Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011506.19ON30730714610.0
SAKL0E01144g6.19ON43023910671e-144
TPHA0J003206.19ON34229910571e-144
Kpol_1037.246.19ON36630710551e-144
KLLA0D01111g6.19ON31423810241e-140
Suva_15.1816.19ON33627410191e-138
CAGL0E02717g6.19ON32530510171e-138
TDEL0G045006.19ON30124210121e-138
YOR006C (TSR3)6.19ON31327410061e-137
Smik_15.1756.19ON31223810041e-137
Ecym_30236.19ON3492389971e-135
Skud_15.1676.19ON3122749911e-135
NCAS0H008106.19ON3233099751e-132
ZYRO0C07832g6.19ON2812419521e-129
ACR007W6.19ON3132469551e-129
NDAI0D007906.19ON4013289481e-127
Kwal_56.224216.19ON3372319271e-125
KLTH0C11264g6.19ON3462399261e-124
KAFR0L003906.19ON3292768561e-114
TBLA0A072506.19ON3043047861e-104
Ecym_64542.38ON106675721.8
CAGL0E03454g4.46ON86799702.6
KLTH0F09350g2.325ON139694694.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01150
         (307 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {O...   567   0.0  
SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON...   415   e-144
TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON...   411   e-144
Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {O...   410   e-144
KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {O...   399   e-140
Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {...   397   e-138
CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {O...   396   e-138
TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19...   394   e-138
YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}  ...   392   e-137
Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {O...   391   e-137
Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON} s...   388   e-135
Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {O...   386   e-135
NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON...   380   e-132
ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar...   371   e-129
ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic hom...   372   e-129
NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {O...   369   e-127
Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {...   361   e-125
KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} simila...   361   e-124
KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}...   334   e-114
TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {...   307   e-104
Ecym_6454 Chr6 complement(880101..883301) [3201 bp, 1066 aa] {ON...    32   1.8  
CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {...    32   2.6  
KLTH0F09350g Chr6 (809231..813421) [4191 bp, 1396 aa] {ON} simil...    31   4.5  

>KNAG0M01150 Chr13 complement(206754..207677) [924 bp, 307 aa] {ON}
           Anc_6.19 YOR006C
          Length = 307

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/307 (90%), Positives = 278/307 (90%)

Query: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60
           MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC
Sbjct: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60

Query: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120
           DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR
Sbjct: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120

Query: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180
           LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF
Sbjct: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180

Query: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240
           SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN
Sbjct: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240

Query: 241 RNMNKMTLXXXXXXXXXXXXXXIRYDNLGNAXXXXXXXXXXXXXXXRYDNLGNVIVDESD 300
           RNMNKMTL              IRYDNLGNA               RYDNLGNVIVDESD
Sbjct: 241 RNMNKMTLSDEESDEEETEASSIRYDNLGNAIIDESDEEEPEISSIRYDNLGNVIVDESD 300

Query: 301 EEASSST 307
           EEASSST
Sbjct: 301 EEASSST 307

>SAKL0E01144g Chr5 complement(88424..89716) [1293 bp, 430 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 430

 Score =  415 bits (1067), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 198/239 (82%), Positives = 216/239 (90%), Gaps = 2/239 (0%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMEL-RQHDGVKGTKFPVKMAMWDFDHCDP 62
           GKGKNK+  + +SR  H+G+NGHSSRLNHKRME+ R  D   G KFPVK+AMWDFDHCDP
Sbjct: 2   GKGKNKNHEERSSR-PHRGANGHSSRLNHKRMEMKRGGDSSAGNKFPVKLAMWDFDHCDP 60

Query: 63  KRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLD 122
           KRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCP+DR IVEE GASVVECSWARLD
Sbjct: 61  KRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGRGVVCPNDRVIVEEHGASVVECSWARLD 120

Query: 123 EVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSW 182
           EVPF RIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLAS+LLSNFSW
Sbjct: 121 EVPFGRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLASELLSNFSW 180

Query: 183 GLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
           GLGFLELNKELLE+YQ+CTD +SVK AEE WL KIEEEAQQRK ++++ DIWMMGNVNR
Sbjct: 181 GLGFLELNKELLEIYQQCTDADSVKAAEEAWLKKIEEEAQQRKQQSKEEDIWMMGNVNR 239

>TPHA0J00320 Chr10 complement(71267..72295) [1029 bp, 342 aa] {ON}
           Anc_6.19 YOR006C
          Length = 342

 Score =  411 bits (1057), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 200/299 (66%), Positives = 229/299 (76%), Gaps = 10/299 (3%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTK-----FPVKMAMWDFD 58
            KGKNKS    + + S +GSNGH +R NHKRME++  +   G       FPVK+AMWDFD
Sbjct: 2   AKGKNKSSETRSGKPS-RGSNGHHTRTNHKRMEMKFSNAGTGANSKEAGFPVKLAMWDFD 60

