FL  Y   K+  I     + +       + S +  R+
Sbjct: 689  RVSNIQEIIRDERLILGKYQKHTFLDCYDFVKNTIIFEDLGVRSVRNSMFNLFSAYSLRV 748

Query: 745  SNKRSVVLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXK 804
             N  + VL    K+  Q+   +++                +P  F P            K
Sbjct: 749  ENS-NWVLYFTFKDTNQDSYITKSVSLKILFNIIKKYNKLYPLHFIPHKEVLLRLTGIVK 807

Query: 805  TASSRSLMKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKL 864
               +  + K       L  ++    +++E +   T   ++   L + I   K      K 
Sbjct: 808  NNPNNGIQKLK-NRAFLNLISNYFGTLIETDDFDTELFKNPESLTKWIKAGK-----RKH 861

Query: 865  KRRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVC 924
            K+ +  K+M  + I  I +F+++ +  L KL  T+  L+                  +  
Sbjct: 862  KKENYYKRMTLDDINMIKSFVQFNINELGKLNRTLAILKKLCTFLALKINDVNESYKLFR 921

Query: 925  TLGAEVSSKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKI 984
              GA +  K I   M +   +      +  F +L+ QI F E C   + ++ + L+   I
Sbjct: 922  NFGALLQQKDISNQMKKIDGLIKPKYFQSIFLILLDQISFLEICTIHMSDNFNDLIKNDI 981

Query: 985  PEWWKCYGQLLELSKE 1000
            PEW   +  L  L K+
Sbjct: 982  PEWHSVHFILSNLKKQ 997

>KLTH0C11242g Chr3 complement(921970..925263) [3294 bp, 1097 aa]
           {ON} similar to uniprot|Q04263 Saccharomyces cerevisiae
           YML002W Hypothetical ORF
          Length = 1097

 Score =  406 bits (1043), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 252/726 (34%), Positives = 407/726 (56%), Gaps = 44/726 (6%)

Query: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
           +P LLNPL++AVFNC   + SPLRKV++ +    F L+ P    L  Y+D  +   L +L
Sbjct: 5   LPVLLNPLINAVFNCPTPQNSPLRKVFTRIEKQRFALVTPTPEILLEYEDLESGSSLQDL 64

Query: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
           C+S  FVS HIL    G                 E ++ T +GK I     +++L+T +G
Sbjct: 65  CYSASFVSDHILLLGGGG-------------CSHEEEYKTLSGKTITLRNQQKALFTGEG 111

Query: 121 FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
           F  R   ++L+ E L +F  Y QGSST+ +I++D PL  T RL + ++   F      +T
Sbjct: 112 FDARRRCQVLETELLSNFNEYFQGSSTYPIIHVDFPL--TGRLARRDEWPGFKAYRFAST 169

Query: 181 PSTRSLANLSSAEVPPQRNPLLNSMI--HAQYNWKFRAVFQNYRKEITQS---ESMLIPG 235
            +T + ++L+++  P      L  M+  H  Y  K  A+ +  R  ++ S      L   
Sbjct: 170 DTTSANSSLAASTEPKAS---LEQMLRAHPSYGDKLSAIIRTQRAALSSSTYNADNLAAH 226

Query: 236 FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSES 293
           F +T +K    +  D SF   P +R  I EYVE N+YDD W  L N +  + E E QS+ 
Sbjct: 227 FMQTCEKALAAIQEDQSFRAFPNLRLQIHEYVEMNLYDDFWAQLTN-SLKDSEIENQSDF 285

Query: 294 SDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353
           S I R IS+ Q+ +  Y     KF ++ + Q+EKN+ +A +    L VT+++  K +V+V
Sbjct: 286 S-ILRNISISQVPSFLYPTDRQKFDIRCVTQVEKNLREAVECLRRLPVTNSHSSKAKVIV 344

Query: 354 ETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413
           ETLQ +S+ ++ +    + + ADTLVSL ++++ + ++K+++ HL+YLQ F +D NSI F
Sbjct: 345 ETLQTVSRSLE-INDKVISVDADTLVSLLVVVVCQAEVKDLKSHLFYLQEFAKDSNSITF 403

Query: 414 GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473
           G+L Y +STLEAV+ Y E+    +E+L  +EK+ ++   +   L   K +    L+ S+ 
Sbjct: 404 GILAYGMSTLEAVLSYFES----REKLKLLEKHCSSNASYWEALADGK-LPLGSLNPSEV 458

Query: 474 SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533
               R R   G S LS+C+ N + ++F  L ++ +E  F  EDLL D+T EG+ LL+Q L
Sbjct: 459 KDILRTRTPAGLSCLSICLQNRQPNLFLHLATK-FEHCFPLEDLLNDETVEGSNLLIQML 517

Query: 534 QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDS 593
            +    ++    +++ ++ T+ EL  +    ++Y+R+ GHY+     L+ K+GK+I W+ 
Sbjct: 518 DNGCSSLSGNFIEMLFRSCTKTELESFLNHVNRYQRSSGHYLMHALDLIVKVGKFINWEQ 577

Query: 594 KDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHI 653
           +DC G TPL  I R+YD   YD MV  ++  A  W  T+K  +F    H D+KGNTLLH+
Sbjct: 578 RDCNGHTPLFAIIRTYDHTDYDAMVLEAYKSARLW-CTLKGKQFRLSKHQDNKGNTLLHV 636

Query: 654 IKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI---------FS 704
           IK N+S +L  P V++N  N +GL+P+   A Y+R +N++++L+D RLI          +
Sbjct: 637 IKSNVSVVLDDPLVNVNSFNKKGLTPIMVYARYNRLDNIKSILRDKRLIIQKCQNGSYLT 696

Query: 705 SFDFLK 710
            FD++K
Sbjct: 697 CFDYIK 702

 Score = 59.3 bits (142), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 99/234 (42%), Gaps = 24/234 (10%)

Query: 873  MQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSS 932
            ++PE + +I   +K+    +L +K   + L+                  +  + G   + 
Sbjct: 851  IEPEEVASIQKIMKFNRTEILAIKSGALMLKKLAIFGILKGKDLERSHTMFQSHGNNFT- 909

Query: 933  KKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYG 992
            K IGR+   + ++ +  L +  F  L       E     ++  ID +L+  IP WWK YG
Sbjct: 910  KIIGRSTNVFGSLKHS-LPQCEFGYLANNTALLELSSRLLVQKIDKILNHDIPHWWKTYG 968

Query: 993  QLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRA 1052
            +L+ L             H+   N  ++V     ++T   G + ++IE KR++ ++    
Sbjct: 969  ELVSLR------------HEYNKNFPDDVRPRVAENT---GFISSYIETKRVRLEQGLVG 1013

Query: 1053 AISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFI-------HSAMLEKWV 1099
             I+   + L      +  +N  + +E   FINF+++F        H+AM  KW+
Sbjct: 1014 RINRSSKNLLRFSLMLRRSNESLAVELNNFINFKAEFWVSATIKEHAAMNIKWL 1067

>NCAS0H00820 Chr8 (148184..151624) [3441 bp, 1146 aa] {ON} Anc_6.20
            YML002W
          Length = 1146

 Score =  400 bits (1029), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 334/1150 (29%), Positives = 554/1150 (48%), Gaps = 111/1150 (9%)

Query: 11   AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELC-HSPEFVSS 69
            ++FNC +   SPL+K+Y+SL D  FILLVPPT  L  Y D  TK  L +LC H+ +F+ +
Sbjct: 16   SIFNCPNPSNSPLKKLYASLKDKSFILLVPPTETLLNYTDTKTKIQLEDLCYHNVDFIGA 75

Query: 70   HIL---TRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDGFSFRST 126
            HIL          +  ID   +RL ++ +  F T NG  I   +    L    G   R  
Sbjct: 76   HILLPPKDSISSSSSTIDDGYTRLASIEQ--FDTLNGDNILVKWRNNFLVLLSGSPNRQK 133

