Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011406.17ON59459428110.0
KAFR0L003806.17ON54059414560.0
Kpol_1045.726.17ON69570412061e-157
Kwal_56.224116.17ON68969011801e-153
SAKL0E01100g6.17ON71055011681e-151
CAGL0L13288g6.17ON64665411411e-148
YEL062W (NPR2)6.17ON61535710671e-137
Suva_5.56.17ON61935910611e-137
NCAS0H008706.17ON61234710601e-136
Skud_5.276.17ON61535610581e-136
Smik_5.256.17ON61535710561e-136
ZYRO0C07876g6.17ON68134410541e-135
TDEL0G045206.17ON67934210521e-134
TBLA0G010106.17ON71035310331e-131
NDAI0D008606.17ON66638110271e-131
KLTH0C11308g6.17ON6903519661e-121
KLLA0D01067g6.17ON6603369631e-121
Ecym_30216.17ON6743499501e-119
TPHA0J003106.17ON6753699501e-119
ACR009W6.17ON6806939311e-116
YBR103W (SIF2)3.344ON53599715.2
KNAG0C005101.45ON78034715.8
NDAI0D031504.341aON1188125706.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01140
         (594 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...  1087   0.0  
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   565   0.0  
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   469   e-157
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   459   e-153
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   454   e-151
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   444   e-148
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   415   e-137
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    413   e-137
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   412   e-136
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   412   e-136
Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...   411   e-136
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   410   e-135
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   409   e-134
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   402   e-131
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   400   e-131
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   376   e-121
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   375   e-121
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   370   e-119
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   370   e-119
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   363   e-116
YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40 r...    32   5.2  
KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}...    32   5.8  
NDAI0D03150 Chr4 (749402..752968) [3567 bp, 1188 aa] {ON}              32   6.9  

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score = 1087 bits (2811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/594 (90%), Positives = 535/594 (90%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LTMKYGNYRIVSYPVAVQSSS              PYECATSPYEPAITRLGKMFRVLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHLISVQ 180
           QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHLISVQ
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHLISVQ 180

Query: 181 DLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDL 240
           DLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDL
Sbjct: 181 DLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDL 240

Query: 241 NWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAP 300
           NWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAP
Sbjct: 241 NWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAP 300

Query: 301 SSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGXXXXXXXXXXXXXXTGVLXX 360
           SSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPG              TGVL  
Sbjct: 301 SSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGSRNNKHKKSNSLSSTGVLSW 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQG 420
                                        GTPGAGRSDDHTIYYPTRMVLFDLYRSLSQG
Sbjct: 361 QSNSQYSNNSSEFYSMSNKKRSESSLSSEGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQG 420

Query: 421 ITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSKM 480
           ITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSKM
Sbjct: 421 ITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSKM 480

Query: 481 AEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGA 540
           AEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGA
Sbjct: 481 AEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNGA 540

Query: 541 DKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594
           DKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC
Sbjct: 541 DKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  565 bits (1456), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/594 (50%), Positives = 373/594 (62%), Gaps = 56/594 (9%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M ++FEGF PIHT+F++IFHPTEGSKVCYQFPP NLQ Y+INFD+IKN++IPKPQLCHRL
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT++Y NYR+VSYPV V SSS               Y+C T PYEPAI RLGKMF+ LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QSQVLSRAERDDSLFK-GDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHLISV 179
           QSQ+LS+++R  + FK G+ + F                        D K        S+
Sbjct: 121 QSQILSKSQRTSAFFKDGEDVDF-----------------------VDTK-------FSI 150

Query: 180 QDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIID 239
           QDL+MR+YQDLNNYSECLIPIDEGN I+IKIFP++ PPTSV +SIEDVP+ +V L KI+D
Sbjct: 151 QDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQISIEDVPLSIVNLDKIVD 210

Query: 240 LNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYA 299
           LNWDPTM+SILPFI+GVNSI NI+ LSDSDP LVIECIKHLIYY CVIITDIFQFSNIYA
Sbjct: 211 LNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIYYNCVIITDIFQFSNIYA 270

Query: 300 PSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGXXXXXXXXXXXXXXTGVLX 359
           PSSLIN FL DP +A++CQ YV LP  S++  +PL +                  +    
Sbjct: 271 PSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPLASEQDDEINNSDMTQKALSSSRSSF 330

Query: 360 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQ 419
                                         G     R        P++  LFDLYRSL+ 
Sbjct: 331 SSYFSHKSAYARVSETAHHHQSTSTLSSSEGQQDNPRQGQ---VLPSKCTLFDLYRSLNY 387

Query: 420 GITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMGKSK 479
           G T+E WY  NF+TI+ N+IDVRKFI+FG I KIIYRV  YP++E +          KS 
Sbjct: 388 GCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIMEHK--------TFKSP 439

Query: 480 MAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENARERKSFDAVGGTNG 539
           +     + K    STSDIKFD GDR+ NS+Y + SKV+F+      R++K    +G +  
Sbjct: 440 LLSDRQNDK-IVLSTSDIKFDVGDRILNSIYNKLSKVTFD------RDKKLESKIGNSRN 492

Query: 540 ADKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593
                  L + EK  L  AL+  ESFD+IC +LG+S+ E+ ++I++IGEY  IN
Sbjct: 493 -------LGESEKNILFNALERHESFDRICSKLGKSKNEVESIISEIGEYMTIN 539

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  469 bits (1206), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 282/704 (40%), Positives = 374/704 (53%), Gaps = 122/704 (17%)

Query: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61
           M  F+GF PIHT+FY++FHPTEG KVCYQFPP NL +Y INFD+I++Y+IPKPQLC++LL
Sbjct: 1   MVGFDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLL 60

Query: 62  TMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEEQ 121
           T+KYGNYRI+ YP+ +  S               PYEC TSPYE  I +LGKMFRVLEEQ
Sbjct: 61  TLKYGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQ 120

Query: 122 SQVLSRAERD----------------DSLFKGDKLPFD-------------------NNS 146
           SQ LS+AE+D                DS  K +K                        +S
Sbjct: 121 SQFLSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDS 180

Query: 147 AKNQAPLTHALISKTKSFSPDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAI 206
            KN + L        +  S D   E D    S+QD IMR+YQDLNNYSECLIPID GNA+
Sbjct: 181 KKNSSYLFEKYKEIQEFVSND---ESDF---SIQDFIMRLYQDLNNYSECLIPIDAGNAV 234

Query: 207 DIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLS 266
           DIK+FPL+ PP +  +SIEDVP+  V LK+IID+NWDPTM+ I+P I+GVNSI  IA+LS
Sbjct: 235 DIKLFPLLRPPPAT-ISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLS 293