Query: 59  HCDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSW 118
           HCDPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD+  VEEFGASVVECSW
Sbjct: 61  HCDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDKETVEEFGASVVECSW 120

Query: 119 ARLDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLS 178
           ARLDEVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA++LL 
Sbjct: 121 ARLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRVDLAAELLE 180

Query: 179 NFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGN 238
           +FSWGLGFLELNKELLE+YQKCTD ESVKK EE+WL KI++E Q+RK+++R+GDIW+ GN
Sbjct: 181 HFSWGLGFLELNKELLEMYQKCTDSESVKKVEEEWLEKIDKEVQERKSQSREGDIWLQGN 240

Query: 239 VNRNMNKMT----LXXXXXXXXXXXXXXIRYDNLGNAXXXXXXXXXXXXXXXRYDNLGN 293
            NR++  M+                   IRYDNLGN                RYD LGN
Sbjct: 241 TNRDLQDMSDDEEFDSEQYYSEENTERKIRYDNLGNVLISEEENESEEEEEVRYDALGN 299

>Kpol_1037.24 s1037 complement(54258..55358) [1101 bp, 366 aa] {ON}
           complement(54258..55358) [1101 nt, 367 aa]
          Length = 366

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 234/307 (76%), Gaps = 16/307 (5%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQH--DGVKGTKFPVKMAMWDFDHCD 61
            KGKNK     T + S +GSNGHSS+LNHK ME++++  +  +  KFPVK+AMWDFDHCD
Sbjct: 2   AKGKNKQHEARTGKPS-RGSNGHSSKLNHKHMEMKKYGKNISQDDKFPVKLAMWDFDHCD 60

Query: 62  PKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARL 121
           PKRCSGK+LERLGLI SL+VGQKFQG+VVSPNG+GV+CP+DR IVEEFGASVVECSWARL
Sbjct: 61  PKRCSGKRLERLGLIKSLRVGQKFQGVVVSPNGKGVLCPNDREIVEEFGASVVECSWARL 120

Query: 122 DEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFS 181
           DEVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD A++LLSNFS
Sbjct: 121 DEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWAAELLSNFS 180

Query: 182 WGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
           WGLGFLE+N+ELL++YQ+CTD ESVKKAEE+WL KIE+E Q+RK +AR+ DIWMMGN NR
Sbjct: 181 WGLGFLEINEELLKIYQQCTDSESVKKAEEEWLAKIEQEIQERKTQARESDIWMMGNTNR 240

Query: 242 NM---------NKMTLXXXXXXXXXXXXXXIRYDNLGNAXXXXXXXXXXXXXXXR----Y 288
           NM         N                   RYDNLGN                R    Y
Sbjct: 241 NMNGDDDEEEGNSYEALSGDDYEEENNNKSARYDNLGNIIESEEDYDDYDDEEDRVEVKY 300

Query: 289 DNLGNVI 295
           D+LGN+I
Sbjct: 301 DSLGNII 307

>KLLA0D01111g Chr4 complement(100315..101259) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006C Hypothetical ORF
          Length = 314

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/238 (79%), Positives = 210/238 (88%), Gaps = 3/238 (1%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKGKNK     T   S KGSNGHSSRLNHKRME++  D    +KFPVK+AMWDFDHCDPK
Sbjct: 2   GKGKNKESS--TRPRSQKGSNGHSSRLNHKRMEMKHVDSTT-SKFPVKLAMWDFDHCDPK 58

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+VGQKFQG+VVSPNG+ VVCPDD+A+VEE GASVVECSWARLDE
Sbjct: 59  RCSGKKLERLGLIKSLRVGQKFQGVVVSPNGKTVVCPDDKALVEENGASVVECSWARLDE 118

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           VPFN+IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA+DLLSNFSWG
Sbjct: 119 VPFNKIGGKNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAADLLSNFSWG 178

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
             FLELNKELL++YQ+CTDH+SVK AEE WL KIE+EA +RK +A+  DIWM+GNVNR
Sbjct: 179 PAFLELNKELLDIYQQCTDHDSVKAAEEKWLQKIEQEAIERKQQAKTEDIWMIGNVNR 236

>Suva_15.181 Chr15 complement(312147..313157) [1011 bp, 336 aa] {ON}
           YOR006C (REAL)
          Length = 336

 Score =  397 bits (1019), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 194/274 (70%), Positives = 222/274 (81%), Gaps = 8/274 (2%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKGKNK+   +  R   +G+NGHSSR NHKRME++ +D  + T FPVK+AMWDFDHCDPK
Sbjct: 26  GKGKNKTHEPKNGR-PQRGANGHSSRQNHKRMEMK-YDNSEMTNFPVKLAMWDFDHCDPK 83

