Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M011306.16ON95095047280.0
KAFR0L003706.16ON96393818820.0
TDEL0G045306.16ON95893218590.0
KLTH0C11330g6.16ON94194316330.0
Kwal_56.224036.16ON94378416300.0
TPHA0M002406.16ON93984115950.0
Ecym_30206.16ON94494715370.0
ACR010C6.16ON94587015200.0
NCAS0H008806.16ON100458313501e-170
YEL061C (CIN8)6.16ON100060313171e-165
Skud_5.286.16ON99870713171e-165
Smik_5.266.16ON100271513151e-165
NDAI0D008706.16ON106969113191e-165
Suva_5.66.16ON99960213061e-164
ZYRO0C07898g6.16ON97467212871e-161
Kpol_1032.66.16ON100455712221e-151
CAGL0B03641g6.16ON98862012011e-148
KLLA0D01045g6.16ON96557311471e-141
TBLA0A072306.16ON109758911541e-140
SAKL0E01078g6.16ON94862111271e-138
Kpol_1045.736.16ON96287810431e-126
ACR228C7.387ON11298738901e-102
SAKL0F12298g7.387ON11126868691e-100
Skud_2.417.387ON11107038681e-99
NCAS0E026407.387ON11027778442e-96
Ecym_46887.387ON11345528434e-96
KAFR0L017107.387ON11514828374e-95
TDEL0C016007.387ON11054698312e-94
YBL063W (KIP1)7.387ON11117148284e-94
NDAI0E043007.387ON11865318042e-90
TPHA0E008907.387ON12326687877e-88
TBLA0D006407.387ON11425006523e-70
TPHA0J003006.16ON9826295872e-62
Smik_2.537.387ON11133965743e-60
Suva_2.547.387ON11104435725e-60
ZYRO0B03234g7.387ON11383215558e-58
TPHA0D012708.678ON6963843405e-32
KLTH0G03850g5.531ON4731733282e-31
KLLA0B00759g5.531ON4562903263e-31
KAFR0H024108.678ON6583833307e-31
SAKL0G05016g5.531ON5041753231e-30
Kwal_47.186085.531ON4793043221e-30
SAKL0G18920g2.633ON6491743154e-29
TDEL0A062408.678ON6374443083e-28
Smik_6.3528.678ON7153983032e-27
Smik_7.483.528ON8051773023e-27
Skud_7.533.528ON8051773006e-27
YGL216W (KIP3)3.528ON8051772998e-27
Suva_7.443.528ON8051772988e-27
Ecym_40665.531ON4781742911e-26
KAFR0F042103.528ON6721772933e-26
Ecym_34152.633ON6622452862e-25
ADR145C2.633ON6352792852e-25
CAGL0I07029g3.528ON7051792791e-24
NCAS0E005503.528ON7841752792e-24
SAKL0F01760g3.528ON8091742783e-24
Kwal_47.190933.528ON8191752755e-24
TDEL0D059603.528ON7331442729e-24
ZYRO0E08668g3.528ON7781752711e-23
KNAG0B005203.528ON7231422702e-23
KLTH0G01606g3.528ON8191752693e-23
NDAI0I029603.528ON8681482676e-23
Kpol_423.83.528ON8061442666e-23
AER441C3.528ON8181452658e-23
TPHA0D034803.528ON8471932641e-22
TBLA0C049603.528ON8011812632e-22
Ecym_12003.528ON8331452622e-22
CAGL0D04994g3.479ON6921372603e-22
TPHA0D032003.479ON7241392603e-22
Kpol_505.393.479ON6921392577e-22
KAFR0B065903.479ON7061392577e-22
ZYRO0D12650g5.531ON4781782528e-22
KNAG0A078803.479ON7641342542e-21
Kpol_1050.1033.479ON6971332532e-21
KLLA0A01606g3.528ON7691462542e-21
TBLA0C039403.479ON7391752523e-21
YPR141C (KAR3)3.479ON7291332495e-21
ZYRO0B04290g3.479ON7311402479e-21
Skud_16.4353.479ON7291332452e-20
Suva_16.4693.479ON7311332442e-20
TDEL0F036403.479ON7041372442e-20
NCAS0F034703.479ON6981392442e-20
Smik_16.3883.479ON7291332443e-20
AGR253W3.479ON7091682433e-20
KLLA0B10956g3.479ON6901412424e-20
Kpol_1004.255.531ON5061932387e-20
SAKL0F03168g3.479ON7061342391e-19
NDAI0B057703.479ON7631472372e-19
ZYRO0F07414g8.678ON6541572335e-19
Kwal_26.88068.678ON7152522291e-18
TBLA0C053103.479ON6761912291e-18
KLTH0F14498g3.479ON7021392282e-18
Ecym_44073.479ON7111382273e-18
SAKL0H06490g8.678ON6571732263e-18
NCAS0C013508.678ON6551782254e-18
KLLA0D05951g8.678ON6682712211e-17
KNAG0J017208.678ON6251792201e-17
YPL155C (KIP2)8.678ON7061982202e-17
Kpol_1013.78.678ON6201452156e-17
NDAI0E02090singletonON6851602121e-16
TPHA0D041903.479ON6721322112e-16
ACR145W8.678ON6851692112e-16
CAGL0M02189g8.678ON6721922103e-16
Skud_16.1278.678ON7061652086e-16
KLTH0D11286g8.678ON6781472051e-15
TBLA0C018808.678ON4681392021e-15
TDEL0B072702.633ON6443202032e-15
Ecym_23958.678ON6871471996e-15
Kpol_1019.112.633ON6472541951e-14
Suva_16.1558.678ON7041981881e-13
YKL079W (SMY1)2.633ON6563571835e-13
TPHA0N016502.633ON6822561647e-11
Kwal_55.21164singletonOFF5881291612e-10
Kwal_YGOB_55.211643.479ON6571291602e-10
Smik_11.1602.633ON6562221602e-10
Suva_11.1452.633ON6573471584e-10
NCAS0H031802.633ON6604131559e-10
Skud_11.1482.633ON6563521513e-09
NDAI0C004802.633ON5981231451e-08
KAFR0C040202.633ON6673611406e-08
TBLA0A008202.633ON8031281372e-07
ZYRO0E01078g2.633ON6681731362e-07
KNAG0M025402.633ON5221221352e-07
TBLA0C008002.633ON6931331343e-07
CAGL0L05104g2.633ON6753801316e-07
TPHA0H016805.414ON989264920.032
NCAS0C052002.633ON57261850.21
KNAG0H003602.633ON681115830.39
NDAI0J005307.488ON138987810.59
KLTH0D08844g2.604ON340195790.85
KAFR0F030204.46ON824252791.0
TPHA0I029207.488ON1200130781.6
AFR669W1.82ON191887771.9
KNAG0M012605.123ON76655762.6
KNAG0L020805.696ON669161753.5
KNAG0F036507.488ON126494753.6
KLLA0A00286g1.295ON1224173744.6
NCAS0C028308.401ON87472744.7
YBL047C (EDE1)7.488ON138197744.8
KLTH0F16478g5.415ON13182695.0
KLLA0E05787g7.488ON1228104735.1
YNL272C (SEC2)1.81ON75963735.4
KLLA0D09394g5.245ON80381735.5
KAFR0K010707.153ON99480736.3
TDEL0E007103.62ON476145726.8
TDEL0B020108.435ON80576727.5
ZYRO0B12144g4.238ON2005100719.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01130
         (950 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6....  1825   0.0  
KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16...   729   0.0  
TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {O...   720   0.0  
KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {...   633   0.0  
Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061...   632   0.0  
TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16...   619   0.0  
Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to ...   596   0.0  
ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON} S...   590   0.0  
NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {...   524   e-170
YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}  C...   511   e-165
Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON} Y...   511   e-165
Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON} ...   511   e-165
NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {...   512   e-165
Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON} YE...   507   e-164
ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {...   500   e-161
Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON} (9109..1...   475   e-151
CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} simila...   467   e-148
KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar ...   446   e-141
TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON} Anc_...   449   e-140
SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar ...   438   e-138
Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa] ...   406   e-126
ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON} ...   347   e-102
SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa] ...   339   e-100
Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W (R...   338   1e-99
NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7....   329   2e-96
Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} simila...   329   4e-96
KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa] ...   327   4e-95
TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7....   324   2e-94
YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}  KIP1Kines...   323   4e-94
NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {...   314   2e-90
TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7....   307   7e-88
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....   255   3e-70
TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16...   230   2e-62
Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W (R...   225   3e-60
Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W (...   224   5e-60
ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa] ...   218   8e-58
TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.6...   135   5e-32
KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some s...   130   2e-31
KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some sim...   130   3e-31
KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {O...   131   7e-31
SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly...   129   1e-30
Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {...   128   1e-30
SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]...   125   4e-29
TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON} Anc_8...   123   3e-28
Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C ...   121   2e-27
Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   3e-27
Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)   120   6e-27
YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}  KIP3Kinesin-...   119   8e-27
Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)   119   8e-27
Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar t...   116   1e-26
KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {O...   117   3e-26
Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar t...   114   2e-25
ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON} S...   114   2e-25
CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} simila...   112   1e-24
NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}...   112   2e-24
SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} simila...   111   3e-24
Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]...   110   5e-24
TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa] ...   109   9e-24
ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {...   108   1e-23
KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528...   108   2e-23
KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} simila...   108   3e-23
NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {O...   107   6e-23
Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON} (11134..13...   107   6e-23
AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}...   106   8e-23
TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {O...   106   1e-22
TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa] ...   105   2e-22
Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar t...   105   2e-22
CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {...   104   3e-22
TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {O...   104   3e-22
Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}...   103   7e-22
KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa] ...   103   7e-22
ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some...   101   8e-22
KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa] ...   102   2e-21
Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]...   102   2e-21
KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} simila...   102   2e-21
TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {O...   101   3e-21
YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON} ...   100   5e-21
ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} simila...   100   9e-21
Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {...    99   2e-20
Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {...    99   2e-20
TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {O...    99   2e-20
NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {O...    99   2e-20
Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {...    99   3e-20
AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic ...    98   3e-20
KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} simila...    98   4e-20
Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON} (54983....    96   7e-20
SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} simila...    97   1e-19
NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa] ...    96   2e-19
ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} simila...    94   5e-19
Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C...    93   1e-18
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...    93   1e-18
KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]...    92   2e-18
Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar t...    92   3e-18
SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {...    92   3e-18
NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {O...    91   4e-18
KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} simila...    90   1e-17
KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8....    89   1e-17
YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON} ...    89   2e-17
Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON} (11880.....    87   6e-17
NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {O...    86   1e-16
TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {O...    86   2e-16
ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic ho...    86   2e-16
CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa] ...    86   3e-16
Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {...    85   6e-16
KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} simila...    84   1e-15
TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.6...    82   1e-15
TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa] ...    83   2e-15
Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}...    81   6e-15
Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {O...    80   1e-14
Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {...    77   1e-13
YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Prote...    75   5e-13
TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {...    68   7e-11
Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa] {...    67   2e-10
Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)...    66   2e-10
Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079...    66   2e-10
Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079...    65   4e-10
NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633     64   9e-10
Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079...    63   3e-09
NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}...    60   1e-08
KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.6...    59   6e-08
TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.6...    57   2e-07
ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar ...    57   2e-07
KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2....    57   2e-07
TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {O...    56   3e-07
CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa] ...    55   6e-07
TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.4...    40   0.032
NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON} Anc_2...    37   0.21 
KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633...    37   0.39 
NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa] ...    36   0.59 
KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} simila...    35   0.85 
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    35   1.0  
TPHA0I02920 Chr9 (639184..642786) [3603 bp, 1200 aa] {ON} Anc_7....    35   1.6  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...    34   1.9  
KNAG0M01260 Chr13 complement(231670..233970) [2301 bp, 766 aa] {...    34   2.6  
KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {...    33   3.5  
KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7....    33   3.6  
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    33   4.6  
NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401     33   4.7  
YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON} ...    33   4.8  
KLTH0F16478g Chr6 (1337447..1337842) [396 bp, 131 aa] {ON} simil...    31   5.0  
KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakl...    33   5.1  
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...    33   5.4  
KLLA0D09394g Chr4 (795025..797436) [2412 bp, 803 aa] {ON} simila...    33   5.5  
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    33   6.3  
TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.6...    32   6.8  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    32   7.5  
ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa] ...    32   9.9  