Query: 267 DSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKS 326
           DSD  LVIECIKH IYY CV+I+DIFQFSNIYAP+SL+  FLTDP MA +CQ YVT+P+S
Sbjct: 294 DSDTVLVIECIKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPES 353

Query: 327 SRLIHMP------LQTSVPGXXXXXXXXXXXXXXTGVLXXXXXXXXXXXXXXXXXXXXXX 380
           S L  +P      L+    G              +                         
Sbjct: 354 STLHQLPLESLSKLKLDSDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSD 413

Query: 381 XXXXXXXXXGTPGAGRSDD---HTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSN 437
                     +  +  ++D   +    PTR  LFDLYRSLSQG+TL++WY  NF  IR+N
Sbjct: 414 LYLNRHRSESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNN 473

Query: 438 YIDVRKFIQFGTIKKIIYRVLSYPV---------LEKRRNSIIAKQMGKSKMAEKAPHSK 488
            ID+RKFI FG I  ++YR  S+PV         ++K ++    K+  K K+ ++     
Sbjct: 474 GIDIRKFIIFGIINGLLYRCQSFPVTANFEEINKVKKFKDIQNRKETRKDKLQKQLSQD- 532

Query: 489 NAFFSTSDIK-----------------FDDGDRLFNSLYARFSKVSFEKRRENAR----- 526
              FSTSDIK                  D  D +  ++Y + +  + E+   N       
Sbjct: 533 --IFSTSDIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590

Query: 527 -ERKSFDAV------------------------------GGTNGADKETMILTKEEKLQ- 554
            E+KS  ++                                ++G   E   +   EKL+ 
Sbjct: 591 LEKKSVQSLFESSNPYSKVPKRPGTLSKVSFQQNSNMQYSASSGDVTENEDINNLEKLRK 650

Query: 555 -----LLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593
                LL AL++ E+ DKICV L + R E+  ++  + +++VIN
Sbjct: 651 QNEQILLEALESTENLDKICVLLEKPRSEVEEMLKHLVDFKVIN 694

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  459 bits (1180), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 262/690 (37%), Positives = 372/690 (53%), Gaps = 97/690 (14%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M   F+GFVP+H + YTIFHPTEG+KV +QFPPG L+  DI FD IKNY+IPKPQLC++L
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT KYG++R+V YPV V +                PY+CATSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QSQVLSRAERD---------DSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTE 171
           QSQ+LS+AE           DS    ++ P ++N  +       A  S++  ++ +K  E
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHKHTNQEPVNDNELQGTLKNNEASQSESHGYAFEKYHE 180

Query: 172 ------GDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225
                 G    ISV+DLI +IY+DLNNYSECLIPID GNA+DIK+FPL++PP+S  LS E
Sbjct: 181 ILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSC-LSFE 239

Query: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285
           DVPM  V L K+ID+NWDPTM+ I+P+ING NSI  +A+LSDSD  LV+ECI+HL+YY C
Sbjct: 240 DVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYYNC 299

Query: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ--------TS 337
           VI+ DIFQF NIYAP+S ++ FLT+P +A +CQ YVTL +S+ +  +P +         +
Sbjct: 300 VILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFERKPSRTTYNN 359

Query: 338 VPGXXXXXXXXXXXXXXTGVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPGAGRS 397
           +P                  +                                    G S
Sbjct: 360 IPVRNSSSTLDVQRKGREMSIKESSFTAGIDQSGRNQYTPQSHTSSIQCHNVSDASLGNS 419

Query: 398 D---DHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKII 454
           +   ++ +++ ++  LFD+YRSLSQG T+++WY T+F  IR+  IDVR+FI FG I  ++
Sbjct: 420 EGGFNNKVFFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLL 479

Query: 455 YRVLSYPVLEKRRNSIIAKQMGKS--------KMAEKAPHSKNAFFSTSDIKF------- 499
           YR  S+P+++      + K +G S        K         N   S ++I+        
Sbjct: 480 YRCYSFPIMKNVGYLEVVKALGLSDGDSSTEGKWLSGNSEPTNNVLSAAEIRIGLESSSS 539

Query: 500 -------------DDGDRLFNSLYARFS----KVS------------FEKRRENARERKS 530
                        D  + + N +Y + +    KV             F    +++    S
Sbjct: 540 KLRERRFNHFSNADTAEDILNDVYRKLALNENKVEQSSQSGNPMMRMFGNCSDDSSGETS 599

Query: 531 FDAVGGTNGADK-----------------------ETMIL---TKEEKLQLLGALDNLES 564
              V  T G+D                        E M L    ++++L LL ++ ++E+
Sbjct: 600 VKDVVSTAGSDTRNTVAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVEN 659

Query: 565 FDKICVQLGRSRVEIANLIADIGEYRVINC 594
           FDKIC +LGR R E+  ++ D+G Y V++C
Sbjct: 660 FDKICTRLGRDREEVEKMLEDLGPYNVVHC 689

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  454 bits (1168), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 256/550 (46%), Positives = 317/550 (57%), Gaps = 54/550 (9%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M S F+GFVPIHT+FY++FHPTEG+KV YQFPP NL++ DINFD IKNY+IPKPQLC++L
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT KYG YR+  YPV V +S               PY CATSPYEPA+ RLGKMFRVLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QSQVLSRAERDDSLFK------------------GDKLPFD-------NNS--AKNQAPL 153
           QSQ+LS+AE D   F                   G   P D       NNS  +K Q  +
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 154 --THALISKTKSFSPDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIF 211
               A I K      D   E     +S++DLI ++YQDLNNYSEC IPID GN++DIK+F
Sbjct: 181 EGQGAAIEKYHEIMDD--LEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLF 238

Query: 212 PLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPE 271
           PL+ PP S  LS EDVP+  V L K+ID+NWDPTM+ I+PFINGVNSI  IA+ S SD +
Sbjct: 239 PLLAPPNSC-LSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTD 297

Query: 272 LVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVT--------L 323
           LVIEC+KHLIYY CV++ DIFQFSNIYA +SLI+EFLTDPT+A +CQ YVT        L
Sbjct: 298 LVIECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVTSSDLELYRL 357

Query: 324 PKSSRLIHMPLQTSVPGXXXXXXXXXXXXXX---TGVLXXXXXXXXXXXXXXXXXXXXXX 380
           P  SR   + + +S                    T  L                      
Sbjct: 358 PFESRPNLLSMHSSRKQNSSSTIHTVGVRNSPNRTNSLDYPSELSTRRNNFSSSSASSLM 417

Query: 381 XXXXXXXXXGTPGAGRSDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYID 440
                     T  A    +  +  PT+  LFDLYRSL QG T+++WY  NF  IR N+ID
Sbjct: 418 RVRDRSGQSTTGSAVDEQESRLLLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHID 477