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG GVVCPDD  +VE+ GASVVECSWARL+E
Sbjct: 84  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGNGVVCPDDLEVVEQHGASVVECSWARLEE 143

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS LLS+FSWG
Sbjct: 144 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASGLLSHFSWG 203

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243
           LGFL+LN+ELLE+YQKCTD  SVKKAEE+WL K+E+E Q+RK++++D DIWMMGNVNR  
Sbjct: 204 LGFLDLNRELLEIYQKCTDSNSVKKAEEEWLQKLEKETQERKSQSKDEDIWMMGNVNRKD 263

Query: 244 N------KMTLXXXXXXXXXXXXXXIRYDNLGNA 271
           N        +               I YD+LGNA
Sbjct: 264 NGAQSDESESEEDSDQSELESDKQSIEYDSLGNA 297

>CAGL0E02717g Chr5 complement(257708..258685) [978 bp, 325 aa] {ON}
           similar to uniprot|Q12094 Saccharomyces cerevisiae
           YOR006c
          Length = 325

 Score =  396 bits (1017), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 197/305 (64%), Positives = 223/305 (73%), Gaps = 14/305 (4%)

Query: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60
           MAKGKGKNKS  DE       GSNGH +R NH+ ME++   G K + FPVK+AMWDFDHC
Sbjct: 1   MAKGKGKNKSH-DEGRSNKSGGSNGHHTRRNHRHMEMKYCGGSKDSSFPVKLAMWDFDHC 59

Query: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120
           DPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG+ VVCPDDR IVE  GASVVECSWAR
Sbjct: 60  DPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKSVVCPDDREIVEAHGASVVECSWAR 119

Query: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180
           L+EVPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR DLA +LLS+F
Sbjct: 120 LEEVPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRTDLAHELLSHF 179

Query: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240
           SWGLGFLELNK+LLE YQ+CTD ES+KK EEDWL +I++E Q+RK +A+  D+WMMGN N
Sbjct: 180 SWGLGFLELNKDLLERYQQCTDSESIKKVEEDWLQQIDQEVQERKLKAQTEDVWMMGNTN 239

Query: 241 RNMNKMTLXXXXXXXXXXXXXXIRYDNLGNAXXXXXXXXXXXXXXXRYDNLGNVIVDESD 300
           R  + +                   D                    RYDNLGN+I D  D
Sbjct: 240 RGNSGLMPPSDSEEEYEEEAEEEEEDT-------------TTRKNVRYDNLGNIIEDSED 286

Query: 301 EEASS 305
           +   S
Sbjct: 287 DNNES 291

>TDEL0G04500 Chr7 (818321..819226) [906 bp, 301 aa] {ON} Anc_6.19
           YOR006C
          Length = 301

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 190/242 (78%), Positives = 215/242 (88%), Gaps = 7/242 (2%)

Query: 1   MAKGKGKNKSRGDETSRG-SHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDH 59
           M+KGK KN+    E   G S KGSNGHSSR NHKRME+++  G + TKFPVK+AMWDFDH
Sbjct: 1   MSKGKNKNR----EAKNGHSGKGSNGHSSRQNHKRMEMKR--GTEDTKFPVKLAMWDFDH 54

Query: 60  CDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWA 119
           CDPKRCSGKKLERLGLI SL+VGQKFQGIVVSPNG GVVCPDD++IVEE GASVVECSWA
Sbjct: 55  CDPKRCSGKKLERLGLIKSLRVGQKFQGIVVSPNGSGVVCPDDKSIVEEHGASVVECSWA 114

Query: 120 RLDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSN 179
           RLDEVPFN+IGGKHERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD AS+LLS+
Sbjct: 115 RLDEVPFNKIGGKHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSH 174

Query: 180 FSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNV 239
           FSWGLGFLELN+ELLE+YQ+CTD +SVK AE  WL KI++E ++RK++A+D DIWM GNV
Sbjct: 175 FSWGLGFLELNQELLEIYQQCTDADSVKAAESAWLVKIQKEVEERKSQAKDEDIWMTGNV 234

Query: 240 NR 241
           NR
Sbjct: 235 NR 236

>YOR006C Chr15 complement(337680..338621) [942 bp, 313 aa] {ON}
           TSR3Protein required for correct processing of the 20S
           pre-rRNA at site D to generate mature 18S rRNA; green
           fluorescent protein (GFP)-fusion protein localizes to
           both the cytoplasm and the nucleus
          Length = 313