>KNAG0M01130 Chr13 (201705..204557) [2853 bp, 950 aa] {ON} Anc_6.16
           YEL061C
          Length = 950

 Score = 1825 bits (4728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 896/950 (94%), Positives = 896/950 (94%)

Query: 1   MDTTGLGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEV 60
           MDTTGLGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPI           EV
Sbjct: 1   MDTTGLGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIVVTVPDVTTTPEV 60

Query: 61  SINTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMT 120
           SINTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMT
Sbjct: 61  SINTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMT 120

Query: 121 STGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDDYVVKCSFVELYNEDLRDLL 180
           STGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDDYVVKCSFVELYNEDLRDLL
Sbjct: 121 STGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDDYVVKCSFVELYNEDLRDLL 180

Query: 181 SEGQDDFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXX 240
           SEGQDDFSNGTENSSKQPESLNASKKLRIFD                 HKARSDY     
Sbjct: 181 SEGQDDFSNGTENSSKQPESLNASKKLRIFDSNNSRSNSPVTNTNNPTHKARSDYLKKKL 240

Query: 241 XXXXXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVA 300
                   DDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKE             VA
Sbjct: 241 KSNRKKSLDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEGLQLLQRGLQRRQVA 300

Query: 301 TTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           TTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI
Sbjct: 301 TTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360

Query: 361 NQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCS 420
           NQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCS
Sbjct: 361 NQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCS 420

Query: 421 TLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEM 480
           TLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEM
Sbjct: 421 TLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEM 480

Query: 481 VDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKL 540
           VDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKL
Sbjct: 481 VDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKL 540

Query: 541 AQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQ 600
           AQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQ
Sbjct: 541 AQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQ 600

Query: 601 WDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISD 660
           WDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISD
Sbjct: 601 WDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISD 660

Query: 661 NVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQK 720
           NVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQK
Sbjct: 661 NVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQK 720

Query: 721 MSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQS 780
           MSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQS
Sbjct: 721 MSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQS 780

Query: 781 DSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNS 840
           DSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNS
Sbjct: 781 DSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNS 840

Query: 841 FKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNR 900
           FKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNR
Sbjct: 841 FKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNR 900

Query: 901 GPELHSTLIPLKPSSSNLNRLSDSTKSSPRKRSQGSEDETHASKIPKLTQ 950
           GPELHSTLIPLKPSSSNLNRLSDSTKSSPRKRSQGSEDETHASKIPKLTQ
Sbjct: 901 GPELHSTLIPLKPSSSNLNRLSDSTKSSPRKRSQGSEDETHASKIPKLTQ 950

>KAFR0L00370 Chr12 (66535..69426) [2892 bp, 963 aa] {ON} Anc_6.16
           YEL061C
          Length = 963

 Score =  729 bits (1882), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/938 (43%), Positives = 595/938 (63%), Gaps = 39/938 (4%)

Query: 9   DPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGS 68
           DP   + S    +++++NITVAVRCRGRN+REI+AKS +           EV+INTS   
Sbjct: 3   DPT--VSSDKQPQEEELNITVAVRCRGRNQREIDAKSSVVVTVPDIMGSKEVAINTSEDI 60

Query: 69  GIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTM 128
           G  AQ+ +KTYTVDKV+GP ++Q L+F++ AEPLF DF++GYNCTMLVYGMTSTGKTYTM
Sbjct: 61  GFTAQMNSKTYTVDKVFGPSATQSLIFDEIAEPLFSDFIKGYNCTMLVYGMTSTGKTYTM 120

Query: 129 TGDVEMGAEGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLL----- 180
           TGD ++  E +++  AGI PRIL KLFE L+   +D++VKCSFVELYNE+L+DLL     
Sbjct: 121 TGDEKLYNE-ELSDSAGIIPRILFKLFETLEKLNEDHIVKCSFVELYNEELKDLLHGDCN 179

Query: 181 -------------SEGQDDFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXX 227
                        S G+D  SN   NS K   +     K ++ +                
Sbjct: 180 NDNGNFKKLRIFDSLGRDSRSNSRNNSPKMSNNNTTFLKKKLRNEALLRSRNIASSKRSS 239