Query: 127  RRILKYETLDHFQNYLQGSSTFILIYIDQPLI-DTNRLLKCEDLDCFPNLTI-----NTT 180
             +I + + L +F +YLQGS+ FIL++ID+PL+ D  RL   ++L+CF  LT+     +++
Sbjct: 134  IKIERIQVLPNFNDYLQGSTYFILVHIDKPLMKDVIRL--NDELECFDTLTLHDNDGDSS 191

Query: 181  PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPG---FR 237
            P  R L    S     Q   ++N+  +  +N +F+     Y+   T  E    P    F+
Sbjct: 192  PDARPLIQDMSQHERSQFENIINT--NDTWNKRFKDWMNEYKDSTTAEE----PNETLFK 245

Query: 238  KTIDKIYDGLDNS--FHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSD 295
            + +   Y+ L ++  F     +R+LI EY+E N+YD +W  +      + E +       
Sbjct: 246  QIVAVAYNELKSNKIFKGFGHLRRLIHEYLEINLYDHLWLQITTLCALDDETKGTR---- 301

Query: 296  IFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVET 355
              + IS++++D  FY+     F L  I +LEKN+ ++T S   L+  +++ EK   L+ T
Sbjct: 302  -IKNISIEEIDDKFYEM----FPLDFITKLEKNMVRSTNSINKLNGKNSFNEKSENLIAT 356

Query: 356  LQILSKPVKRVG--------GYQVPITADTLVSLFILLIKRTKMK--NIRCHLYYLQNFH 405
            LQIL+     +G        G    I ADTL++L IL+I R+++   +++ +++YL+ F+
Sbjct: 357  LQILTNMDNPIGELNQENEKGANNLIDADTLINLLILIICRSEINIVDLKRNIFYLKKFN 416

Query: 406  QDENSIKFGLLGYAISTLEAVICYLETI-ETDKERL--DCIEKNDANLEEFLTLLTRSKC 462
             DEN I FG+L Y IST E VI   E I E DK +   + IEK    L +   L    K 
Sbjct: 417  YDENLINFGILSYTISTFEIVIYSFENIVEYDKLKSYSEIIEK----LIKVDDLKKVPKT 472

Query: 463  VSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQT 522
            +        K+     +R+  G S L  CI N + + F +LL + YE  F+ +++L+D  
Sbjct: 473  I--------KWEQFLTFRSDTGESILFSCITNNQTEKFLDLLVD-YEEIFSMDNILDDAN 523

Query: 523  TEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLL 582
             EGTTLLMQ+L + N +I+  L +++L+N + +++  Y  K DK+ RN+GHY+  +  +L
Sbjct: 524  VEGTTLLMQALIYRNFKISMVLINLLLRNCSNKQIMEYINKIDKFNRNVGHYLINELEIL 583

Query: 583  QKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDH 642
            + IGKY+ W  +D  G+TPL  IFR YDQ  YD ++ T F I + WY+     KF   DH
Sbjct: 584  KIIGKYVNWKQRDLVGRTPLFTIFRGYDQPNYDEVISTVFDITLNWYAE-NGLKFQMSDH 642

Query: 643  TDSKGNTLLHIIKCNISFLLQSP-----DVDINKVNSQGLSPLTNNAMYDRGENVEALLK 697
             D K N++LHI++ NI  L         ++DINK N +G +PL     Y R  NV+ +L 
Sbjct: 643  YDLKDNSILHILRSNIDILFTYSKRNHFEIDINKRNYKGFTPLMIYVKYHRLSNVKLILG 702

Query: 698  DPRLIF---------SSFDFLKQYPNTKSAPILSHYCLDNEAPFRNIIASHFDFRISNKR 748
            D RL+F         + FD+     ++  +  L  + L N   F  I       R S   
Sbjct: 703  DDRLLFNRYQRELYTTCFDYA---TDSTISNELGKHALQNNTVFGRIYIHSLKVRSSTNA 759

Query: 749  SVVLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASS 808
            +  LT    +   E  G+   +             +   +  P               ++
Sbjct: 760  TFSLTFPLPDKENE-TGTVNIKVKAIISLLKVIRKKSQISLLPLDRIIKVLVKLTSKENN 818

Query: 809  RSLMKSSFCSK---VLKKLTYCLDSMVEMEL------LPTAALQSVALLERHIAKEKVTV 859
            + +++     +   +L++LT CLD+++  ++      L T   + +  +     K K  V
Sbjct: 819  KIIVRKIEMLRNQSLLRRLTDCLDTLLFFDIGIDYLSLITDETKLLGWVTNENTKLKHNV 878

Query: 860  DEEKLKRRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXX 919
            +    K   + K ++PE I  I +FLK+ ++ L  +   +  L                 
Sbjct: 879  N----KTHGEKKSLKPEDINIIQSFLKFNVKELYNVLLNVKTLEKLLNFIHLKSIDVKES 934

Query: 920  XNIVCTLGAEVSSKKIGRAMVRY--STIDNKFLGEQSFD--LLVFQIHFFESCLSSIINS 975
                  L   + + +I +A  R     I+ + L  Q ++  L+  ++ F ++C   +  +
Sbjct: 935  RLAFVHLVKSIKNDQIAQATNRSLEPIIEMQSLENQYYNNTLIRDELDFLKACTLILTGN 994

Query: 976  IDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGM--- 1032
            I+ +L  +IP WWK YG+LLEL+K    +          PN  NN   +   H++ +   
Sbjct: 995  IEDILRTQIPNWWKLYGELLELNKHYNKLFP--------PNHYNNTLATDNQHSAEVSND 1046

Query: 1033 ----GVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSK 1088
                GV G  IE +R K  ++ +  I  L+  L++L NEI   + ++  E   ++ F+  
Sbjct: 1047 VNNGGVFGGLIENQRNKAVKKLKTDIDQLKYSLEILGNEIFRKHEMLAEELNKYMEFKGV 1106

Query: 1089 FIHSAMLEKW 1098
            F   A++  W
Sbjct: 1107 FFKKAIIRNW 1116

>Ecym_3024 Chr3 (46949..50188) [3240 bp, 1079 aa] {ON} similar to
           Ashbya gossypii ACR006C
          Length = 1079

 Score =  381 bits (979), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 241/720 (33%), Positives = 388/720 (53%), Gaps = 36/720 (5%)

Query: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
           +P LLNPLV+AVFNC     SPL+K+++++    FILLVP T  L  Y D ++  PL EL
Sbjct: 5   LPVLLNPLVNAVFNCPTPTTSPLKKLFNNVKGQRFILLVPSTDVLLQYQDLDSGLPLSEL 64

Query: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
           C++ +FV+SHIL +                  V E ++ T NG  +  +   Q+      
Sbjct: 65  CYNYDFVASHILIQLQES-------------KVTEQEYRTLNGNSV--IIRSQAGIVMSK 109

Query: 121 FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
              R  R +  YE L +F +YL     F L++ID+PL+    L++ ++L  F +  ++  
Sbjct: 110 PELRKCR-VKSYEVLRNFNDYLSNVIYFPLLHIDRPLVGA--LVRNDELQVFGSYEMHNP 166

Query: 181 PSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFRKTI 240
             ++++  +S   +P ++   L   + AQ +  F+   Q  R E+ Q +  LI  F+  +
Sbjct: 167 SKSKTINTISENHIPFEKFIRLYPQLGAQLDGYFQRDRQRIRNEVDQLDK-LIKIFKDLV 225

Query: 241 DKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFR 298
             +Y  +  D +F     +  + QEYVE N+Y+D+W  L+  N ++        SS   +
Sbjct: 226 IDVYGVIKEDKNFRNYMELLNVTQEYVELNMYEDIWLKLVQLNGSKEPDRVSGYSST--K 283