 Score =  392 bits (1006), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 192/274 (70%), Positives = 223/274 (81%), Gaps = 8/274 (2%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKGKNK    +  R   +G+NGHSSR NH+RME++ +D  +  KFPVK+AMWDFDHCDPK
Sbjct: 2   GKGKNKMHEPKNGR-PQRGANGHSSRQNHRRMEMK-YDNSEKMKFPVKLAMWDFDHCDPK 59

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD  IVE+ GASVVECSWARL+E
Sbjct: 60  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEIVEQHGASVVECSWARLEE 119

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS+LLS+FSWG
Sbjct: 120 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWG 179

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243
           +GFLELNKELLE+YQ+CTD +SVK+AEE+WL K+E+E Q+RK+ A++ DIWMMGN+NR  
Sbjct: 180 MGFLELNKELLEIYQQCTDCDSVKRAEEEWLQKLEKETQERKSRAKEEDIWMMGNINRRG 239

Query: 244 N------KMTLXXXXXXXXXXXXXXIRYDNLGNA 271
           N        +               I YD+LGNA
Sbjct: 240 NGSQSDTSESEENSEQSDLEGNNQCIEYDSLGNA 273

>Smik_15.175 Chr15 complement(304998..305936) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  391 bits (1004), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 183/238 (76%), Positives = 214/238 (89%), Gaps = 2/238 (0%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKGKNK+   +  R   +G+NGHSSR NH+RME++  +  K  KFPVK+AMWDFDHCDPK
Sbjct: 2   GKGKNKAHEPKNGR-PQRGANGHSSRQNHRRMEMKYENSDK-VKFPVKLAMWDFDHCDPK 59

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+VGQKFQGIVVSPNG+GVVCPDD  +VE+ GASVVECSWARL+E
Sbjct: 60  RCSGKKLERLGLIKSLRVGQKFQGIVVSPNGKGVVCPDDLEVVEQHGASVVECSWARLEE 119

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           VPFN+IGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMD AS+LLS+FSWG
Sbjct: 120 VPFNKIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDWASELLSHFSWG 179

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
           +GFLELNKELLE+YQ+CTD +SVK+AEE+WL K+E+E Q+RK++A++ DIWMMGN+NR
Sbjct: 180 MGFLELNKELLEIYQQCTDADSVKRAEEEWLQKLEKETQERKSQAKEEDIWMMGNINR 237

>Ecym_3023 Chr3 complement(45641..46690) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii ACR007W
          Length = 349

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 177/238 (74%), Positives = 207/238 (86%), Gaps = 4/238 (1%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKG+NK   D     S KGSNGHSSR NH+R+E + ++ ++G+KFPV +AMWDFDHCDPK
Sbjct: 2   GKGRNK---DYDKNHSQKGSNGHSSRTNHRRIETK-YNAIQGSKFPVTLAMWDFDHCDPK 57

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+V QKFQGIVVSPNG+ VVCP+DR I E++G SVVECSWARL+E
Sbjct: 58  RCSGKKLERLGLIKSLRVKQKFQGIVVSPNGKTVVCPNDREIAEKYGVSVVECSWARLEE 117

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           +PF +IGG+HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA  LLS+FSWG
Sbjct: 118 IPFEKIGGRHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLAETLLSHFSWG 177

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
           LGFLELNKE+LE+YQKCTDH+S+K AEE WL +IE EA +R+ + ++ DIWMMGNVNR
Sbjct: 178 LGFLELNKEILEIYQKCTDHDSIKAAEEAWLKQIETEAMERRKQTKENDIWMMGNVNR 235

>Skud_15.167 Chr15 complement(297699..298637) [939 bp, 312 aa] {ON}
           YOR006C (REAL)
          Length = 312

 Score =  386 bits (991), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 187/274 (68%), Positives = 220/274 (80%), Gaps = 8/274 (2%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPK 63
           GKGKNK+   +  R   +G+NGHS+R NHK ME++ +D  +  KFPVK+AMWDFDHCDPK
Sbjct: 2   GKGKNKTHEPKNER-QQRGANGHSARQNHKHMEMK-YDKSEKMKFPVKLAMWDFDHCDPK 59

Query: 64  RCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDE 123
           RCSGKKLERLGLI SL+VGQKFQG+VVSPNGQGVVCP+D  IVE+ GASVVECSWARL+E
Sbjct: 60  RCSGKKLERLGLIRSLRVGQKFQGVVVSPNGQGVVCPNDLEIVEQHGASVVECSWARLEE 119

Query: 124 VPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWG 183
           VPFN+IGGK+ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVG+MD AS+LLS+FSWG
Sbjct: 120 VPFNKIGGKYERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGKMDWASELLSHFSWG 179

Query: 184 LGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNRNM 243
           LGFL+LNKELLE+YQ+CTD +SVKKAE++WL K+E E Q+RK+  +  DIWMMGN+NR  
Sbjct: 180 LGFLDLNKELLEIYQRCTDADSVKKAEKEWLEKLEMETQERKSHTKKTDIWMMGNINRRG 239