Query: 228 XHKARSDYXXXXXXXXXXXXXDDMSLNANAG-------GKTHVPPTQT-GIYIQNLKDFH 279
               R+                    N +A         K+ +   QT GIYIQNL++FH
Sbjct: 240 MQTIRNTTTTKASATTTTTTMFSSGNNDSANKFSPADNDKSTIQSDQTAGIYIQNLQEFH 299

Query: 280 ISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLA 339
           I+TAKE             VA+TK+ND SSRSHTIFTITL+K+ K +++RLSK+NLVDLA
Sbjct: 300 ITTAKEGIKLLQKGLKYRQVASTKMNDFSSRSHTIFTITLFKEVKGEIFRLSKMNLVDLA 359

Query: 340 GSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGN 399
           GSEN+N++GALN RAKE+GSINQSLLTLGRVINSLADK+ H+PFRESKLTRLLQDSLGGN
Sbjct: 360 GSENINRSGALNQRAKEAGSINQSLLTLGRVINSLADKNVHVPFRESKLTRLLQDSLGGN 419

Query: 400 TKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRA 459
           TKT LIATISPAK+  EETCSTLEYASKAKNIKNKPQLGSFI+KDILLK+++ EL K+++
Sbjct: 420 TKTALIATISPAKVTLEETCSTLEYASKAKNIKNKPQLGSFIMKDILLKNITTELTKIKS 479

Query: 460 DLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERA 519
           DL  TKSK+GIY+ Q++YKE+  DL N+KTE+ E KRT +SL  +N LL K+K++  E  
Sbjct: 480 DLLSTKSKDGIYMDQQHYKELTTDLQNYKTEIQECKRTIESLTSQNALLLKDKRTINENN 539

Query: 520 DSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSK 579
           +  + ++  +   +K +  K+ +  +   +L  ++    +  ++L  +I+  + +     
Sbjct: 540 ELQRIKIQTMNESMKKLYAKIERQQSIENELDGKIQIFTKTNSKLTKIIDEMKNREALVN 599

Query: 580 HKFQRLLKDELATLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGEVMNLLETTKENAET 638
            KF+ LL   L+ ++ K+  Q +  K+   + N+ +  ++  I+ E+ NLL T ++N E 
Sbjct: 600 SKFKTLLDHSLSYVSKKLNYQIENFKDQGINQNFTVDENLQLIKSEMTNLLSTARDNFEK 659

Query: 639 LYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQF 698
            Y+ CI   L +TP +F  I+DNV +++ +T  +Y+++A N SDLSEE+N FKQ++  +F
Sbjct: 660 FYQECITKFLSDTPLLFDEINDNVLNLKALTSNYYSQIAENLSDLSEEYNNFKQFITDEF 719

Query: 699 F---QNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDV 755
           +   + +  E++  + +   + ++  S+D++ ++QN +  +L  N +++ NS+++V  ++
Sbjct: 720 YNQEKGHQHELLNKYINNTQTVIESSSNDVMSTIQNLLNEHLRANKELIINSLSNVTTEL 779

Query: 756 INKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNESMDRSIST 815
           ++ E+D   PK SKWEES +LIN+SD+L+N+F +N+  S+  +   I+ +N+S++ +I  
Sbjct: 780 MSNELDRLKPKLSKWEESAELINRSDALNNEFNDNVESSMTTMTDKIKQTNDSINNNIKK 839

Query: 816 IKKHIIENDI--NSQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNL 873
           I +H   NDI  ++   I+ N ++ N+FK+I+EK N+ LH    +  +   ESM  +  L
Sbjct: 840 INEHFKTNDIAHSNNLMIDDNNIIKNNFKSIEEK-NSRLHEFVKEGYLVTNESMKKLNEL 898

Query: 874 DRSIRTLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPL 911
           D SIRT++    Y    K  + P +      ++  IPL
Sbjct: 899 DTSIRTVLKDIDYEKDIKETNSPLKPSHKHDYNHTIPL 936

>TDEL0G04530 Chr7 complement(824970..827846) [2877 bp, 958 aa] {ON}
           Anc_6.16 YEL061C
          Length = 958

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/932 (43%), Positives = 586/932 (62%), Gaps = 40/932 (4%)

Query: 17  ASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQA 76
           AS  + +++NITVAVRCRGRN+REI+AKS +           EVSINT+G  GI AQ+ +
Sbjct: 7   ASGEDVEELNITVAVRCRGRNEREIKAKSSVVVSVPDVTGSNEVSINTTGDVGITAQINS 66

Query: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136
           KTYTVD+V+GP ++Q LVF+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++  
Sbjct: 67  KTYTVDEVFGPSANQSLVFQKIAEPLFADFIKGYNCTVLVYGMTSTGKTYTMTGDEKL-Y 125

Query: 137 EGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTEN 193
           +G+++  AGI PRIL KLFE L+   +DYVVKCSFVELYNE+L+DLL + Q+        
Sbjct: 126 DGELSESAGIIPRILFKLFETLELQKEDYVVKCSFVELYNEELKDLLGDSQE-------- 177

Query: 194 SSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSL 253
                  + +S+KLRIFD                   +R++                   
Sbjct: 178 -------IASSRKLRIFDSNTMSAATNSMSTGNSTKNSRNNSPRSSSELPTATFLRKRWK 230

Query: 254 NANAGGKTH--VPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRS 311
            A +  ++H        GIYIQNL+DFHI+ AKE             VATTK+ND SSRS
Sbjct: 231 TAPSVTQSHQNSQDQNAGIYIQNLQDFHITNAKEGIKLLQKGLKHRQVATTKMNDFSSRS 290