Query: 441 VRKFIQFGTIKKIIYRVLSYPVLEKRRNSIIAKQMG----------KSKMAEKAPHSKNA 490
           VR+FI FG ++ +IYR  +YPV++      + K +           K K  EK   + N 
Sbjct: 478 VRRFITFGIVRGLIYRCYAYPVMKNLGALEMLKTLKSASDSRSLRRKLKFREKKNFTNNV 537

Query: 491 FFSTSDIKFD 500
            FST+DIK D
Sbjct: 538 -FSTADIKVD 546

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 514 SKVSFEKRRE--NARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQ 571
           SKV+FEK R      E +  +     +   KE     + E+  LL ++ ++++FDKIC++
Sbjct: 632 SKVAFEKGRSPWQVEEDEKKERTEEVSNLLKEK----RHEEFLLLKSVKSVDTFDKICMR 687

Query: 572 LGRSRVEIANLIADIGEYRVIN 593
           L + R E+  L+ ++G Y +IN
Sbjct: 688 LEKDREEVEQLLKEMGHYNIIN 709

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  444 bits (1141), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 270/654 (41%), Positives = 365/654 (55%), Gaps = 68/654 (10%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M S+FEGFV IH++FY+ FHPTEGSKV + FPP +L++  INFD+IKNY+IPK  LCHRL
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T KYGNYRI  YPV V SS               P+ C TSPYEPAI RLGKMFRVLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QSQVLSRAERDDSLFK---GDK-LPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGDIHL 176
           Q+Q+LS++E D  +F     DK    DN+S+     +    IS   +     K E   ++
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSSNY---ILGDDISSIMTTQQKDKYERLNNI 177

Query: 177 IS----------VQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIED 226
           IS          + DL+MR+YQDLN YSECLIPID+GNA+DIK+FPL+ PPT  ++SIE 
Sbjct: 178 ISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTP-YISIEH 236

Query: 227 VPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCV 286
           VP+ +V L KI+D+NWDP M++I+P+ING+N+I  I++LS ++  LVIECI+HL+YY+C+
Sbjct: 237 VPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVYYRCI 296

Query: 287 IITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPL--QTSVPGXXXX 344
           ++TDIF+FSN+YAP+S +  FL DP MA +CQ YV LP +S++  + L            
Sbjct: 297 VLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHSAFNG 356

Query: 345 XXXXXXXXXXTGVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPGAGRSDDHT--- 401
                     T +                                 +   G S++     
Sbjct: 357 DIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNFYKNKKQSESSISTGNSNNGQNIH 416

Query: 402 IYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYP 461
            + PTR +LFDLYRSLSQGITL++WY  N   IR N IDVR+FI FG +++IIYR  +Y 
Sbjct: 417 KHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFITFGVLRRIIYRCETYS 476

Query: 462 V------------LEKRRNSIIAKQMGK-------------------SKMAEKAPHSKNA 490
           V            L +  N I  + + K                    K++ K P SK A
Sbjct: 477 VINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMNAYKKLSLKVP-SKGA 535

Query: 491 FFS--TSDIKFD---DGDRLFNSLY---ARFSKVSFEKRRENARERKSFDAVGGTNGADK 542
             S  TS   F        + NS      R SKVSFE   E   +R  F          +
Sbjct: 536 LKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPE---DRNGFRWGSNIKTPIQ 592

Query: 543 ETMI--LTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594
           ET    L+K ++  +L AL + E+ DKICV L   R  + N++ ++GE ++INC
Sbjct: 593 ETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGELKLINC 646

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  415 bits (1067), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 208/357 (58%), Positives = 260/357 (72%), Gaps = 21/357 (5%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M+S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+  KNYIIPKP LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T KYG YRIV YPV + S                PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKLPFDN------------NSAKNQAPLTHALISK-TKSFSPD 167
           Q+Q+LS++ERD   F    L                N + N  P TH    K TK     
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTP-THPTSEKDTKDMRSS 179

Query: 168 KKTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVH 221
           + ++   D+ L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  
Sbjct: 180 RYSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC- 238

Query: 222 LSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLI 281
           +S+EDVP+  V LKKIID+NWDPTM+SI+P+I+G+NSI  I++LS+SDP LVIECI+HLI
Sbjct: 239 VSLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLI 298

Query: 282 YYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSV 338
           YYKCV ++DIFQFSNIYAPSSLI  FLTDP MA DCQ YVT P+ S++ ++PL  S+
Sbjct: 299 YYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSL 355

 Score =  115 bits (288), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 112/200 (56%), Gaps = 25/200 (12%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           + PTR  LFDLYRSLSQG TL+ WY + +  ++ N ID+R+FI FG  K+IIYR  S+PV
Sbjct: 431 FLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKRIIYRCYSFPV 490

Query: 463 L-------EKRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFS 514
           +        K    II K +    K+ EK  H  N   S +  +  +  +  N    R S
Sbjct: 491 MINAGSREPKEMTPIITKDLVNNDKLLEKRNH--NHLLSATGSR--NTAQSGNLKPERPS 546

Query: 515 KVSFEKRRENARERKSFDAVGGTNGADKETM-ILTKEEKLQLLGALDNLESFDKICVQLG 573
           KVSFE +R ++       A G      K TM  L+ EE+  L  ++ N E+FDKICV L 
Sbjct: 547 KVSFEMQRVSSL------ATG------KSTMPKLSDEEEGILEESIRNAETFDKICVLLS 594

Query: 574 RSRVEIANLIADIGEYRVIN 593
           + ++E+ + + ++GE++VIN
Sbjct: 595 KPKLEVESYLNELGEFKVIN 614

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  413 bits (1061), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 206/359 (57%), Positives = 257/359 (71%), Gaps = 26/359 (7%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+ + INF+ IKNYIIPKP LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T KYG YRIV YPV + S                PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKL------------PFDNNSAKNQAPLTHALISK------TK 162
           Q+Q+LS++ERD   F    +            P  +N + N  P TH    K      + 
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTP-THPTSDKDAKDLRSN 179

Query: 163 SFSPDKKTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINP 216
            F+ +K  +   D+ L     S+QDL+MRI+QDLNNYSECLIPID+GNA+DIKIFPL+ P
Sbjct: 180 RFNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRP 239

Query: 217 PTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIEC 276
           PT+  +S+EDVP+  V LKKIID+NWDPTM+ I+P+I+G+NSI  I++ S SDP LVIEC
Sbjct: 240 PTTC-VSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIEC 298

Query: 277 IKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335
           I+HLIYYKCV ++DIFQFSNIYAPSSLI  FLTDP MA DCQ YVT P+ S+L ++PL 
Sbjct: 299 IRHLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLN 357

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/197 (39%), Positives = 110/197 (55%), Gaps = 20/197 (10%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           + PTR  LFDLYRSLSQG TL+ WY   FTT++ N ID+R+FI FG  + IIYR  S+PV
Sbjct: 436 FLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITFGLERSIIYRCYSFPV 495

Query: 463 LEKRRNSIIAKQMGKSKMAEKAPHSKNAFFSTSD------IKFDDGDRLFNSLYARFSKV 516
           +     S   K+M  + +A K P +++      D      +         N    R SKV
Sbjct: 496 M-IHVGSRDTKEM--TPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTTQTNVKSERPSKV 552

Query: 517 SFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLGRSR 576
           SFE +R N+          G N   K    L+ EEK  L  ++ + E+FDKICV LG+S+
Sbjct: 553 SFEMQRANS-------LATGKNKIPK----LSDEEKKILEKSIRSAENFDKICVLLGKSK 601

Query: 577 VEIANLIADIGEYRVIN 593
            E+ N ++++GE++VIN
Sbjct: 602 QEVENYLSELGEFKVIN 618

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  412 bits (1060), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 200/347 (57%), Positives = 251/347 (72%), Gaps = 11/347 (3%)

Query: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61
           ++ FEGF+PIHT+FY+IFHPTEG+KVCY+FPP NL ++ INFD IKNYIIPK QLC+RLL
Sbjct: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68

Query: 62  TMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEEQ 121
           T KY NYRIVSYP+ + +                PYEC TSPYEP+I RLGKMF++LEEQ
Sbjct: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128

Query: 122 SQVLSRAERDDSLFKGDKLPFD---------NNSAKNQAPLTHALISKTKSFSPD--KKT 170
           SQ+LS+AE D   FK D +P +         + S +N+    H   +    F  D   + 
Sbjct: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQISPSHRNKRNNDHNDNNDGSRFETDFFGEE 188

Query: 171 EGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPML 230
           E  +   SVQDLIMRIYQDLNNYSECLIPID+GN I+IK+FPL+ PP +  +S+EDVPM 
Sbjct: 189 EDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPNHLISLEDVPMS 248

Query: 231 VVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITD 290
           ++ L  +ID+NWDPTM++I+P+INGVN I  IA+L+ +DP LVIECIKHL+YY CVIITD
Sbjct: 249 LINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKHLVYYNCVIITD 308

Query: 291 IFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTS 337
           IFQFSN+YAP+SLI  FLTD  MA  CQ YV LP  S+L H+P + +
Sbjct: 309 IFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN 355

 Score =  126 bits (317), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 115/209 (55%), Gaps = 26/209 (12%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           + PT+  LFDLYRSLS G+TL  WY +N T I  N +DVRKFI+FG I+ +IYR  SYP+
Sbjct: 413 HLPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPI 472

Query: 463 LEKRRNSIIAK------------QMGKSKMAEK--APHSKNAFFSTSDIKFDDGDRLFNS 508
            ++  N  I +            Q+  S  A +  +     +  S S I  D  D L  +
Sbjct: 473 PQRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKN 532

Query: 509 LY---ARFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESF 565
           +Y    R SKVSF  + +N  E    D  G  +        +TKEE+  LL ++++LE+ 
Sbjct: 533 VYKKLERHSKVSFMDKEKN--ESMKTDEKGRPS-------TMTKEERSVLLKSIESLENL 583

Query: 566 DKICVQLGRSRVEIANLIADIGEYRVINC 594
           DKICV+LG+SR ++   + ++G Y++I C
Sbjct: 584 DKICVKLGKSRQQVERWLDELGNYKIITC 612

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  412 bits (1058), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 202/356 (56%), Positives = 253/356 (71%), Gaps = 19/356 (5%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+ IKNYIIPKP LCH+L
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T KYG YRIV YPV + S                PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKL------------PFDNNSAKNQAPLTHALISKTKSFSPDK 168
           Q+Q+LS++E+D   F    L            P  +N + N  P         K     +
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 169 KTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHL 222
             +   D+ L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  +
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239

Query: 223 SIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIY 282
           S+EDVP+  V LKKIID+NWDPTM+SI+P+I+G+NSI  I++LS SDP LVIECI+HLIY
Sbjct: 240 SLEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIY 299

Query: 283 YKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSV 338
           YKCV ++DIFQFSNIYAPSSLI  FLTD  MA DCQ YV  P+ S++  +PL  ++
Sbjct: 300 YKCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNL 355

 Score =  119 bits (298), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 108/201 (53%), Gaps = 15/201 (7%)

Query: 397 SDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYR 456
           +D+   + PTR  LFDLYRSLSQG TL+ WY +    ++ N IDVR+FI FG  ++IIYR
Sbjct: 425 NDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERRIIYR 484

Query: 457 VLSYPVL----EKRRNSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYAR 512
             S+PV+     + R  +    +  S   +++   KN   S S +   +  +  N    R
Sbjct: 485 CYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNVKSER 544

Query: 513 FSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQL 572
            SKVSFE +R            G     +     L+ EE+  L  ++ + ESFD ICV L
Sbjct: 545 PSKVSFEMQR-----------AGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLL 593

Query: 573 GRSRVEIANLIADIGEYRVIN 593
            +S++E+ N + ++GE++VIN
Sbjct: 594 SKSKLEVENYLNELGEFKVIN 614

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score =  411 bits (1056), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/357 (57%), Positives = 259/357 (72%), Gaps = 21/357 (5%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M+S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+ IKNYIIPKP LCH+L
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T KYG YRIV YPV + S                PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKL------------PFDNNSAKNQAPLTHALISK-TKSFSPD 167
           Q+Q+LS++E+D   F    L            P  +N++ N  P TH    K  K     
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTP-THPTSDKDAKDLRNS 179

Query: 168 KKTE--GDIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVH 221
           +  +   D  L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  
Sbjct: 180 RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC- 238

Query: 222 LSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLI 281
           +S+EDVP+  V L+KIID+NWDPTM++I+P+I+G+NSI  I++LS+SDP LVIECI+HLI
Sbjct: 239 VSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLI 298

Query: 282 YYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSV 338
           YYKCV ++DIFQFSNIYAPSS I  FLTDP MA DCQ YVT P+ S++  +PL  ++
Sbjct: 299 YYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNL 355

 Score =  119 bits (297), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/206 (37%), Positives = 120/206 (58%), Gaps = 25/206 (12%)

Query: 397 SDDHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYR 456
           S++   + PTR  LFDLYRSLSQG TL+ WY + +  I+ N ID+R+FI FG  K+IIYR
Sbjct: 425 SNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYR 484

Query: 457 VLSYPVL-------EKRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNS 508
             SYPV+        K    IIAK    +S  +EK  H      S S I+  +   LFN+
Sbjct: 485 SYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEH----SFSIIRSKNA-VLFNN 539