Query: 299 FISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQI 358
           +ISL+ + T  Y    + F L+ + ++EK + KAT  F  LS+T+++ EK +++V T QI
Sbjct: 284 YISLNNVATILYPEGTNSFDLRVVTEVEKRVVKATDCFAKLSLTNSHNEKAKIVVSTFQI 343

Query: 359 LSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGY 418
           L+  ++        I ADTL+ L ++++ R+++KN++ HL YL+ F    + +KFGL GY
Sbjct: 344 LTTKMEYTS-IDPTIDADTLIGLMLVVLCRSQVKNLKSHLEYLREFAPRPDDVKFGLTGY 402

Query: 419 AISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFR 478
           ++ST+EAV+ Y E  +  ++    I  ++AN   F  L+     VS     LS Y ++  
Sbjct: 403 SLSTIEAVLAYFEAGDGTEKLKKLISLSEAN-RVFWDLIRSGVAVS-----LSSYKNSLI 456

Query: 479 YRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNH 538
            R+ +  S+LS+CI   + D+  E+L  NY+     EDLL D     +TLL+Q+L+  + 
Sbjct: 457 SRSSNCESSLSICIHAGRLDLIKEILL-NYQEQIKLEDLLFDVNQANSTLLIQALETGHD 515

Query: 539 EITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTG 598
           EI E L D+M+ N T  E Y Y  + +   R + HY+    ++++KIG Y+ W  KD   
Sbjct: 516 EIAELLIDVMISNCTNNEFYEYVNRSNSAGRTVAHYLPQAFSIIEKIGLYLDWRKKDVNM 575

Query: 599 QTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNI 658
            TPL +I R+YDQ  Y  M+  SF    E Y   +   F F DH D  GN+LLHI+K  I
Sbjct: 576 HTPLFIICRAYDQLHYSEMLSRSFEYVFE-YCRRRGEDFSFTDHEDPMGNSLLHIMKGGI 634

Query: 659 SFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFSSFDFLKQYPNTKSA 718
             +L  P++++NK N +G++PL   A Y+R EN+  +L+D RLI S      Q P T  A
Sbjct: 635 QSILSQPNINVNKSNIKGMTPLMLYAKYNRIENIRDILEDKRLIVSKI----QNPQTLKA 690

 Score = 68.2 bits (165), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 54/225 (24%), Positives = 102/225 (45%), Gaps = 22/225 (9%)

Query: 866  RRSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCT 925
            R +KD++++PE + +I +FLK+ L    ++K     LR                  I+  
Sbjct: 835  RANKDERIEPEEVSSIQSFLKFNLSEFSEIKEKFTILRKLVVFQSLKAQDIECAQRIIYQ 894

Query: 926  LGAEVSSKKIGRAMVRYSTIDNKFLGE-QSFDLLVFQ--IHFFESCLSSIINSIDHLLHL 982
               E+ S  +G       +++  F+G  +++ L  FQ  I F   CL ++ + I ++L  
Sbjct: 895  -QMEIVSNSVG------PSVEKTFIGSNENYSLDSFQQAIEFIAMCLETLSSKIQYVLDS 947

Query: 983  KIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGK 1042
            K+  WW+ YG+L        S L RE       N  ++  +S        G   ++IEGK
Sbjct: 948  KVTLWWRLYGEL--------SSLRREYQR----NFPSDFKSSDVSGEESKGFFESYIEGK 995

Query: 1043 RIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQS 1087
            R K +++ +A +     +L+ L  E+  ++  +  E   F+ F++
Sbjct: 996  RQKTEDKLQARLRVCITKLQTLSGELKKDHENLAEEISFFVTFKN 1040

>YML002W Chr13 (264541..266754) [2214 bp, 737 aa] {ON} Putative
            protein of unknown function; expression induced by heat
            and by calcium shortage
          Length = 737

 Score =  352 bits (904), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 240/715 (33%), Positives = 360/715 (50%), Gaps = 43/715 (6%)

Query: 367  GGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAV 426
            G   + + ADTL+SLF+L++ R++ K+++ HLYYLQNF  + +S KFG+LGYA+STLEAV
Sbjct: 11   GLNNMTMDADTLISLFVLVVCRSEQKHLKSHLYYLQNFSNNSSSTKFGILGYAVSTLEAV 70

Query: 427  ICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKC--VSNEGLDLSKYSHNFRYRNGDG 484
            +CY E    +      + K +   E+   LL +  C   +NE  DL+ Y     YRN  G
Sbjct: 71   VCYFEDFNKNTGN---VAKANTLCEKTKNLLDKLSCENPTNEVEDLATYKDILTYRNEQG 127

Query: 485  NSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEITEYL 544
             S LS+CI N KN I  ++LSE YE+ F  EDLLED+T +G+TLL++S++  N E  + L
Sbjct: 128  QSILSICITNHKNYILLDILSE-YENDFPVEDLLEDETIDGSTLLIESIKAGNLEAAKVL 186

Query: 545  TDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQTPLCV 604
              IML N TEEEL  Y  K DKY R + HY+  +  +L+ IG YI W  K+ +GQTPL  
Sbjct: 187  IKIMLFNCTEEELVSYINKTDKYARTVAHYLTHEMDILKSIGNYIDWKRKNSSGQTPLFS 246

Query: 605  IFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISFLLQS 664
            IFRSYDQ  Y+ MV+T+F IA  WY    NS F + DHTD+KGN+LLH++K NI  LLQ 
Sbjct: 247  IFRSYDQPNYEEMVKTAFDIANTWYRK-HNSLFDYLDHTDNKGNSLLHVLKTNIPILLQL 305

Query: 665  PDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLI---------FSSFDFLKQYPNT 715
              +DIN+ N +GL+PL     Y R  N++A+ KD RLI         F+ FD+ K +   
Sbjct: 306  TKLDINEENYKGLTPLMVYVKYKRLSNIDAITKDRRLILEKVQNSTFFTCFDYAKDHS-- 363

Query: 716  KSAPILSHYCLDNEAPFRNIIASHFDFRISNKRSVVLTSR--SKEDAQELIGSEAFEXXX 773
                +LS      E   ++ +     F      ++  T+   S  +A++   +       
Sbjct: 364  ----VLSKI---GERGVKDSLFGLIYFHSLRYHNLNATTNITSVSNAEKPFATTVINMKT 416

Query: 774  XXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTASSRSLMKSSFCSKVLKKLTYCLDSMVE 833
                       +PFTF P            +  S  +++  +  + +L +LT C + ++ 
Sbjct: 417  IQGLLRSILKDNPFTFLPLNTYIDEISHLNR--SDLTIIGKTDVTSLLHQLTNCFNVLLF 474

Query: 834  MELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITTFLKYILESLL 893
            ++ +P       A +  +  +   +   +K   +   K M+PE I  I +FL++  + + 
Sbjct: 475  LKKIPENLFTDEASI-LYWMRINTSKRNQKPSGKENPKTMEPEEINMIQSFLRFNFDEIS 533

Query: 894  KLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVRYSTIDNKFLGEQ 953
              K ++  LR                   +  +G ++ + +   A     T  N F  E 
Sbjct: 534  SFKASLNILRKVLIFINLKSDDFEDAYKGLNEMGRKLINSEASSAFKGIITNHNMF-SEL 592

Query: 954  SFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQ 1013
            S   L+  + F E C   + + +  +L  KIP WWK YG+ L L K         S  K 
Sbjct: 593  SLAALLENVRFLEQCTIQLSSFVQIILFEKIPNWWKHYGEFLALHK---------SYRKA 643

Query: 1014 TPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEI 1068
             PN    V   +   TS    LG FIE KR ++++R    I    + LK L +EI
Sbjct: 644  FPNM---VKPKSASDTSSRAPLGGFIETKREQSEQRLAVQIKASSKMLKELGSEI 695