Query: 312 HTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVI 371
           HTIFTITLYK++  +++R+SK+NLVDLAGSEN++++GA + RAKE+GSINQSLLTLGRVI
Sbjct: 291 HTIFTITLYKEYNGEIFRVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVI 350

Query: 372 NSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
           NSL DKS H+PFRESKLTRLLQDSLGGNTKT LIATISPAKI +EETCSTL+YA+KAKNI
Sbjct: 351 NSLTDKSLHVPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYAAKAKNI 410

Query: 432 KNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTEL 491
           KNKPQLGS I+KDIL+K+++ EL K++ADL  TKSKEGIY+SQ NYKE+ +DL+++KTE+
Sbjct: 411 KNKPQLGSVIMKDILVKNITGELAKIKADLLSTKSKEGIYMSQDNYKELTNDLESYKTEV 470

Query: 492 TELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLS 551
            E KR  ++L  +N LL K+KK+  E  D  + +L N+R  +  + +K  + N +   L 
Sbjct: 471 KECKRAIETLTSQNTLLLKDKKASNEVNDLQRIKLQNMRDAMSDLYSKAEKQNKREQNLV 530

Query: 552 EQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQW-DTLKNVNSG 610
              + +      ++S+I+ ++++    + K   L  +E A +   ILS   D  + ++  
Sbjct: 531 ATASTLKTTVGTMQSIIKEHERRERDIESKMGDLFNNEFARVKQTILSNIRDIEQQIDWE 590

Query: 611 NYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTE 670
           N  +  +IDSIRGE+  LLE  ++  + +YK C++ +L ETP  FQL ++ V ++  +  
Sbjct: 591 NIGVQGNIDSIRGEISKLLERAQQQTDDMYKDCVEKILDETPGHFQLAAEKVSEVEKLIA 650

Query: 671 EHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQ 730
             + ++  N SD+SEEFN  +QYL+  FF+NNH E++ +H D    ++Q  +DDL Q  +
Sbjct: 651 TCHRDLTENLSDVSEEFNNLRQYLNDHFFKNNHEEILVSHIDRTYHHIQTSADDLFQQFK 710

Query: 731 NSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNN 790
             + N+L  N  ++  S+     DVI KEM LF P+K KWE+S   IN+ DS++  F+N 
Sbjct: 711 EMMDNHLEKNKDLMLESLKTATYDVIRKEMQLFEPQKKKWEDSFKYINKCDSINFAFQNG 770

Query: 791 MTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNN 850
           +   +  I S + +S E+++++I+ +K+ + E++ +    ++++ + +  F  I  K  +
Sbjct: 771 VKSPLLGIKSTLGSSQEAINKTITKVKEQMDEHE-SPASMLSNSRVFSEQFSGILNK-QS 828

Query: 851 ILHLVTGDLTVTAQESMDGIQNLDRSIRTLI-------HGDQYIHSTKGV--HIPPQNRG 901
           +LH       +   +  D +  L  +I  ++        G++  H   G+   +  QN  
Sbjct: 829 LLHESLKKSVIITSDHADAVDKLKEAIDHVVSERGSSMEGERVEH-VDGILRRMDEQNL- 886

Query: 902 PELHSTLIPLKPSSSNLNRLSDSTKSSPRKRS 933
             L+    PL+P++  +N+   S ++SP + S
Sbjct: 887 --LYLDRSPLRPANFKMNK---SERNSPNRSS 913

>KLTH0C11330g Chr3 complement(931865..934690) [2826 bp, 941 aa] {ON}
           similar to uniprot|P27895 Saccharomyces cerevisiae
           YEL061C CIN8 Kinesin motor protein involved in mitotic
           spindle assembly and chromosome segregation
          Length = 941

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/943 (39%), Positives = 560/943 (59%), Gaps = 72/943 (7%)

Query: 21  EKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYT 80
           E++++NITVAVRCRGRN++E++AKS +           EVSINT+G +GI AQ+ +KTYT
Sbjct: 3   EEEELNITVAVRCRGRNEKEVKAKSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYT 62

Query: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140
           VD+V+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G++
Sbjct: 63  VDRVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGEL 121

Query: 141 NGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197
           +  AGI PR+L KLF+ L    DDY++KCSF+ELYNE+L+DLL E  D         S  
Sbjct: 122 SEGAGIIPRVLFKLFDALDAHNDDYMIKCSFIELYNEELKDLLDETPD---------SSM 172

Query: 198 PESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLNANA 257
           P      +KLRIFD                                         +  N 
Sbjct: 173 P------RKLRIFDSVTNPNSSRSSSRNSSPKPPEGSTSGTKRR-----------IRPNT 215

Query: 258 GGKTHVPPT---------QTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVS 308
             K    PT          + I+IQNL++FHI  AKE             VA+TK+NDVS
Sbjct: 216 MYKPSRSPTVKPTLSSELNSAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVS 275

Query: 309 SRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLG 368
           SRSHTIFTI LY+K   + +R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLG
Sbjct: 276 SRSHTIFTIMLYRKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLG 335

Query: 369 RVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKA 428
           RVINSLADK+AHIPFRESKLTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+KA
Sbjct: 336 RVINSLADKNAHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKA 395

Query: 429 KNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFK 488
           KNIKNKPQ+GSFI+KD+L+K+V+ EL+K+R+DL  TKSK+GIY+SQ+NYKE+ ++L+N+K
Sbjct: 396 KNIKNKPQVGSFIMKDVLVKNVTAELVKIRSDLLATKSKDGIYMSQENYKELTNELENYK 455