Query: 509 LYA-RFSKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDK 567
           + + R SKVSF+ ++ ++        + G +   K    L+ +E+  L  ++ + E+FDK
Sbjct: 540 IKSGRPSKVSFDMQKASS-------LITGESTIPK----LSDDEERILEESVRSAENFDK 588

Query: 568 ICVQLGRSRVEIANLIADIGEYRVIN 593
           ICV LG+ ++E+ N + ++GE+++IN
Sbjct: 589 ICVLLGKPKLEVENYLNELGEFKIIN 614

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  410 bits (1054), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 251/344 (72%), Gaps = 12/344 (3%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M  +FEGFVPIHTLFY +FHPT+G++V Y++PPGNL++ +INFDAIKNYIIPKPQLCH+L
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT+KY  YRIV YPV V S                PY+C TS YEPAI RLGKMFRVLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKN---QAPLTHALISKTKSFSPDK------KTE 171
           Q+Q+LS+AE D   F  D    DN + ++    A  +   ++K++  +  K        E
Sbjct: 135 QNQILSKAENDPIYF--DFKLADNTTEQDGKLNAEKSFKGLTKSQGMALAKYNEIMKDLE 192

Query: 172 GDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLV 231
            +    SVQDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL  PP S  +SIEDVP+  
Sbjct: 193 SEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTPPNSC-ISIEDVPIST 251

Query: 232 VKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDI 291
           V LK IID+NWDPTM+ I+P+I+G+NSI  IA+LSDSD  LV+EC+KHL+YY CVI+ DI
Sbjct: 252 VNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECVKHLVYYNCVILADI 311

Query: 292 FQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335
           FQFSNIYAP+SLI +FLTDPT+A +CQ +VTL   S L  MP +
Sbjct: 312 FQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFE 355

 Score =  111 bits (277), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 119/265 (44%), Gaps = 75/265 (28%)

Query: 399 DHTIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVL 458
           D   + PT+  LFDLYR+LSQG+T+ +WY  N+ TI+ N IDVR+FI FG IK +IYR  
Sbjct: 421 DLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFITFGVIKGLIYRCF 480

Query: 459 SYPVLEKRR--------------NSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKFDDG-- 502
           S+PV++K                N +  K  G+  +AE         FSTSD+K  +G  
Sbjct: 481 SFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESK-----YVFSTSDMKLGEGSK 535

Query: 503 ----------DRLFNSLYARFSKVSFEKRREN------ARERK--SFDAVGGTN------ 538
                     D +  ++Y + S  +    R++       RE    S  A+ G N      
Sbjct: 536 MHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGDNVSHPKK 595

Query: 539 -------------------------GADKETMI-----LTKEEKLQLLGALDNLESFDKI 568
                                    G +KE            +K+ LL ++   +  DKI
Sbjct: 596 PERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAAADCLDKI 655

Query: 569 CVQLGRSRVEIANLIADIGEYRVIN 593
           CV+L + R E+  L+ ++G+Y++IN
Sbjct: 656 CVKLEKPRHEVEELLHELGDYKIIN 680

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  409 bits (1052), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 196/342 (57%), Positives = 254/342 (74%), Gaps = 8/342 (2%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M  +FEGF+PIHT+FY +FHPTEG+KV Y+FPPGNL+ ++INFDAIKNYIIPKPQLCH+L
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT+KY NYRI SYPV V S                PY+C TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKLPF-DNNSAKNQAPLTHALISKTKSFSPDK--KTEGDIH-- 175
           Q+ +LS+AE+D   +   ++   D+  AK++       +SK+++++ +K  K   DI   
Sbjct: 121 QNLILSKAEKDPIFYHFKQVEIKDDQDAKSKPEKGSHNLSKSQAYASEKYHKIMTDIESA 180

Query: 176 --LISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVK 233
               S++DL++R+YQDLNNYSECLIPIDEGNA+DIKIFP++ PP S ++SIEDVP+  V 
Sbjct: 181 DSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTPPNS-NISIEDVPVSTVN 239

Query: 234 LKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQ 293
           L K+ID+NWDPTM+ I+P+ING+NSI  IA+LS SDP LVIECIKHLIYY CV++ DIFQ
Sbjct: 240 LNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECIKHLIYYNCVLLADIFQ 299

Query: 294 FSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335
           FSNIYAP+S +  FLTD  ++ +CQ YV   + S L  +P +
Sbjct: 300 FSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFK 341

 Score =  123 bits (309), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 80/259 (30%), Positives = 120/259 (46%), Gaps = 68/259 (26%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           Y PT+  LFDLYRSLSQG +L +WY  ++ TIR+N IDVR+FI FG I  +IYR  SYP+
Sbjct: 420 YLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFITFGVINGLIYRCYSYPI 479

Query: 463 LEKRRNSIIAKQMGKSKMA------EKAPHSKNAFFSTSDIKF----------------- 499
           ++      +AK++ +  ++       KA +     FSTSDIKF                 
Sbjct: 480 MKNLEIFDLAKRLHREDISNHTVKHNKAKNPSKNIFSTSDIKFGVEYERQRNKHHKALNL 539

Query: 500 DDGDRLFNSLYARF---------------------------------------------S 514
           D  D +  ++Y +                                              S
Sbjct: 540 DIADEVLRNVYKKLSVTNSTDTRPNSADPIARLYRERSLGSLADGSTNNIYRLQNSDRPS 599

Query: 515 KVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLGR 574
           KVSF+K++E     K   +       D+E  +  +E  L LL +++  +S D ICV+L  
Sbjct: 600 KVSFDKQQEIGHISKGMSSSNDKVKMDEEAKLERRERDLILLESVEAADSLDTICVKLEM 659

Query: 575 SRVEIANLIADIGEYRVIN 593
           SR ++  LI ++GEY++IN
Sbjct: 660 SRYDVEALIQNLGEYKIIN 678

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  402 bits (1033), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 201/353 (56%), Positives = 252/353 (71%), Gaps = 19/353 (5%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M+  FEGFVPIHT+FY+IFHPTEG+KV Y+FPPGNLQ Y+INFD IKNYIIPKPQLCH+L
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT+KYG+YR+VSYPV + SS               P  C TSPYEP I RLGKMFRVLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDK--LPFDNNSAKNQAPLTHALISKTKSFS------------- 165
           Q+Q+LSRAE D   F      L  + +S  +Q   T  L    K FS             
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIMHQDKNTSILGFSRKRFSFSKRPTDLSLSEY 180

Query: 166 PDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225
           PD ++  +    SVQDLIMRI+QDLNNYSECLIPIDEGN++DIKIFP + PP S+ +S E
Sbjct: 181 PDNESGSNF---SVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPP-SISISYE 236

Query: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285
           DVP+ +V L  ++D+NWDPTM+ I+PFI+ +NSI  IA LS+SD + V+ECI+HL+YY+ 
Sbjct: 237 DVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRHLVYYQL 296