>TPHA0J00330 Chr10 (72684..76007) [3324 bp, 1107 aa] {ON} Anc_6.20
           YML002W
          Length = 1107

 Score =  353 bits (906), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 247/723 (34%), Positives = 381/723 (52%), Gaps = 49/723 (6%)

Query: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
           MP L NPL++AVFNC D  ASP +K+Y+ L D  F+LLVP  F L YY D  +     EL
Sbjct: 5   MPVLKNPLINAVFNCPDPHASPFKKLYNELRDKDFLLLVPNDFILLYYKDSTSNISFREL 64

Query: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSL-YTTD 119
           C++ +FV++HIL       N   D   S  +   +    + NGK    +  +QSL     
Sbjct: 65  CYTYDFVAAHILIL---DKNSSTDKISSSNQKNGDVYLKSLNGK---EVLLRQSLCIPIK 118

Query: 120 GFSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPN---LT 176
           G+  +   ++     L +F +YL GS  F +++ID PL  ++  L  ++L  F     L 
Sbjct: 119 GYFSKRKSQMRDATLLTNFNDYLHGSGHFGIMHIDYPLGVSDWTL-IDELKGFEESRELP 177

Query: 177 INTTPSTRSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPG- 235
            ++    +      + E    R   +  +   + +W      + Y K+    E +   G 
Sbjct: 178 FHSQDKDKPGLLQRTEENKADRVKFI-QLFQERKDWTIE--LEKYLKKYQAMEPLQNIGS 234

Query: 236 --FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQS 291
             F   ++ IY+ L  +  F     +  +  EY+E  +Y D+W  L      E  ++K  
Sbjct: 235 ELFHDIVNMIYNTLKEEQRFQRFTNLYDIAYEYIESLLYQDIWNKL-----QEHYRDKIL 289

Query: 292 ESSDIFRFIS---LDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEK 348
           +    FR +S   LD LDT FY   F  F L DIV +E  + +A   F+ +   ++Y +K
Sbjct: 290 D----FRLVSQLSLDMLDTTFYNRTFKNFQLIDIVNMEACMVQAVSVFKGIKSANSYSKK 345

Query: 349 CRVLVETLQILS-----KPVKRVGGYQVP-ITADTLVSLFILLIKRTKMKNIRCHLYYLQ 402
             V+ +TL I++       ++     ++P I ADTLVSLF LL+ R  ++++  H+ YLQ
Sbjct: 346 VDVIFKTLNIITGKNSDDTIRDNTLPKLPLIDADTLVSLFALLLCRAGVEDVFLHVQYLQ 405

Query: 403 NFHQDENSIKFGLLGYAISTLEAVICYL-ETIETDKERLDCIEKNDANLEEFLTLLTRSK 461
           +F++DEN++KFG LGY +ST+EA + Y  E   +D+ R+    +  + LE+FL    + +
Sbjct: 406 SFYKDENTVKFGALGYTLSTIEATLSYFYELSNSDESRIQL--QKLSLLEDFLI---KIR 460

Query: 462 CVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQ 521
              ++ + ++++   FRYR   G S LSL I N KN+   E L  N+E  F  +DLL D 
Sbjct: 461 SQHDDLIPINQFKDYFRYRTQYGESILSLLIANKKNEALCEALL-NFEDIFPLDDLLYDT 519

Query: 522 TTEGTTLLMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTL 581
              G+TLL++ L+  N E  E L +I   + T  EL  Y  K DK KR + HYI  +  +
Sbjct: 520 DVSGSTLLIKCLKERNLEAAEILIEIFQNSCTNSELLNYYNKTDKTKRTLAHYITDEIEI 579

Query: 582 LQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFR- 640
           L+KIGKYI W  KD  G+T L  IFRSYDQ  Y   ++ +   A+ WY   KN+   F+ 
Sbjct: 580 LEKIGKYINWTLKDLKGRTALFTIFRSYDQTTYSSTIKIALDQALLWY---KNNDIIFKV 636

Query: 641 -DHTDSKGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDP 699
            DHTD  G++LLHI+K  +S LL+  D+DIN  N +G++PL     Y+R +N++ +L+D 
Sbjct: 637 SDHTDLFGDSLLHILKSQVSLLLKFEDLDINIPNLKGMTPLMTYVKYNRIDNIKTILEDG 696

Query: 700 RLI 702
           RLI
Sbjct: 697 RLI 699

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 59/276 (21%), Positives = 113/276 (40%), Gaps = 13/276 (4%)

Query: 824  LTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLKRRSKDKKMQPESIGTITT 883
            L++ L +++  E +    L    L+ + I+  K+   E+ +   S  K +  E I  I  
Sbjct: 821  LSHGLSALLYFEKIDPLTLLDENLIIKWIS-SKLQQQEKSIDDHSSFKPLSAEDINNIKA 879

Query: 884  FLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVRYS 943
            F  +  + + K    I                     +I+  LG+  S+ +I R +    
Sbjct: 880  FCDFSFQEIGKTNNVIQSFLKLSIFGEIKNTDLNTSYDILERLGSYFSNNEISRTLGDLQ 939

Query: 944  TIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPS 1003
            +I         +  L   I F + C   + + +   +  K+  W K   +LLE  KE  S
Sbjct: 940  SISPHVHSSMVYYELSQDILFMKKCTLILTSKLASFIKDKLSIWLKKNTKLLEHRKE-YS 998

Query: 1004 VLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKL 1063
            +   +S+ ++T N S N  TS   +   +          R + + R + A+ +L+R LK 
Sbjct: 999  IKFLQSN-EETGNLSEN--TSVFRYAWNVTY--------RKEEERRLKFAMLELERDLKK 1047

Query: 1064 LDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
            L  EI   +  +  E+  ++  +SKF  + ++ K+V
Sbjct: 1048 LGTEIRVKHEELAEEFSDYVRMKSKFNSNLLVRKFV 1083

>NDAI0D00800 Chr4 (177862..181443) [3582 bp, 1193 aa] {ON} Anc_6.20
            YML002W
          Length = 1193

 Score =  346 bits (888), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 309/1100 (28%), Positives = 517/1100 (47%), Gaps = 129/1100 (11%)

Query: 11   AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELC-HSPEFVSS 69
            AVFNC D   SP +K++++L +  FILLVPPT  L  Y D   K  L+ELC H+ +F+ S
Sbjct: 16   AVFNCPDPSHSPFKKLFTTLKNQQFILLVPPTSTLLNYTDSYYKLSLNELCYHNSDFLGS 75

Query: 70   HILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDGFSFRSTRRI 129
            HILT  +      ID++        + +F   NG      +    ++T   FS     +I
Sbjct: 76   HILTWSNA-----IDSNKDSTTTNDDEEFDNLNGNKFIIKWKHNIIFTRGNFSNDQRFKI 130

Query: 130  LKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCF-PNL-----TINTTPST 183
            LK   L +F +Y  GS  F LI+ID+P I  + L+  + L C  PN          TP  
Sbjct: 131  LKIHPLTNFNDYFHGSKEFFLIFIDKP-ITVSSLIANDSLKCLLPNTRDLKSQEKETPLV 189

Query: 184  RSLANLSSAEVPPQRNPLLNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPG---FRKTI 240
            + L+  S +      N       +  +N KF  +  NY+ E ++ E    P    FR+ +
Sbjct: 190  QDLSQQSKSSFENDLNK------NEAWNLKFGILSNNYKIESSELE----PNHKLFRELV 239

Query: 241  DKIYDGLDNSFH-------TIPTIRQLIQEYVEQNVYDDVW----QVLIN--RNNAEGEK 287
            ++ +  +D+          T   + QL  +Y+E+++YD++W    ++++N  +N A+ +K
Sbjct: 240  NEAFIEIDSKKFFQKKKNFTSDQLFQLTHDYMERHLYDEIWSRIWKMMMNSVKNYADDQK 299

Query: 288  EKQSESSDIFRFISLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVE 347
             +      + +  S+ ++D +FY      F LK +  LEKN+  +      L  T +Y E
Sbjct: 300  AQH-----LIKHFSIVEIDPNFYDI----FPLKFVPMLEKNLKHSVTCINKLKSTKSYTE 350

Query: 348  KCRVLVETLQILSKPV--------KRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLY 399
            K  +L+E+LQI++           K   GY +       +   ++L     + +++ +LY
Sbjct: 351  KSTILIESLQIITDSNTGGEESKDKNKSGYLIDADNLLNLLTLVILQSNITLHDLKANLY 410

Query: 400  YLQNFHQDENSIKFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLT--LL 457
            YL+ F  DE+S  FG+L Y I+T   V   LE +  D +RL   EK+D   E  +T  L 
Sbjct: 411  YLKYFSTDESSSSFGILNYTIATFHMVSHVLENV-IDWDRLK--EKSDLIEELIMTDDLS 467

Query: 458  TRSKCVSNEGLDLSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDL 517
            T S    N+   L        YRN +G S L+L IIN +N  F + L E YE     + +
Sbjct: 468  TLSSTFENDKKTL------LMYRNSNGESLLALSIINKQNKKFTQYLIE-YEDILNMDII 520

Query: 518  LEDQTTEGTTLLMQSLQHSNHEITEYLTDIMLKN-STEEELYYYCGKRDKYKRNIGHYIC 576
              DQ+ + +TLL+Q+++ +N E    L  ++ +N   ++EL  Y  + D + RNIGHY+ 
Sbjct: 521  SNDQSMDSSTLLLQAIRSNNFEAAIILVKLLFQNCRNQKELISYINQVDIHNRNIGHYLV 580

Query: 577  GQQTLLQKIGKYIKWDSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSK 636
               T+L+ IG++I W  KD  G+TPL  IFRSYDQ+ YD +V   F IA++WY+   N K
Sbjct: 581  INLTILKIIGQFINWKQKDVNGRTPLFTIFRSYDQSNYDELVCQVFQIAIKWYA-ANNLK 639

Query: 637  FCFRDHTDSKGNTLLHIIKCNISFLL-----QSPDVDINKVNSQGLSPLTNNAMYDRGEN 691
            F   DH DS GN+LLHI++ NIS LL     Q+  +++NK+N +G +PL     Y R +N
Sbjct: 640  FQMNDHDDSNGNSLLHILQNNISILLDYAKDQNIPINLNKMNCKGFTPLMMYFKYKRYDN 699

Query: 692  VEALLKDPRLIFSSF---DFLKQYPNTKSAPILS---HYCLDNEAPFRNIIASHFDFRIS 745
            +  ++K+ +LIF+ F   +F+  +  +  + I++    + L N   F  II      ++S
Sbjct: 700  IRMIIKEEKLIFNKFQSPNFIDCFDYSVDSSIMNDIGEFLLSNGQLFGKIIVLSLKKQMS 759

Query: 746  NKRSV-----VLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXX 800
               S+     +  +   ++A +   ++  +             ++  +F P         
Sbjct: 760  TVPSLPRGLYINYTILIDEADKSTLTKTMKFTSLVKFLKIMKRKYAISFLPLDTLLNESQ 819

Query: 801  X--XXKTASSRSL-------MKSSFCSKVLKKLTYCLDSMVEMELLPTAALQSVALLERH 851
                 K+ ++ +L       ++     + LK+L  CLD ++  +    + + +  LL   
Sbjct: 820  SFLDKKSKNNNNLRTIPLRYIEKLRIRRFLKRLNTCLDVLLHFD---DSTIATPLLLSET 876

Query: 852  IAKEKVTVDEEKLKRRSKDKKMQPE----------------SIGTITTFLKYILESLLKL 895
               E ++++E KL+R S     + +                +I  I  FLK+ L  L  +
Sbjct: 877  ELLEWISIEESKLRRSSTTPSAKSKLENAMGEKKKKELKPENINIIQNFLKFNLNELNTI 936

Query: 896  KGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVSSKKIGRAMVR-YSTIDNKFLGEQS 954
               +  L                       L   +++K++   + + ++ ID+    +  
Sbjct: 937  SMNLKVLSKLVIFMNLKTLDIHDAQIRFNGLVKGLNNKEVPSIIEKSFNVIDSSRYDDDK 996

Query: 955  FDLLVF---QIHFFESCLSSIINSIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDH 1011
              LL      I FF  C   +I+ +++++ +KIP WWK YG+LLEL+K           H
Sbjct: 997  GVLLESLHEDISFFNECTLKLIHDVENIIKIKIPNWWKLYGELLELNK---------YYH 1047

Query: 1012 KQTPNASNNVGTSTTDHTSG 1031
            K  PN    V    TD  SG
Sbjct: 1048 KNFPNCV--VHARRTDLLSG 1065

>KLLA0D01133g Chr4 (101580..104783) [3204 bp, 1067 aa] {ON} some
           similarities with uniprot|Q04257 Saccharomyces
           cerevisiae YML002W and some similarities with
           uniprot|Q04257 Saccharomyces cerevisiae YML003W
           Hypothetical ORF
          Length = 1067

 Score =  335 bits (858), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 231/726 (31%), Positives = 370/726 (50%), Gaps = 52/726 (7%)

Query: 11  AVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHELCHSPEFVSSH 70
           A+FNC   + S L++++S L D  F +LVP T  L  + D  +   L ELC+  +FV+SH
Sbjct: 15  AIFNCPSPKTSSLKQMFSRLDDERFFILVPSTETLLQFQDLESGLELAELCYHYDFVASH 74

Query: 71  ILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDGFSFRSTRRIL 130
           I+        K    D+   R++    F T NG+ ++  +   ++ T DGF+ R    I 
Sbjct: 75  IVVI------KDPTKDVPDQRSIYNTDFTTLNGRKLSIRYRNSTIVTGDGFTERRKITIK 128

Query: 131 KYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTTPSTRSLANLS 190
           +   L  F +YL+GS+   +++I  PL        C DL     L + +  +    +   
Sbjct: 129 EINLLPTFNDYLKGSNYTPILHISMPL--------CGDLVPLDELQVFSKVAGNKYSKQE 180

Query: 191 SAEVP---PQRNPL-LNSMIHAQYNWKFRAVFQNYRKEITQSESMLIPGFR----KTIDK 242
            A +P    Q+  L     I +  +   R     +  +    +++ + G R     T D 
Sbjct: 181 QAPLPFDEEQKKVLYFEQRIQSISDVAERVALTFHLTKARIKKAISVIGIRTEWLNTRDS 240

Query: 243 IYD--GLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRFI 300
           I     LD   + +  +  +I +YVE  ++ D+ Q L      E ++ +        R I
Sbjct: 241 IRQIISLDKRLNHLEDLDAMIYDYVELKLFTDIQQQL--SEIVEDQELEHRFDFKALRSI 298

Query: 301 SLDQLDTDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLVETLQILS 360
           SL+Q+ T+FY      F L  +V+LEK+++ A +  +++ +  T+  K  VL  T+++LS
Sbjct: 299 SLNQVPTNFYPKDEKSFSLASVVELEKSVNDALEYLKSIDLKTTHSGKLEVLSTTMRLLS 358

Query: 361 KPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAI 420
           + +  +        ADTL+SLF+LLI R+++  +   L YL NF   E SIKFGL GY +
Sbjct: 359 REINGIST-----DADTLLSLFVLLICRSQVTGLVRTLTYLTNFEISETSIKFGLQGYVL 413