Query: 489 TELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNT 548
           TE+ E KR  + L  +N LL KEK+   E  +S + ++  L + +  + +K+ + +    
Sbjct: 456 TEVQECKRAIERLSTQNGLLTKEKRITNEVNESQRLKIKKLSNNIDFLYDKIDRQHKNEQ 515

Query: 549 KLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVN 608
           +LS  V ++ R    +++ ++VY+ +    + + +R+L + + +    +L++ + LK   
Sbjct: 516 ELSNVVQELMRALRTMQNSLKVYEDQGHRFQTEMERVLYENIGSFKHSLLNEIEKLKGTE 575

Query: 609 SGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGM 668
              + +  +ID++  E+  + +    +   + +  ++ + ++TP   Q I + V  I  +
Sbjct: 576 EDGFDVDANIDTLTKELNRIYDFINTSTIEICRKFMNKITEQTPTYLQDIRNQVESITHV 635

Query: 669 TEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQS 728
              + +++  + S +SEE+N  K YL+  FF+NN  + +  H D     ++  ++ +   
Sbjct: 636 VGSYSSDLMMHLSSISEEYNHLKDYLNEHFFKNNFQDALDVHVDRTYHQLKVSANSIFLK 695

Query: 729 VQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFR 788
           ++  +   L TN +++  S+ + A +V+ KEM L  P K  WE S++ IN+ D L++ F 
Sbjct: 696 LREMMNEELETNKEIMMQSLKNAASEVVAKEMGLLDPVKQAWESSLENINECDKLNSGFE 755

Query: 789 NNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDI------NSQEQINSNELLTNSFK 842
                   DI SV+R+  E ++  +   +  + + ++      ++   + +++++  S +
Sbjct: 756 K-------DIGSVVRDVFEKINEGLQFSESAVGDANLDLSRFQDASRALRTDDVIPGSIE 808

Query: 843 AIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIP-PQNRG 901
            I++K +N+L L   D     + +      +D SI+ L++       ++ V  P  +NR 
Sbjct: 809 EIKKK-HNMLKLKVQDSASYMEAATQKFGEIDDSIQGLLN-------SQAVSQPHSENRI 860

Query: 902 PEL-----HSTLIPLKPSSSNLNRLSDSTKSS------PRKRS 933
             L        L PL PS     R++    +S      PRKRS
Sbjct: 861 EGLLEQLNGKPLKPLGPSGKTPMRITQGCIASSDQLSLPRKRS 903

>Kwal_56.22403 s56 (112080..114911) [2832 bp, 943 aa] {ON} YEL061C
           (CIN8) - 1:1 [contig 185] FULL
          Length = 943

 Score =  632 bits (1630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/784 (43%), Positives = 494/784 (63%), Gaps = 21/784 (2%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NITVAVRCRGRN++E++A+S +           EVSINT+G +GI AQ+ +KTYTVD
Sbjct: 5   EELNITVAVRCRGRNEKEVKARSSVVVAVPDVTGTNEVSINTTGDTGITAQINSKTYTVD 64

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 65  KVFGPSADQLLIFKVIAEPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGELSE 123

Query: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L KLF+ L    DDY++KCSF+ELYNE+L+DLL E  D         S  P 
Sbjct: 124 GAGIIPRVLFKLFDALSAQGDDYMIKCSFIELYNEELKDLLDETPD---------SSMP- 173

Query: 200 SLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLNANAGG 259
                KKLRIFD                  K                     + +  +  
Sbjct: 174 -----KKLRIFDSVSNVSSNSRASSRNNSPKPNEGSSFGTRRKTRAPSIHRPTKSPVSKP 228

Query: 260 KTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITL 319
            +   P+ + I+IQNL++FHI  AKE             VA+TK+NDVSSRSHTIFTI L
Sbjct: 229 VSPCEPS-SAIHIQNLQEFHIMDAKEGIRLLQRGLRHRQVASTKMNDVSSRSHTIFTIML 287

Query: 320 YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379
           YKK   + +R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADKS 
Sbjct: 288 YKKCNGESFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKSL 347

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+KAKNIKNKPQ+GS
Sbjct: 348 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQVGS 407

Query: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499
           FI+KD+LLK V+ EL+K+++DL  TKSK+GIY+SQ+NYKE+ ++L+N+KTE+ E KR  +
Sbjct: 408 FIMKDVLLKSVTAELVKIKSDLLSTKSKDGIYMSQENYKELTNELENYKTEVEECKRAME 467

Query: 500 SLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNR 559
            +  +N LL KEK+   E  +S K +L  L + ++ + +K+ + +    +LS  V ++ R
Sbjct: 468 KVSAQNSLLIKEKRVSNEVNESQKVKLRKLGNNIEFLYDKIDRQHKNEQELSNVVQELMR 527

Query: 560 IQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLK-NVNSGNYQIHTHI 618
               ++  + +Y+ + +    + +R+L D + +    ++ + + LK NV+     +  ++
Sbjct: 528 ALHTMQQSLRIYEDQGQRFHTEMERVLYDNIGSFKKSLMDEIEKLKINVDENGDDVEVNV 587

Query: 619 DSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMAR 678
           D++  E+  + +    +   ++++ I  +  +TP  F+ I   V  I  +   + + +  
Sbjct: 588 DAVTTELTRIFDFMNSSNIEVFRNYIKKVNDQTPAYFKDIYSQVESITSVVSSYSSNLMI 647