Query: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSV 338
           VI++DIFQF+NIYAP+S + +FLTD  +A DCQ YV LPK+S    +PL+ S+
Sbjct: 297 VILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSI 349

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/62 (46%), Positives = 43/62 (69%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           Y PT+  LFDLYRSLSQG  L  WY  +++ I  N ID+R+FI FG ++ ++YR  + P+
Sbjct: 405 YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464

Query: 463 LE 464
           ++
Sbjct: 465 MK 466

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 49/84 (58%), Gaps = 3/84 (3%)

Query: 514 SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEE---KLQLLGALDNLESFDKICV 570
           +KVSF   R++   + + D +     + K+ +   +E+   +  LL +L   ++ DKIC+
Sbjct: 627 NKVSFNLSRDSDTTQNNLDHMNPILDSSKDIIAQQQEKNHIRRLLLESLREADNMDKICI 686

Query: 571 QLGRSRVEIANLIADIGEYRVINC 594
           +L + R E+  L+++IG+Y +INC
Sbjct: 687 KLQKPRKEVEELLSEIGDYVIINC 710

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  400 bits (1027), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 205/381 (53%), Positives = 249/381 (65%), Gaps = 52/381 (13%)

Query: 2   MSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRLL 61
           ++ FEGF+PIHT+FY+IFHPTEG+KV Y+FPP NL   DI+FDAIKNYIIPK QLC++LL
Sbjct: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69

Query: 62  TMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEEQ 121
           T KY NYRIVSYP+ + S                PY+C TSPYEPAI RLGKMF+VLEEQ
Sbjct: 70  TFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQ 129

Query: 122 SQVLSRAERDDSLFKGDKLPF----------DNNSAKNQAPLTHALISKTKS-FSPDKKT 170
           +Q+LS+AE D   FK D  P+          DN+  +N+      L+ K  + FS  ++ 
Sbjct: 130 NQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKK-----LMKKENTIFSTRQQR 184

Query: 171 EGDIHL------------------------------------ISVQDLIMRIYQDLNNYS 194
                +                                    ISVQDLIMRIYQDLNNYS
Sbjct: 185 SNSNRILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYS 244

Query: 195 ECLIPIDEGNAIDIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFIN 254
           ECLIPID+GN +DIKIFPL+ PP +  LSIEDVPM +V L KI D+NWDPTM+ ++PFIN
Sbjct: 245 ECLIPIDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFIN 304

Query: 255 GVNSILNIARLSDSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMA 314
           G+N I  I++LS+S P LVIECIKHLIYY CVIITDIFQFSN Y+ +SLI+ FLTDP MA
Sbjct: 305 GINDISKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMA 364

Query: 315 YDCQEYVTLPKSSRLIHMPLQ 335
             CQ YV LP  S+L  +P  
Sbjct: 365 TLCQNYVVLPLGSKLTRLPFH 385

 Score =  124 bits (310), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 78/221 (35%), Positives = 117/221 (52%), Gaps = 31/221 (14%)

Query: 401 TIYYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSY 460
           T + PT+M LF+LYRSL+Q   L+ WY  N+TTI  N ID+RKFI+FG IK +IYR  SY
Sbjct: 450 TAHLPTKMSLFELYRSLNQRTDLKNWYKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSY 509

Query: 461 PVLEKRRNSIIAKQMGKS-----------------KMAEKAPHSK----NAFFSTSDIKF 499
           P++      + A +  KS                 +  +K P S+     +   +S ++ 
Sbjct: 510 PIVITP--VVSAPESAKSTSPFVSSSGISSSVDSKQHTQKGPISRFPGLGSHVPSSGVR- 566

Query: 500 DDGDRLFNSLYARF------SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKL 553
           D  D+L  S Y +       SKVSF  +     +     A    N  DK    LT +++ 
Sbjct: 567 DTRDKLMKSFYEKLEKGKNHSKVSFSDKIAFQNDENDHSATSSDND-DKSKSQLTLKQRN 625

Query: 554 QLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594
            LL ++ N+++ DKICV+LGR R +I   +++ G+Y+VINC
Sbjct: 626 ILLDSISNMDNMDKICVKLGRPRSQIEEWLSEFGDYKVINC 666

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  376 bits (966), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 186/351 (52%), Positives = 239/351 (68%), Gaps = 18/351 (5%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M   F+GFVP+H +FY++FHPTEG+KV +QFP G L+  DI FD IKNY+IPKPQLC++L
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT KYG +R+V YPV V +                PY+CATSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QSQVLSRAERDDSLF----------------KGDKLPFDNNSAKNQAPLTHALISKTKSF 164
           QSQ+LS+AE     F                KG + P   +  +   P      S  K +
Sbjct: 121 QSQILSKAENSSVYFQLKARNTQKHGNTETAKGTEQPSSLDIGEIAQPENQGYAS-AKYY 179

Query: 165 SPDKKTEGDIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSI 224
              K  EG    I++ DLI +IY+DLN+YSECLIPID GNA+DIK+FPL++PP+S   SI
Sbjct: 180 EILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSC-FSI 238

Query: 225 EDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYK 284
           EDVP+  V L K+ID+NWDPTM+ I+P ING+NSI  +A+ SDSD  LV+ECIKHLIYY 
Sbjct: 239 EDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYYN 298

Query: 285 CVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335
           CVI+TDIFQFSNIYA ++ ++ FLT+PT+A +CQ YV   +S+ L ++P +
Sbjct: 299 CVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFE 349

 Score = 90.1 bits (222), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 121/260 (46%), Gaps = 71/260 (27%)

Query: 404 YPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVL 463
           + ++  LFDLYRSL+QG T+ +WY T+F  IR+  IDVR+FI FG +  +IYR  SYPVL
Sbjct: 431 FTSKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVL 490

Query: 464 EKRRNSIIAKQMGKSKMAEKAPHSK--------NAFFSTSDIKF---------------- 499
                +   + +G +  +  A +          N   S +DI+                 
Sbjct: 491 RNIGFAESVEALGATNHSRYAKYKHLLKTNQPLNNVLSAADIRIGLENAGFKARSEKLKQ 550

Query: 500 ----DDGDRLFNSLYARF-----------------SKVSFEKRRENARE---RKSFDAVG 535
               D  + + + +Y +                  SKV F +  E++ +   R+S +++G
Sbjct: 551 HSTADAAEEVLSDVYRKLALSDKKTDHVAQGNNPISKV-FGRNSEDSTDISTRESANSMG 609

Query: 536 ---------------GTNGAD--KETMIL-----TKEEKLQLLGALDNLESFDKICVQLG 573
                           T+ AD  + + IL      + E+L LL ++ ++ +FDKIC  LG
Sbjct: 610 SDIKNKVAFDVRKTLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDKICTLLG 669