Query: 421 STLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKYSHNFRYR 480
           ST EA + +       ++ +D + K  A+ ++    + +   V  E L     S N R R
Sbjct: 414 STFEAALSFFH-----QDTVDSLTKKCASNKKIWASIQKHSKVEAELL-----SSNLRIR 463

Query: 481 NGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQHSNHEI 540
              G S LS+CI +  N++   LL+ N+ES F  ED+L+D+    +TLL+Q+LQ  N + 
Sbjct: 464 TDSGESLLSICIQSHNNEVLTTLLA-NFESEFPLEDILDDRDFALSTLLIQALQVQNSQA 522

Query: 541 TEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKYIKWDSKDCTGQT 600
              L++I+LK+ TE E+  Y    + + R   HYI    +LL+ +G+Y  W+ KD  G T
Sbjct: 523 AAILSEIILKSCTESEVRSYLNSPNLHNRITAHYIMQDISLLESVGRYFNWEHKDINGHT 582

Query: 601 PLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLLHIIKCNISF 660
           PL  +FRSYD   YD +V       V+WY+   N  F F+ H D KGNTLLH++K  I  
Sbjct: 583 PLFAVFRSYDAVNYDEIVTKVLDQVVKWYAN-NNKPFNFKIHEDPKGNTLLHVMKSGIES 641

Query: 661 LLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALLKDPR---------LIFSSFDFLKQ 711
           LL+ PDV++NK +S+GL+PL   + Y+R  N+E ++KD R         L+ +S DF K 
Sbjct: 642 LLKLPDVNVNKPDSKGLTPLMIYSRYNRITNIETIMKDERLLCDLVQQPLVMTSLDFTKN 701

Query: 712 YPNTKS 717
              TK+
Sbjct: 702 PKVTKT 707

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 56/228 (24%), Positives = 102/228 (44%), Gaps = 19/228 (8%)

Query: 872  KMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEVS 931
            K++PE I  I TFLKY L    KL+  +I L+                 N   +LG ++S
Sbjct: 837  KLEPEEINGIQTFLKYNLAEFQKLRNCLIILKKLAIVQQIKHRDVITMRNSFLSLGNQMS 896

Query: 932  SKKIGRAMVRYSTIDNKFLGEQSFDLLVFQIHFFESCLSSIINSIDHLLHLKIPEWWKCY 991
             K + ++   +   +  +  + S+      + + E  + +++N+ + LL  K   WWK +
Sbjct: 897  QKGVAKS---FENTNCAWSYDLSYYEFTRNLEYLEHSVVTLLNNFESLLA-KTTLWWKHF 952

Query: 992  GQLLELSKEDPSVLARESDHKQTPNASNNVGTSTTDHTSGMGVLGTFIEGKRIKNQERTR 1051
            G+L+EL KE       +   K  P+++N               + T+IEGKR K + +  
Sbjct: 953  GELMELKKEWKKNFPND---KAPPSSANR------------NFIDTYIEGKRSKFRNKLS 997

Query: 1052 AAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSKFIHSAMLEKWV 1099
              +      LK +  EI T +  + +   +FI F+ +F H  +++  V
Sbjct: 998  NQLKMSSLNLKKIGGEIKTTHESIAVGINLFIEFKEQFYHDHIVKSIV 1045

>TBLA0A07260 Chr1 (1807831..1811445) [3615 bp, 1204 aa] {ON}
           Anc_6.20 YML002W
          Length = 1204

 Score =  283 bits (724), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 242/777 (31%), Positives = 387/777 (49%), Gaps = 122/777 (15%)

Query: 3   ELLNPLVDAVFNCQ--DVEASPLRKVYSSLHDIPFILLVPPTFALWYYDD---------- 50
           ++LNPL++ +F+ +  D    PL+K++  L  + F+LL PPT  L  Y D          
Sbjct: 4   DILNPLIEVLFHSEGTDTLNGPLKKLFEKLKLLKFVLLAPPTDILLNYLDSSNITPRNPY 63

Query: 51  --RNTKFPLHELC-HSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVR----EAKFCTFNG 103
              N K PL +LC +S +F++SHIL      D+K I  D   + ++       K  T NG
Sbjct: 64  NGSNAK-PLEDLCMNSYDFIASHILLY----DSKVIKNDQCVMESINGKTITIKRVTGNG 118

Query: 104 KIINGLFSKQSLYTTDGFSFRSTRRILKYETLD---HFQNYLQGSSTFILIYIDQPL--- 157
            + NG    + L  T   ++ + +++LK   +D   +F +YLQG   + + YID PL   
Sbjct: 119 ALNNG----EMLVITPSKNYNTPKKMLKIIKMDLWHNFNSYLQGMENYPIWYIDYPLYPN 174

Query: 158 IDTNRLLKCED---------------LDCFPNLTINTTPSTRSLANLSSAEVPPQRNPLL 202
           I  N  L   D               ++   N T +     R+++ L        R    
Sbjct: 175 IIKNEFLTAFDRKLIETEQYSDIAQPVNDLENTTKDQNHKIRNISKLEPDISQSDRGGFT 234

Query: 203 NSMIHAQYNWKFRAVFQNYR---KEITQSESMLIPGFRKTIDK----------------I 243
             +   +  W  + +  +YR   K I Q+E     G  + ID+                +
Sbjct: 235 KLIKDDRVIW--QPLINSYRATTKHIEQAE-----GLPQAIDENQTDVNIEMVRDINCDL 287

Query: 244 YDGLDN----SFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDIFRF 299
           ++ L +    +F +   + +LI E++E  ++DD+W          G    +   SD F F
Sbjct: 288 FEQLKDEKRYNFLSHDNLMELIYEFIEIKLHDDIW----------GRISFKFTESD-FDF 336

Query: 300 -----ISLDQLDTDFYKA-KFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRVLV 353
                IS+++L  +FY    F  F L DIV +EK IS+A   F+      T+ EK   L+
Sbjct: 337 SKLSNISVNKLLLNFYSTNNFKNFKLHDIVMMEKKISRAVTYFQKFINGITFQEKSTALI 396

Query: 354 ETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKF 413
           +TLQIL+  + ++        ADTL+ L  ++I R K++N++ HL+YLQNF  D N+IKF
Sbjct: 397 KTLQILT--INKLTD------ADTLIGLLSIVICRLKVRNLKSHLFYLQNFAADPNTIKF 448

Query: 414 GLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEFLTLLTRSKCVSNEGLDLSKY 473
           G+LGY+ISTLEA+  Y + I +   + D I   D     + T+L   K + N+ L     
Sbjct: 449 GILGYSISTLEAITYYFDHI-SHSHKADLIAFCDKLHNLYDTILNNIKSLDNDIL----- 502

Query: 474 SHNFRYRNGDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSL 533
                YR+ +G S LSLCIIN K DIF ELL+  YE  F  ED+L+D    G++LLMQ+ 
Sbjct: 503 ----SYRSQNGESLLSLCIINNKMDIFLELLTT-YEHSFPIEDILDDSDLNGSSLLMQAC 557

Query: 534 QHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQT--LLQKIGKYIKW 591
           +++N+  +E L  I+  +  EEEL  +  K DK+ R++ HY   + +  +L + G  I W
Sbjct: 558 KYNNYVASEILVTILKNSCNEEELRIFLNKTDKFNRSVAHYFNMKNSILILTEFGNLIDW 617

Query: 592 DSKDCTGQTPLCVIFRSYDQAFYDVMVETSFAIAVEWYSTVKNSKFCFRDHTDSKGNTLL 651
           + KD    TPL  IF+ +   + +  ++  F + + WY  + N  F  + H D  GN LL
Sbjct: 618 ELKDIKKLTPLLTIFKVHKVNYNESFIKILFRVVLTWYK-IHNKPFNLKAHVDQNGNNLL 676