Query: 679 NFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLS 738
           + S +SEE+N  K YL+  FF+NN  E +  H D     ++  ++ +   ++  +   L 
Sbjct: 648 HLSSISEEYNNLKDYLNEHFFKNNFQEALDVHVDRTYHQLKVSANSIFLKLREMLNEELD 707

Query: 739 TNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDI 798
           TN + +  S+   A +V+ KEM L  P K  WE S++ IN+ D L+N F N +  +V++I
Sbjct: 708 TNKEFMMQSLRHAASEVVAKEMCLLDPVKQAWENSLENINECDKLNNVFENKIGVTVNEI 767

Query: 799 ASVI 802
              I
Sbjct: 768 FKTI 771

>TPHA0M00240 Chr13 (47407..50226) [2820 bp, 939 aa] {ON} Anc_6.16
           YEL061C
          Length = 939

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/841 (41%), Positives = 518/841 (61%), Gaps = 51/841 (6%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGG--SGIEAQLQAKTYT 80
           D++NI VAVRCRGRNKREI++KS +           E+SINTS    SG+ AQL +KTYT
Sbjct: 13  DEMNIMVAVRCRGRNKREIKSKSSVIVSVPDVMGSNEISINTSDDIVSGLTAQLNSKTYT 72

Query: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140
           VDKV+GP ++Q+L+FE+ AEPLF+DF+RGYNCT+LVYGMTSTGKTYTMTGD E   +GD+
Sbjct: 73  VDKVFGPSANQRLIFEEIAEPLFNDFLRGYNCTVLVYGMTSTGKTYTMTGD-EKLYKGDL 131

Query: 141 NGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197
           +  AGI PR+L KLFE ++   D+YV+KCSF+ELYNE+L+DLL +     SN T+     
Sbjct: 132 SDSAGIIPRVLFKLFETIEFQSDNYVIKCSFIELYNEELKDLLID-----SNNTK----- 181

Query: 198 PESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSL-NAN 256
                  KKLRIFD                 H                   D+ ++ N N
Sbjct: 182 ------LKKLRIFDSNLSKSSNNNNISRQNSHFISGMDLRKNPINPINNSNDNTAIQNGN 235

Query: 257 AGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFT 316
           A            IYIQNL++FHI  A+E             VA+TK+NDVSSRSHTIFT
Sbjct: 236 AS-----------IYIQNLEEFHIKNAREGIQLLQKGLKYRQVASTKMNDVSSRSHTIFT 284

Query: 317 ITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLAD 376
           I LYK+ K +++++SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINS+AD
Sbjct: 285 INLYKEHKGEIFKISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSIAD 344

Query: 377 KSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQ 436
           K+ HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ AEETCSTLEYA+KAK+IKNKPQ
Sbjct: 345 KNIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKLNAEETCSTLEYATKAKSIKNKPQ 404

Query: 437 LGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKR 496
           LGS I+KD+ LKD++ EL K++ DL  TK K+G+Y++Q +YK++ +DL+++KTE+ E  R
Sbjct: 405 LGSIIMKDVRLKDLNNELAKIKRDLTSTKQKDGVYMTQNHYKDLTNDLESYKTEIQECDR 464

Query: 497 TNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTD 556
              SL  +N LL K+KK+  E     +  L+ + + L ++   L   + +   L E++  
Sbjct: 465 IVKSLELQNALLLKDKKASNEVNKLQELNLNEMTNTLSNIQTTLEIQHKKEQILVEELAH 524

Query: 557 MNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHT 616
                 ++K++I+ Y +K E  +   + +  DEL  L   ++   + L  +   N  + T
Sbjct: 525 SREKSLKMKTVIKEYSEKEERIQSNMKSIFNDELIKLKELLI---ENLNGIAKENLIVQT 581

Query: 617 HIDS----IRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEH 672
           ++      I+ +V++++  ++E ++ L+      ++KETP I ++ S +V   + + E +
Sbjct: 582 NVKDNIKLIKDDVISIVTESQELSKKLFLEFSQQIIKETPLILEMFSSDVKKNQELNETY 641

Query: 673 YTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNS 732
           +  +  N   + ++++   +Y    FF++NH+ ++  H +   + ++K   D+ +  Q +
Sbjct: 642 FANLFENLESIKQQYSKLNEYFSNDFFKSNHVTIVNDHVNTTKAIIEKSVSDIFKQFQQN 701

Query: 733 IQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMT 792
           ++ +   N +++  ++  V+ D+I  EM+ F   KS+W+ S   IN  D L+N +     
Sbjct: 702 MEAFAEQNEKLILENLKTVSSDLIQNEMNSFKEHKSEWDISFKKINHCDYLNNSYH---- 757

Query: 793 KSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQ-EQINSNELLTNSFKAIQEKSNNI 851
              D + + +RN    +  S   IKKH+  N I S  + +NS   L N+ +AI +  N I
Sbjct: 758 ---DQMHTYLRNMKGKLQSSDEIIKKHM--NQIKSNVDSLNSTPKLLNTDRAIGDNYNQI 812

Query: 852 L 852
           +
Sbjct: 813 I 813

>Ecym_3020 Chr3 (37549..40383) [2835 bp, 944 aa] {ON} similar to
           Ashbya gossypii ACR010C
          Length = 944

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/947 (37%), Positives = 547/947 (57%), Gaps = 90/947 (9%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NITVAVRCRGRN+REI+AKS +           EVSINT+G  GI  ++ ++TYTVD
Sbjct: 19  EELNITVAVRCRGRNEREIKAKSAVVVTVPDVTGSNEVSINTTGDIGIAGKMNSRTYTVD 78

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           +V+GP + QKL+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 79  QVFGPSADQKLIFKNIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGELSD 137