Query: 574 RSRVEIANLIADIGEYRVIN 593
           + R  + ++++++G Y V++
Sbjct: 670 KDRERVESMLSELGPYNVLH 689

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  375 bits (963), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 188/336 (55%), Positives = 245/336 (72%), Gaps = 22/336 (6%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M S F+GFVPIHT+FYT+FHPTEGSKV +QFPP +L++  I+FD IKNYIIPKPQLC++L
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT KYG YRIV YPV V +                PY+CATSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEGD-----IH 175
           QSQ+LS++E++   F+   L  ++++A +Q+     + S T S   D K+ GD     + 
Sbjct: 121 QSQILSKSEQNPVYFQ---LKSNDSNAADQST---EMGSITISEHTDIKSTGDDGEKYLE 174

Query: 176 LIS----------VQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIE 225
           +I           ++DL+M+++ DLNNYSECLIPIDEGN+IDIK+FP+  PP+S ++S+E
Sbjct: 175 IIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSS-NISVE 233

Query: 226 DVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKC 285
           DVP+ VV L  IID+NWDPTMV I+P+ING+NS+  IA  + SD ELV ECIKHL+YY C
Sbjct: 234 DVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYYNC 293

Query: 286 VIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYV 321
           VI++DIFQFSNIYAP+S I+ FLT+P +A  CQ +V
Sbjct: 294 VILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV 329

 Score =  112 bits (280), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 113/243 (46%), Gaps = 56/243 (23%)

Query: 405 PTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLE 464
           PTR  LFDLY+SLSQG T++ WY  NF  IR N IDVRK I FG  +++IYRV SYP+++
Sbjct: 419 PTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIVK 478

Query: 465 KRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTSDI-------------KFDDGDRLFNSLY 510
                 I K +  K         S    FS +DI             K D  D L  SLY
Sbjct: 479 NVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADELLKSLY 538

Query: 511 -------------ARFSKVSFEKRRENA-------------RERKSFDAVGGTNGADKET 544
                        ++F++   +    NA              ++ SFD   GT G  K  
Sbjct: 539 QKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDF--GTAGQQKTV 596

Query: 545 MIL--------------TKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYR 590
             +               KEE+L LL +L N E+FDK+C +L +SR E+  L+ D+G Y 
Sbjct: 597 TEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYN 656

Query: 591 VIN 593
           ++N
Sbjct: 657 IVN 659

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  370 bits (950), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 186/349 (53%), Positives = 246/349 (70%), Gaps = 15/349 (4%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M + F+GFVPIH++FY++FHPTEG+KV +QFPP +L++  I+FD IKNY+IPKPQLC++L
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT KYG+YR+V YPV + +S               PY+ ATSPYEPAI RLGKMFRVLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QSQVLSRAERDD---SLFKGDKLPFDNNS----AKNQAPLTHALISKTK-SFSPDKKTEG 172
           QSQVLS+ ERD     L   D    D NS    +KN     +  I +     + +K  E 
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEKYHEI 180

Query: 173 DIHL------ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLSIED 226
             H+      +S++DLI ++Y+DLNNYSECLIP+D GNAIDIK+FPL+ PP S   S+ED
Sbjct: 181 MKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPPNSC-FSVED 239

Query: 227 VPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCV 286
           VP+  + L   +D+NWDPTMV I+P+ING+NSI  I++ SDSD  LV+EC+KHLIYY CV
Sbjct: 240 VPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVKHLIYYDCV 299

Query: 287 IITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQ 335
           ++ D+FQFSNIYAP+S ++EFLTDP++A +CQ YV   + S L  +P +
Sbjct: 300 VLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPFE 348

 Score =  105 bits (263), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 81/257 (31%), Positives = 113/257 (43%), Gaps = 78/257 (30%)

Query: 405 PTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPVLE 464
           PTR  LFDLYRSLSQG T++ WY  NF  IR N IDVR+FI FG  +K+IYR  SYPV  
Sbjct: 427 PTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYPV-- 484

Query: 465 KRRNSIIAKQMGKSKMAEK-----------APHSKNA--FFSTSDIKFDDG--------- 502
                  AK +G   M ++           +P + N+   FST+DI  D G         
Sbjct: 485 -------AKSIGTLDMLKRFDYASLPNNFMSPKNNNSNNVFSTADICVDFGEPSQFRKKP 537

Query: 503 --------DRLFNSLYARFS----------------KVSFEK-RRENARERKSFDAVGGT 537
                   D +    Y + S                K+S E     N   RK   +  GT
Sbjct: 538 LVPNTDAADEVLRDAYKKLSLNERLPNPLDQITRSKKLSLENDASANVDNRKLSSSTSGT 597

Query: 538 ---------------------NGADKETMILTKEEKLQLLGALDNLESFDKICVQLGRSR 576
                                N A  E +   ++++  LL ++ N++SFDKI ++L  ++
Sbjct: 598 AKVLFDMKDRLSNKDFEYRDQNAASTE-LKRKRQQQFLLLKSIKNVDSFDKIAIKLEINK 656

Query: 577 VEIANLIADIGEYRVIN 593
            E+  L+   GEY +IN
Sbjct: 657 QEVEELLKATGEYNIIN 673

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  370 bits (950), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/369 (50%), Positives = 241/369 (65%), Gaps = 35/369 (9%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M + F+GFVPIH +FY++FHPTEG+KV Y+FPP NL    INFDAIKNY+IPKPQLCH+L
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           LT+KY NYRIV YP+ + SS               PYEC TSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSF---------------- 164
           Q Q LS+ E+D + F    +    +  K+     + ++SKT S                 
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 165 SPDKKTEGDIHL------------------ISVQDLIMRIYQDLNNYSECLIPIDEGNAI 206
           + DK    ++                    +S+ D++MR++QDLN+YSEC IPID+GNAI
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 207 DIKIFPLINPPTSVHLSIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLS 266
           DIK+FP + PP    +S+EDVP+  V L KIID+NWDPTM+ I+P+I+G+NSI  IA LS
Sbjct: 241 DIKLFPTLMPPID-SISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLS 299

Query: 267 DSDPELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKS 326
           +SD  LVIECI+H +YY CVI++DIFQFSNIYAP+S I +FLTDPT+A +CQ YVT P+ 
Sbjct: 300 NSDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPED 359

Query: 327 SRLIHMPLQ 335
           S L  +P +
Sbjct: 360 SLLSALPFK 368

 Score =  108 bits (269), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 85/229 (37%), Positives = 120/229 (52%), Gaps = 37/229 (16%)

Query: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462
           Y PT+  LFDLYRSLSQG+ LE+WY  NF +IR N+ID+R+FI FG IK+IIYR  SYP+
Sbjct: 447 YLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPL 506