Query: 652 HIIKCNISFLLQSPD----VDINKVNSQGLSPLTNNAMYDRGENVEALLKDPRLIFS 704
           H++K  I+ L+++P+    ++IN  N++GLSP       +R +N+  +LK+P LI S
Sbjct: 677 HVMKDYINCLIENPELCETININANNNKGLSPFMVYFKTNRYDNIRIILKNPTLITS 733

 Score = 37.7 bits (86), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 57/248 (22%), Positives = 90/248 (36%), Gaps = 39/248 (15%)

Query: 871  KKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVCTLGAEV 930
            K  QPE I  I TF+K+ L  L   K TI  ++                         ++
Sbjct: 940  KAYQPEDINAIQTFIKFNLGELENFKNTITTIKDVSILIKYKIMDLNSSQFFFQKNTLKI 999

Query: 931  SSKKIGRAMVRYST----IDN-----KFLGEQSFDL-------LVFQIHFFESCLSSIIN 974
                +   +  YST    I N     KF    S+D        L+  + FFE  +  +  
Sbjct: 1000 GINNLSEILKYYSTQKPLITNAYTSRKFYDYNSYDYKVEFLNKLLENLIFFEKLVCKLYY 1059

Query: 975  SIDHLLHLKIPEWWKCYGQLLELSKEDPSVLARESDHKQTPN----ASNNVGTSTT--DH 1028
              + L +  I  WW  YG+LL+   +          +K  PN     +NN  +  T  D 
Sbjct: 1060 DFEDLSNGTIKTWWYHYGRLLDYEAQ---------YNKHYPNRKIDINNNFESFNTMFDK 1110

Query: 1029 TSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQSK 1088
                  +  F E   I N + T   +     ++K L   +        IE   F+NF++K
Sbjct: 1111 RVNFDSITHF-ERNIILNIKNTSTLLRRFNNKIKFLHENL-------AIELNNFMNFKNK 1162

Query: 1089 FIHSAMLE 1096
            FI   +++
Sbjct: 1163 FIREYIIK 1170

>KAFR0L00400 Chr12 (72520..75348) [2829 bp, 942 aa] {ON} Anc_6.20
            YML002W
          Length = 942

 Score =  235 bits (600), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 252/909 (27%), Positives = 397/909 (43%), Gaps = 176/909 (19%)

Query: 237  RKTIDKIYDGLDNSFHTIPTIRQLIQEYVEQNVYDDVWQVLINRNNAEGEKEKQSESSDI 296
            +K+I  +  G++N   ++P    +  +  E  +Y  +W  L+          + SE  +I
Sbjct: 152  QKSITDVVFGINNVIKSLPDENSV--KIFEARLYSSIWNKLV---------HQTSEPQNI 200

Query: 297  FRF----ISLDQLD-TDFYKAKFSKFYLKDIVQLEKNISKATKSFENLSVTHTYVEKCRV 351
             +F    IS  +L+  D+Y   F+KF L+D+V +E  +  A K F  L  + ++ EK  +
Sbjct: 201  DKFYGCYISFHELNINDYYSLPFNKFSLRDVVFIENVVDLACKEFVKLRESLSFDEKIDI 260

Query: 352  LVETLQILSKPVKRVGGYQVPITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSI 411
            L+ T  IL+  +      Q+ I AD L++  +++I R K+ N+  H +YLQNF+  +N  
Sbjct: 261  LLSTFNILTSKLP-----QLEIDADNLLNFMLIIINRVKLNNLNEHFHYLQNFNFKQNK- 314

Query: 412  KFGLLGYAISTLEAVICYLETIETDKERLDCIEKNDANLEEF--LTLLTRSKCVSNEGLD 469
             FG+L YAISTL AV+ Y+                D NL++F   T   +   +S E L 
Sbjct: 315  DFGILNYAISTLGAVLYYI----------------DNNLDKFKRYTDAIQDSKISEEKL- 357

Query: 470  LSKYSHNFRYRNGDGNSTLSLCIINFKNDIFFELL-SENYESYFAFEDLLEDQTTEGTTL 528
                    +YRN +G S L  CII   ND   ELL S  Y   F  ED+L+DQT +G+TL
Sbjct: 358  --------KYRNENGESYLCHCIITKDNDTLRELLFSSEYIKNFPMEDILDDQTIDGSTL 409

Query: 529  LMQSLQHSNHEITEYLTDIMLKNSTEEELYYYCGKRDKYKRNIGHYICGQQTLLQKIGKY 588
            LM +++  N      L +I++ N T +E+  Y    D+  RN+GH+I  Q  LL KIG Y
Sbjct: 410  LMVAVKCLNTTAASILINIIINNGTPDEIRTYVNSVDENNRNVGHFITNQYYLLCKIGPY 469

Query: 589  IKWDSKDC-TGQTPLCVIFRSYDQAF--YDVMVETSFAIAVEWYSTVKNSKFCFRDHTDS 645
            + W+ KD  TGQTPL  IFRSYDQ+   Y  M   SF  A++      +  F  + H D+
Sbjct: 470  LNWNCKDKRTGQTPLFNIFRSYDQSIKSYKKMSRRSFRFAMD------SGDFQLKKHIDN 523

Query: 646  KGNTLLHIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAMYDRGENVEALL----KDPRL 701
              NTLLHI+K NI  +L    + IN  NS G++PL     Y R  N++ LL    KD   
Sbjct: 524  SNNTLLHILKTNIQMILPHASLFINSPNSLGMTPLMVFCKYRRLYNIQILLSSKFKDRVS 583

Query: 702  IFSSFDFLKQYPNTKSAP-------ILSHYCLDNEAPFRNIIASHFDFRI-------SNK 747
            IF +      + N  S         +L  + + N + F N         +        N+
Sbjct: 584  IFETQQVHNAWSNCFSLTNDDQILNLLGKFAIKNYSIFGNCFTHSLKQFLHKSKHGNKNQ 643

Query: 748  RSVVLTSRSKEDAQELIGSEAFEXXXXXXXXXXXXXQHPFTFFPXXXXXXXXXXXXKTAS 807
             SV +T + ++  + +  +   +              H  +F P               S
Sbjct: 644  YSVKITLKFEKKYKTIRFN--IKTIKALINMVLTSNSHVSSFLPLYKVFNELNGIASMIS 701

Query: 808  SRSLMKSSFCSKVL--KKLTYCLDSMVEMELLPTAALQSVALLERHIAKEKVTVDEEKLK 865
            ++        SK+L    L   LD+++ +EL+P       A L+ ++  ++      K+K
Sbjct: 702  TK--------SKILFINNLNVILDTILFLELVPREGFILEARLKDYLRNQR------KIK 747

Query: 866  R-RSKDKKMQPESIGTITTFLKYILESLLKLKGTIIELRXXXXXXXXXXXXXXXXXNIVC 924
               +K KK+Q E I  I+ FLK+ L  L   K                        N V 
Sbjct: 748  TVATKSKKLQIEDINMISNFLKFNLNELNAFK------------------------NGVK 783

Query: 925  TLGAEVSSKKIGRAMVRYSTID-----------NKFLGEQSFDLLVFQIHFFESCLSSII 973
             +  +++S  +     R S +D           N  L   ++++L+      E       
Sbjct: 784  KILRQMNSINLKLFDQRISYMDLLHCPDVVVHLNNPLWNLNYNILISNFQILE------- 836

Query: 974  NSIDHLLHL-------KIPEWWKCYGQLLELSKEDPSVLARESDHKQTPNASNNVGTSTT 1026
            NSID+ LH        KI +WWK   +L+ L+K     LA  SD                
Sbjct: 837  NSIDNTLHFLKVFQNEKIRKWWKLNNELINLTK-----LASNSDD--------------- 876