Query: 244 NKM------TLXXXXXXXXXXXXXXIRYDNLGNA 271
           N +      +               I YD LGNA
Sbjct: 240 NGVQSDELESGEDSEQSGLENSEQPIEYDALGNA 273

>NCAS0H00810 Chr8 complement(146860..147831) [972 bp, 323 aa] {ON}
           Anc_6.19 YOR006C
          Length = 323

 Score =  380 bits (975), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 187/309 (60%), Positives = 230/309 (74%), Gaps = 22/309 (7%)

Query: 4   GKGKNKSRGDETSRG-SHKGSNGHSSRLNHKRMELRQH---DGVKGTKFPVKMAMWDFDH 59
           GKGKNK R D  S+G  H+G+NGHSSR NHK ME+R+H   D     K PVK+ MWDFDH
Sbjct: 2   GKGKNKKRDDGDSKGRQHRGANGHSSRHNHKNMEMRKHENEDTSNVKKIPVKLGMWDFDH 61

Query: 60  CDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWA 119
           CDPKRCSGKKLERLGLI SLK+GQ+FQG+++SPNG+ VV P+D  I++EFGA+VVECSWA
Sbjct: 62  CDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPEDADIIKEFGAAVVECSWA 121

Query: 120 RLDEVPFNRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASD 175
           RLDE+PF+++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALAACFAI+GR D A+D
Sbjct: 122 RLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALAACFAIIGRSDWAAD 181

Query: 176 LLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWM 235
           LLSNFSWG+ FL LN+EL E+Y +CTD +S+++A+E WLNKI+EEA++RK +A+D DIW+
Sbjct: 182 LLSNFSWGMNFLTLNEELFELYSQCTDSDSIQEAQEAWLNKIDEEAKERKLQAQDNDIWL 241

Query: 236 MGNVNR---NMNKMTLXXXXXXXXXX------XXXXIRYDNLGNAXXXXXXXXXXXXXXX 286
           MGN NR   N+  +TL                    ++YDNLGN                
Sbjct: 242 MGNTNRVNDNLRDLTLSDGDEDEEEEDAEDYLTEKSVKYDNLGNV-----IESSEDEITL 296

Query: 287 RYDNLGNVI 295
           RYDNLGNVI
Sbjct: 297 RYDNLGNVI 305

>ZYRO0C07832g Chr3 (594511..595356) [846 bp, 281 aa] {ON} similar to
           uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 281

 Score =  371 bits (952), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 177/241 (73%), Positives = 205/241 (85%), Gaps = 5/241 (2%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKG---TKFPVKMAMWDFDHC 60
           GKGKNK+    ++R   +G+NGH+S+ NHK ME++ H G      T FPVK+ MWDFDHC
Sbjct: 2   GKGKNKNHEVRSTRPG-RGANGHNSKQNHKHMEMK-HGGASNSNKTNFPVKLGMWDFDHC 59

Query: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120
           DPKRCSGKKLERLGLI SL+VGQKFQG+VV+PNG GVVCP+D++IVEE GASVVECSWAR
Sbjct: 60  DPKRCSGKKLERLGLIRSLRVGQKFQGVVVTPNGTGVVCPNDKSIVEEHGASVVECSWAR 119

Query: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180
           LDEVPFNRIGG+HERLLPYLVAANQVNYGRPW+LNCVEALAACFAIVGRMD AS+LLSNF
Sbjct: 120 LDEVPFNRIGGRHERLLPYLVAANQVNYGRPWKLNCVEALAACFAIVGRMDWASELLSNF 179

Query: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240
           S+G  FLE+N ELLE+YQ+CTD ESVK AE  WL KIE+E + RK +A++ DIWM GNVN
Sbjct: 180 SYGPSFLEINAELLEIYQQCTDAESVKDAESAWLEKIEKEIKDRKAQAKNEDIWMTGNVN 239

Query: 241 R 241
           R
Sbjct: 240 R 240

>ACR007W Chr3 (367875..368816) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR006C
          Length = 313

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 173/246 (70%), Positives = 202/246 (82%), Gaps = 5/246 (2%)

Query: 1   MAKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHC 60
           MAKGK K      E  +   KGS+ H+ + N +R EL+ H   K T+FP K+AMWDFDHC
Sbjct: 1   MAKGKNKKT----EERQKPAKGSSKHNGKSNQRRTELK-HGHTKETEFPAKLAMWDFDHC 55

Query: 61  DPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWAR 120
           DPKRCSGKKLERLGLI SL++GQKFQGIVVSPNG+ VVCP+D+ IVE+ G SVVECSWAR
Sbjct: 56  DPKRCSGKKLERLGLIKSLRIGQKFQGIVVSPNGKTVVCPNDKEIVEQHGVSVVECSWAR 115