Query: 463 LEK-----RRNSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKF-----------------D 500
            +      + N +   Q G   +  K+       FSTSDIKF                 D
Sbjct: 507 PKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVD 566

Query: 501 DGDRLFNSLYARFS-----KVSFEKRREN----ARERKSFDA--VGGTNGADKETMILTK 549
             DR+ N++Y + S       S   + ++    A + +S+D    G  N    E    ++
Sbjct: 567 VADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFSR 626

Query: 550 E----EKLQLLGALDNLESFDKICVQLGRSRVEIANLIADIGEYRVINC 594
           E    +K+ LL AL + E+ D IC  L  SR E+  L+ ++ EYR+INC
Sbjct: 627 EININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIINC 675

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  363 bits (931), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 240/693 (34%), Positives = 342/693 (49%), Gaps = 121/693 (17%)

Query: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60
           M +KF+GFVPIH +FY +FHPTEG+KV +QFP  +L+   I FD IKNY+IPK QLC++L
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  LTMKYGNYRIVSYPVAVQSSSXXXXXXXXXXXXXXPYECATSPYEPAITRLGKMFRVLEE 120
           +T K+G+YR+V YPV +++                PY+ ATSPYEPAI RL KM RVLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QSQVLSRAERDDSLFKGDKLPFDNNSAKNQAPLTHALISKTKSFSPDKKTEG-------- 172
           QSQ+LS+ ERD   ++           K     T    SK K+ + DKK+          
Sbjct: 128 QSQMLSKVERDPVYYQ-----LKTGETKAAEQKTEESDSKAKTHNLDKKSRAQHNATTKY 182

Query: 173 ---------DIHLISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHLS 223
                    D   + ++DLI ++Y+DLNNYSECLIP+D GNAIDIK+FPL+ PP S  LS
Sbjct: 183 HEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC-LS 241

Query: 224 IEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYY 283
            EDVP+  V L  ++D+NWDPTM+ I+PFING+NSI  I++ SDS  ELV+ECIKHL+YY
Sbjct: 242 FEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLVYY 301

Query: 284 KCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSVPGXXX 343
            CV + D+FQFSNIYAP++L+ +FL D  +  +CQ YV   +   +  +P ++   G   
Sbjct: 302 DCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGGHS 361

Query: 344 XXXXXXXXXXXTGVLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGTPGAGRSDDHTIY 403
                      T  L                                T    +S+    Y
Sbjct: 362 RNQTASTNTVYT--LRRTTSTNRADSFSSNAEFSQKSSGISSLAQSFT----QSNKDYYY 415

Query: 404 YPTRMVLFDLYRSLSQGITLEKWYT--TNFTTIR----SNYIDVR-------KFIQFGTI 450
             +R +  +  R+L     L   Y   T   T++    +NY  +R       + I FG  
Sbjct: 416 NRSRNLESNCKRTLPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVF 475

Query: 451 KKIIYRVLSYPVLEKRRNSIIAKQMGKSKMAEK-------------APHSKNAFFSTSDI 497
            ++IYR  SYPV         AK +G  ++ ++                + N  FSTSDI
Sbjct: 476 HRLIYRCYSYPV---------AKSIGTLELLKRFDYVSTTDNFIPTGTSAGNNVFSTSDI 526

Query: 498 KFD-DGDRLFNSL--YARFSKVSFEKRRENARE--------------RKSFDAVGGTNGA 540
           + D DG     ++  +   S V+ E  RE  ++               K + A      A
Sbjct: 527 RVDFDGSSRSRNIPPFLNSSDVAEEVLRETYQKLSIKDILNDSIDPIAKGYQAPSDNEAA 586

Query: 541 DKETM-------------------------------------ILTKEEKLQ---LLGALD 560
            K T                                      +L K+++LQ   LL ++ 
Sbjct: 587 MKGTSRKQSMSTLNTTRITFDIRNRHVSKDNEHREQQNEDIPLLLKKKRLQEFLLLQSVK 646

Query: 561 NLESFDKICVQLGRSRVEIANLIADIGEYRVIN 593
           +++SFDKI V+L  ++ E+  L+   GEY ++N
Sbjct: 647 SVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVN 679

>YBR103W Chr2 (447709..449316) [1608 bp, 535 aa] {ON}  SIF2WD40
           repeat-containing subunit of the Set3C histone
           deacetylase complex, which represses early/middle
           sporulation genes; antagonizes telomeric silencing;
           binds specifically to the Sir4p N-terminus
          Length = 535

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 44/99 (44%), Gaps = 8/99 (8%)

Query: 231 VVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIYYKCVIITD 290
           +VKL  I+   W+P   SIL +    NS+  +AR+ ++D E          Y+K  II +
Sbjct: 154 IVKLDNIVSSTWNPLDESILAY-GEKNSVARLARIVETDQE-------GKKYWKLTIIAE 205

Query: 291 IFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRL 329
           +     + A S      +T    ++D    VT  ++  L
Sbjct: 206 LRHPFALSASSGKTTNQVTCLAWSHDGNSIVTGVENGEL 244

>KNAG0C00510 Chr3 complement(82961..85303) [2343 bp, 780 aa] {ON}
           Anc_1.45 YCL030C
          Length = 780

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 271 ELVIECIKHLIYYKCVIITDIFQFSNIYAPSSLI 304
           E+V +CI H    KC    + F  SN YAP  LI
Sbjct: 638 EIVRKCISHSTIIKCDSYEEAFDMSNQYAPEHLI 671

>NDAI0D03150 Chr4 (749402..752968) [3567 bp, 1188 aa] {ON} 
          Length = 1188

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 29/125 (23%), Positives = 56/125 (44%), Gaps = 17/125 (13%)

Query: 467 RNSIIAKQMGKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYARFSKVSFEKRRENAR 526
           +N  I ++  K K  E A  +K  F S ++    DG+ +      + S ++    R N +
Sbjct: 74  KNGTIRRKSPKKKDKEVAVENK-KFISLNETSSGDGEEIACETKKKKSLIADTTLRSNIQ 132

Query: 527 ERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLGRSRVEIANLIADI 586
           E+++ D +G + G   +       +K           +FD + +Q G+++VE       +
Sbjct: 133 EKENVDLIGQSGGLSDDFKNFNIPDK-----------AFDLVHLQKGQNKVE-----EPL 176

Query: 587 GEYRV 591
           GEY+V
Sbjct: 177 GEYKV 181

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 58,435,680
Number of extensions: 2527880
Number of successful extensions: 6942
Number of sequences better than 10.0: 29
Number of HSP's gapped: 7070
Number of HSP's successfully gapped: 58
Length of query: 594
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 479
Effective length of database: 40,294,809
Effective search space: 19301213511
Effective search space used: 19301213511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)