Query: 1027 DHTSGMGVLGTFIEGKRIKNQERTRAAISDLQRRLKLLDNEIDTNNTLVVIEYCIFINFQ 1086
                   +L +F   K     E+    I D  R +  L+ +I  ++ L+ +E   F+ F+
Sbjct: 877  ------DLLRSFFNRK-----EKLSIEIDDKIRSINELNCDIFVSHELLAVEINNFMKFK 925

Query: 1087 SKFIHSAML 1095
              FI   ++
Sbjct: 926  PLFITRTLV 934

>YML003W Chr13 (263483..264355) [873 bp, 290 aa] {OFF} Putative
           protein of unknown function
          Length = 290

 Score =  142 bits (358), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 92/287 (32%), Positives = 152/287 (52%), Gaps = 30/287 (10%)

Query: 1   MPELLNPLVDAVFNCQDVEASPLRKVYSSLHDIPFILLVPPTFALWYYDDRNTKFPLHEL 60
           +P LLNPLV+A+FNC + E SPL+K++++L    FILL PP+  L  Y D  +K PLH+L
Sbjct: 6   LPTLLNPLVNAIFNCPEPERSPLKKLFANLKTRRFILLAPPSEYLLNYHDVKSKLPLHDL 65

Query: 61  CHSPEFVSSHILTRYSGKDNKPIDTDLSRLRAVREAKFCTFNGKIINGLFSKQSLYTTDG 120
           C++ EF++S+IL      +N  I+T+       R++ + T +GK +   +    ++  +G
Sbjct: 66  CYNAEFINSYILLM---TENSYINTN------SRDSHYETLDGKTVVIQWKNNVIHALNG 116

Query: 121 FSFRSTRRILKYETLDHFQNYLQGSSTFILIYIDQPLIDTNRLLKCEDLDCFPNLTINTT 180
           F  R   +IL+ + L +F +Y +G++ FI+++IDQPL      +  + L CF N      
Sbjct: 117 FHIRRRLKILETKILPNFNDYFEGAADFIILFIDQPL--NCEFVPNDYLQCFHNYE-KIP 173

Query: 181 PSTRSLANLSSAEVPPQRNPLLNSM-IHAQYNWKFRAVFQNYRKEITQSESMLIPG---- 235
            +  ++ NLS      +R+   N + IH     +   +F +YR         L PG    
Sbjct: 174 KNAHAMPNLSIDSFQQERSSFENILHIHPARLTQLGQLFSSYRT--------LAPGDDPS 225

Query: 236 ---FRKTIDKIYDGL--DNSFHTIPTIRQLIQEYVEQNVYDDVWQVL 277
              F   + + +DG+  D+ F     +  LI +Y E N+YDD+W  L
Sbjct: 226 RSIFESIVQQAFDGMKSDSLFKNFSNLYDLIHDYFELNLYDDIWSRL 272

>ACR224C Chr3 complement(744590..748477) [3888 bp, 1295 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL036W
           (RPO41)
          Length = 1295

 Score = 34.7 bits (78), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 1/67 (1%)

Query: 627 EWYSTVKNSKFCFRDHTDSKGNTLL-HIIKCNISFLLQSPDVDINKVNSQGLSPLTNNAM 685
           E+   V+ +K  FR+    +   L  H IK  +  LL S  + + KVN +G+ P+TN  +
Sbjct: 515 EFKKLVQRAKTTFRNTQIEESKVLWPHNIKAKVGSLLISMLIHVAKVNVKGVDPVTNKTV 574

Query: 686 YDRGENV 692
           Y +   +
Sbjct: 575 YGKAPAI 581

>CAGL0J00275g Chr10 complement(19390..20301) [912 bp, 303 aa] {ON}
           highly similar to uniprot|Q05636 Saccharomyces
           cerevisiae YDR280w RRP45
          Length = 303

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 44/91 (48%), Gaps = 14/91 (15%)

Query: 482 GDGNSTLSLCIINFKNDIFFELLSENYESYFAFEDLLEDQTTEGTTLLMQSLQ-----HS 536
           GD N+ +S+     K     ELL +   +    ++    Q ++   L M +LQ     H 
Sbjct: 212 GDSNAEISIIDATTKE----ELLRDGVLTVTLNKNREVVQVSKAGGLPMDALQLMQCCHK 267

Query: 537 NHEITEYLTDIMLKNSTEEELYYYCGKRDKY 567
            +EITE LTD++LK     E+ +   KRDKY
Sbjct: 268 AYEITEQLTDMILK-----EVKHDLAKRDKY 293

>NCAS0A02610 Chr1 (496591..499728) [3138 bp, 1045 aa] {ON} Anc_4.274
           YDL077C
          Length = 1045

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 15/68 (22%)

Query: 677 LSPLTNN-----AMYDRGENVEALL---------KDPRLIFSSFDFL-KQYPNTKSAPIL 721
           LS L N+     ++ D  ENV+ L+         KD ++IFS  D+L  QYP++K   +L
Sbjct: 672 LSTLINDTSVSASVPDIKENVKLLMVVYLKKLSNKDLKIIFSYTDWLINQYPDSKEGILL 731

Query: 722 SHYCLDNE 729
           S +C D+E
Sbjct: 732 SIFCNDSE 739

>TDEL0B00450 Chr2 (79835..81169) [1335 bp, 444 aa] {ON} Anc_8.876
           YML097C
          Length = 444

 Score = 32.7 bits (73), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (54%), Gaps = 2/62 (3%)

Query: 375 ADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLETIE 434
           AD+ + L I  I +  ++ +  ++ Y++ F  +E     G   Y +++LEA I Y+ T+E
Sbjct: 237 ADSFIPLLIFTILKGDIRVLVSNVRYIERFRYEE--FIRGEASYYLNSLEAAINYIMTLE 294

Query: 435 TD 436
            D
Sbjct: 295 KD 296

>CAGL0K01749g Chr11 complement(155385..159134) [3750 bp, 1249 aa]
           {ON} similar to uniprot|Q12451 Saccharomyces cerevisiae
           YDL019c
          Length = 1249

 Score = 32.3 bits (72), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 641 DHTDSKGNTLLHIIKCN-----ISFLLQSPDVDINKVNSQGLSPLTNNAMYD-------- 687
           ++ D  GNT LH+         ++FL++ PD++   VN+ G  P+      D        
Sbjct: 104 NYRDYNGNTPLHLAASQSRVDVVNFLMELPDINDTIVNNAGQEPIDMCKTLDIVAAMQNK 163

Query: 688 RGENVEALLKDPRLIFSSFDFLK 710
           R E V  + +D R  F   DF K
Sbjct: 164 RDEYVSQVAQDLRDAFDRRDFDK 186

>KLTH0E12452g Chr5 complement(1102014..1103561) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q02866 Saccharomyces cerevisiae
           YPL070W MUK1 Protein of unknown function localized to
           the cytoplasm computational analysis of large- scale
           protein- protein interaction data suggests a possible
           role in transcriptional regulation
          Length = 515

 Score = 32.0 bits (71), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 373 ITADTLVSLFILLIKRTKMKNIRCHLYYLQNFHQDENSIKFGLLGYAISTLEAVICYLET 432
           ++ D  +S  I LI +T +K+I  +L +++ F  ++  ++  L  YA++ LEA + ++E 
Sbjct: 307 LSNDDFLSTLIYLIIQTPIKHIFLNLQFIKLFRYNKKLVEKDL--YALTNLEAALKFIEG 364

Query: 433 IETD 436
           +  D
Sbjct: 365 LTVD 368

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,627,091
Number of extensions: 5381359
Number of successful extensions: 17963
Number of sequences better than 10.0: 47
Number of HSP's gapped: 18255
Number of HSP's successfully gapped: 64
Length of query: 1131
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1011
Effective length of database: 39,721,479
Effective search space: 40158415269
Effective search space used: 40158415269
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)