Query: 121 LDEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNF 180
           LDE+PF++IGG+HERLLPYLVAANQVNYGRPWRLNCVEA+AACFAIVGR DLA +LLS+F
Sbjct: 116 LDEIPFSKIGGRHERLLPYLVAANQVNYGRPWRLNCVEAIAACFAIVGRTDLAEELLSHF 175

Query: 181 SWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240
           SWG GFLELN+ELLE YQ+CTDH S+K AEE WL K+EEEA+QR+ +  + DIWMMGNVN
Sbjct: 176 SWGPGFLELNQELLETYQQCTDHASIKAAEEAWLQKLEEEAEQRRKQTHEEDIWMMGNVN 235

Query: 241 RNMNKM 246
           R    M
Sbjct: 236 RKAPNM 241

>NDAI0D00790 Chr4 complement(175697..176902) [1206 bp, 401 aa] {ON}
           Anc_6.19 YOR006C
          Length = 401

 Score =  369 bits (948), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 188/328 (57%), Positives = 228/328 (69%), Gaps = 38/328 (11%)

Query: 4   GKGKNKSRGD-ETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGT---------------- 46
           GKGKNKSR D   +  +H+G+NGHSSR NHK ME+++H+    T                
Sbjct: 46  GKGKNKSRDDGPKNPRAHRGANGHSSRHNHKNMEMKKHNDFTSTQMVNDNDDGIDEIHSV 105

Query: 47  -KFPVKMAMWDFDHCDPKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAI 105
            K PVK+ MWDFDHCDPKRCSGKKLERLGLI SLK+GQ+FQG+++SPNG+ VV PDD  I
Sbjct: 106 KKIPVKLGMWDFDHCDPKRCSGKKLERLGLIKSLKIGQRFQGLIISPNGKKVVSPDDADI 165

Query: 106 VEEFGASVVECSWARLDEVPFNRI----GGKHERLLPYLVAANQVNYGRPWRLNCVEALA 161
           ++EFGA+VVECSWARLDE+PF+++    GGK+ERLLPYLVAANQVNYGRPW+LNCVEALA
Sbjct: 166 IKEFGAAVVECSWARLDEIPFSKLNGGNGGKNERLLPYLVAANQVNYGRPWKLNCVEALA 225

Query: 162 ACFAIVGRMDLASDLLSNFSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEA 221
           ACFAI+GR D ASDLLSNFSWGL FL+LN+EL E+Y KCTD +SVK A+E+WL+KIE+EA
Sbjct: 226 ACFAIIGRSDWASDLLSNFSWGLNFLKLNEELFELYSKCTDSDSVKAAQEEWLDKIEQEA 285

Query: 222 QQRKNEARDGDIWMMGNVNR---NMNKMTLXXXXXXXXX------------XXXXXIRYD 266
            +RK +A++ DIWMMGN NR   N+  M +                          +RYD
Sbjct: 286 TERKLQAQETDIWMMGNTNRLDANLRSMNISDEDEEEEEEYDEEEDGGEHITRNKELRYD 345

Query: 267 NLGNAXX-XXXXXXXXXXXXXRYDNLGN 293
           NLGN                 RYDNLGN
Sbjct: 346 NLGNVIEDTDEEYLSEEEKEIRYDNLGN 373

>Kwal_56.22421 s56 complement(120212..121225) [1014 bp, 337 aa] {ON}
           YOR006C - Hypothetical ORF [contig 185] FULL
          Length = 337

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 198/231 (85%)

Query: 11  RGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPKRCSGKKL 70
           +G  +++GS+K   GHS+R +   +E +      G  FPVK+AMWDFD CDPKRCSGKKL
Sbjct: 3   KGGRSNKGSNKVRTGHSNRSSSGYVETKHGAHNNGRNFPVKLAMWDFDQCDPKRCSGKKL 62

Query: 71  ERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDEVPFNRIG 130
           ERLG+I SL+VGQKFQGIVVSPNG+GVVCP+D+ IVEE GA+VVECSWARL+E+PFN+IG
Sbjct: 63  ERLGIIKSLRVGQKFQGIVVSPNGKGVVCPNDKQIVEESGAAVVECSWARLNEIPFNKIG 122

Query: 131 GKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLELN 190
           G++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLA++LL++FSWGLGFLELN
Sbjct: 123 GRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLATELLAHFSWGLGFLELN 182

Query: 191 KELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVNR 241
           KEL+EVYQKCTD ESVK+AE  WL KIE EA +R+N +   D+WM GNVNR
Sbjct: 183 KELIEVYQKCTDAESVKEAEASWLEKIEREANERRNHSATDDLWMTGNVNR 233

>KLTH0C11264g Chr3 (925534..926574) [1041 bp, 346 aa] {ON} similar
           to uniprot|Q12094 Saccharomyces cerevisiae YOR006C
           Hypothetical ORF
          Length = 346

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/239 (71%), Positives = 201/239 (84%), Gaps = 6/239 (2%)

Query: 2   AKGKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCD 61
           +KGKG NK RG  +S    K S+GH+S   H+ +E +      G  FPVK+AMWDFD CD
Sbjct: 5   SKGKGSNKQRGAHSS----KPSSGHTS--THRHVESKHGANKSGKNFPVKLAMWDFDQCD 58

Query: 62  PKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARL 121
           PKRCSGKKLERLG+I SL+VGQKFQGIVVSPNG+ VVCP+DR IVEE GA+VVECSWARL
Sbjct: 59  PKRCSGKKLERLGIIKSLRVGQKFQGIVVSPNGKSVVCPNDRNIVEENGAAVVECSWARL 118

Query: 122 DEVPFNRIGGKHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFS 181
           DEVPFN+IGG++ERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGR+DLA++LLS+FS
Sbjct: 119 DEVPFNKIGGRNERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRLDLATELLSHFS 178

Query: 182 WGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNVN 240
           WGL FLELNKELLEVYQ+CTD +S+KKAE+ WL +IE+EAQ+RK      D+W+ GNVN
Sbjct: 179 WGLQFLELNKELLEVYQRCTDADSIKKAEDAWLEQIEKEAQERKARNPGDDLWLTGNVN 237

>KAFR0L00390 Chr12 complement(71329..72318) [990 bp, 329 aa] {ON}
           Anc_6.19 YOR006C
          Length = 329

 Score =  334 bits (856), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 163/276 (59%), Positives = 202/276 (73%), Gaps = 15/276 (5%)

Query: 23  SNGHSSRLNHKRMELRQHDGVKGTKFPVKMAMWDFDHCDPKRCSGKKLERLGLITSLKVG 82
           SNGH SR N+K+ME +QH   + T FPVK+AMWDFDHCDPKRCSGKKLERL LI SLK+ 
Sbjct: 23  SNGHHSRHNNKKMEFKQHVS-RETSFPVKLAMWDFDHCDPKRCSGKKLERLNLIRSLKIN 81

Query: 83  QKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARLDEVPFNRIGG-KHERLLPYLV 141
           QKFQGI VSPNG+  V P+DR +V EFG +VVECSWAR+DE+PF++    K +RLLPYLV
Sbjct: 82  QKFQGITVSPNGKKFVSPEDRELVTEFGCAVVECSWARIDEIPFSKFSTPKLDRLLPYLV 141

Query: 142 AANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLELNKELLEVYQKCT 201
           AANQVNYGRPW+LNCVEA+AAC AIVG MDLA +LLS+FSWG+ FL+LN+ELLE+YQ+CT
Sbjct: 142 AANQVNYGRPWKLNCVEAIAACLAIVGFMDLAEELLSHFSWGVNFLKLNRELLEIYQQCT 201

Query: 202 DHESVKKAEEDWLNKIEEEAQQRK--NEARDGDIWMMGNVNRNMNKMTLXXXXXXXXXXX 259
           D + ++ A++ W+++IE+E Q+RK  N A++ DIWM GNVNR    +             
Sbjct: 202 DSDEIEAAQDAWMDQIEKEVQERKASNNAQNVDIWMSGNVNR----IDESDEDNEDEDSE 257

Query: 260 XXXIRYDNLGNAXXXXXXXXXXXXXXXRYDNLGNVI 295
              + YDNLGN                RYDNLGN+I
Sbjct: 258 DEEVTYDNLGNI-------IENEPREVRYDNLGNII 286

>TBLA0A07250 Chr1 complement(1806584..1807498) [915 bp, 304 aa] {ON}
           Anc_6.19 YOR006C
          Length = 304

 Score =  307 bits (786), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 162/304 (53%), Positives = 198/304 (65%), Gaps = 24/304 (7%)

Query: 4   GKGKNKSRGDETSRGSHKGSNGHSSRLNHKRMELRQHDGVKGTK--FPVKMAMWDFDHCD 61
            KGKNK   + ++R S+          N +R E +    +K TK  FPVK+AMWDFDHCD
Sbjct: 2   AKGKNKGHEERSNRKSN----------NSRRNESKHSLSIKSTKTNFPVKLAMWDFDHCD 51

Query: 62  PKRCSGKKLERLGLITSLKVGQKFQGIVVSPNGQGVVCPDDRAIVEEFGASVVECSWARL 121
           PKRCSGKKLER GL  SL+VGQ+F G+VVSPNG+ VV P DR  +E++G +VVECSWARL
Sbjct: 52  PKRCSGKKLERTGLAQSLRVGQRFNGMVVSPNGKRVVSPADRETIEQYGIAVVECSWARL 111

Query: 122 DEVPFNRIGGK--HERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSN 179
           DEVPFN++GGK  +E LLPYLVAAN VNYGRPWRLNCVEA AAC AIVG  + AS +L  
Sbjct: 112 DEVPFNKLGGKPSNEVLLPYLVAANPVNYGRPWRLNCVEAFAACLAIVGFKEYASKVLEG 171

Query: 180 FSWGLGFLELNKELLEVYQKCTDHESVKKAEEDWLNKIEEEAQQRKNEARDGDIWMMGNV 239
           FSWG  FLELN ELL++Y  CTD  SV+KA+++WL KIE E ++RK +    D W++GN 
Sbjct: 172 FSWGHAFLELNDELLDIYGNCTDSISVEKAQDEWLEKIELENKERKEKMNSADAWLIGNT 231

Query: 240 NR-NMNKM--TLXXXXXXXXXXXXXXIRYDNLGNAXXXXXXXXXXXXXXXRYDNLGNVIV 296
           NR N+N    +                RYD LGN                +YD+LGNVI 
Sbjct: 232 NRKNLNDFDNSSESTEDNISTVSSADERYDALGN-------LISNDSHSLKYDSLGNVIE 284

Query: 297 DESD 300
            E D
Sbjct: 285 SEGD 288

>Ecym_6454 Chr6 complement(880101..883301) [3201 bp, 1066 aa] {ON}
           similar to Ashbya gossypii ABL171W
          Length = 1066

 Score = 32.3 bits (72), Expect = 1.8,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 147 NYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLELNKELLEVY---QKCTDH 203
           N+G P+    + +L  CF I+      S+++ NFS     L+  K+LL  +   Q C D 
Sbjct: 265 NFGIPYLCGILLSLVVCF-IIDPHGGHSEIMQNFS---STLDDVKQLLIAFVDKQHCNDL 320

Query: 204 ESVKKAEEDWLNKIE 218
            +++KA++D +  I+
Sbjct: 321 ATLQKAQQDVIKSID 335

>CAGL0E03454g Chr5 complement(316082..318685) [2604 bp, 867 aa] {ON}
           similar to uniprot|Q06704 Saccharomyces cerevisiae
           YLR309c IMH1
          Length = 867

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 48/99 (48%), Gaps = 6/99 (6%)

Query: 132 KHERLLPYLVAANQVNYGRPWRLNCVEALAACFAIVGRMDLASDLLSNFSWGLGFLE--L 189
           K+E+  P L+ A +    +  ++  +E + A    VG +D A + L  F   L      L
Sbjct: 55  KYEQKYPLLLQAYKTEKSKSEKIEALEKILAENTPVGNLDDAVESLPTFFKNLNDKNSML 114

Query: 190 NKEL--LEVYQKCTDHESVKKAEEDWLNKIEE--EAQQR 224
           N+E+  L + QK TD++    A E  + ++EE  E Q R
Sbjct: 115 NEEIKRLTMEQKKTDNDEQNDANEAKIRELEEQLETQNR 153

>KLTH0F09350g Chr6 (809231..813421) [4191 bp, 1396 aa] {ON} similar
           to uniprot|Q7LGS3 Saccharomyces cerevisiae YDL112W TRM3
           2'-O-ribose methyltransferase catalyzes the ribose
           methylation of the guanosine nucleotide at position 18
           of tRNAs
          Length = 1396

 Score = 31.2 bits (69), Expect = 4.5,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 14/94 (14%)

Query: 164 FAIVGRMDLASDLLSNFSWG-----LGFLELNKELLEVYQKCTDHESVK-----KAEEDW 213
           F I  + +L   L +N  +G     LG +E  KE LEV  +CT  + +K        E+W
Sbjct: 11  FPIEKQTELLQTLSTNEEFGEMFEVLGTMEFGKEALEVATQCTTEQVLKGFKGHNETEEW 70

Query: 214 -LNKIEEEAQ---QRKNEARDGDIWMMGNVNRNM 243
            ++K+ E A+   +  N       W++G +++N+
Sbjct: 71  DVSKLRELAKLTSKLPNTFAALQEWIVGILDQNL 104

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.406 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,385,536
Number of extensions: 1204680
Number of successful extensions: 4533
Number of sequences better than 10.0: 38
Number of HSP's gapped: 4581
Number of HSP's successfully gapped: 40
Length of query: 307
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 198
Effective length of database: 40,982,805
Effective search space: 8114595390
Effective search space used: 8114595390
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)