Query: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L +LF+ L+    D++VKCS++ELYNE+L+DLL +  D              
Sbjct: 138 SAGIIPRVLFRLFDTLEATESDHLVKCSYIELYNEELKDLLDDTPD-------------- 183

Query: 200 SLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLNANAGG 259
               SK+LRIFD                  +                  D  S +     
Sbjct: 184 ---YSKRLRIFDSNTITNSRAGSQNNSPKEQ------------------DGTSSSMAKRR 222

Query: 260 KTHVP-----PT---------QTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLN 305
            TH+P     P+          + IYIQNL++FHI+ A+E             VA+TK+N
Sbjct: 223 YTHIPTKPKRPSLNKQLLYEQSSAIYIQNLQEFHITNAREGISVLQKGLKHRQVASTKMN 282

Query: 306 DVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLL 365
           D SSRSHTIFTI LYK ++ +L+R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLL
Sbjct: 283 DFSSRSHTIFTIMLYKSYEGELFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLL 342

Query: 366 TLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYA 425
           TLGRVINSLADKS HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI A+ET STLEYA
Sbjct: 343 TLGRVINSLADKSIHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYA 402

Query: 426 SKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLD 485
           +KAKNIKN+PQLGSF++KDIL+K +S EL K+++D   TK+KEGIY+S ++Y+EMV+DL+
Sbjct: 403 TKAKNIKNRPQLGSFMMKDILVKSISSELSKLKSDFLSTKAKEGIYMSHEHYQEMVNDLE 462

Query: 486 NFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNT 545
           N++TE+ E KR  +S   +N LL K+KK+  +  +    ++  L++ ++ + +K+ + + 
Sbjct: 463 NYQTEIQESKRQVESFSSQNSLLLKDKKASQQLNELQDMKITRLQNTIEYLCDKIERQHR 522

Query: 546 QNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLK 605
               L   +  +      +K  ++ Y+      ++  + +L   + +    +    +T+K
Sbjct: 523 NEIDLVSTIHKLKEALHTMKGSLQNYETHELRLQNDIKEVLYQGITSYRESMDQHLETVK 582

Query: 606 N-VNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKI-FQLISDNVG 663
             +   N  I+ ++D IR      L++ +     +  + +  ++K+ P   +Q   + +G
Sbjct: 583 TRMLDKNLSINHNMDEIRTIFHETLDSVRSAGSDMCTNIV-KIVKDQPSTSYQQFKEALG 641

Query: 664 DIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSD 723
           D+    + +   +    ++++EE N  K+YLD  F +NN+ EM+    +      +  SD
Sbjct: 642 DLDTKVQTYSVTLTNKLTEMTEENNNMKEYLDEHFLKNNNQEMLDLRMEKAYHKSKTASD 701

Query: 724 DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSL 783
            L+ SV + +++++  +  ++ +S+ D   ++I+KE+++F P K +W  S + IN+ D+ 
Sbjct: 702 ALISSVVSMMESHMEESRNLMLSSMKDAVSEMIDKELEMFQPVKERWVLSFENINECDAA 761

Query: 784 SNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQ---EQINSNELLTNS 840
             +F N  TK + ++  +  NS  + D     + K + EN  N +    Q ++ E +   
Sbjct: 762 HQQFENKSTKLLTNLKELADNSVVAAD----DVAKQVQENVTNFEGIVRQASAKESIVKQ 817

Query: 841 FKAIQEK--------SNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIH------GDQY 886
              I +K         NNI +          +ES  G + +D SI+ +I       GD  
Sbjct: 818 MNDINDKHKMLEDHFENNIKYF---------KESSKGFEEMDCSIKKIIREMSPEVGD-- 866

Query: 887 IHSTKGV--HIPPQNRGPELHSTLIPLKPSSSNLNRLSDSTKSSPRK 931
           I   + +   +  ++ GP   +   P++P   N    + S   SP K
Sbjct: 867 IKQIEALLERVNSRSFGPIASTGKTPMRPELKNPIPKTRSRSMSPIK 913

>ACR010C Chr3 complement(374085..376922) [2838 bp, 945 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL061C
           (CIN8)
          Length = 945

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/870 (40%), Positives = 530/870 (60%), Gaps = 37/870 (4%)

Query: 22  KDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTV 81
           ++++NITVAVRCRGRN+REI+AKS +           EVSINT+   GI A++ ++TYTV
Sbjct: 18  QEELNITVAVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDEVGIAAKMNSRTYTV 77

Query: 82  DKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVN 141
           DKV+GP + Q L+F++ AEPLF DFM+GYNCT+LVYGMTSTGKTYTMTGD E   +G ++
Sbjct: 78  DKVFGPSADQSLIFKEIAEPLFDDFMKGYNCTVLVYGMTSTGKTYTMTGD-EKLYDGQLS 136

Query: 142 GQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQP 198
             AGI PRI+ KLF+ L+    D++VKCS++ELYNE+L+DLL E  D             
Sbjct: 137 DSAGIIPRIMFKLFDALEATDSDFLVKCSYIELYNEELKDLLDESHD------------- 183

Query: 199 ESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLNANAG 258
               +SK+LRIFD                    R                  +  N  + 
Sbjct: 184 ----SSKRLRIFDSSSMNHSSRASSQSN---SPREPEVAHNGFSRRRQRPPPVKANRMSA 236

Query: 259 GKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTIT 318
            K  +  + +GIY+QN+++FHI  A+E             VA+TK+ND SSRSHTIFTI 
Sbjct: 237 TKQQLSESGSGIYVQNVQEFHIINAREGINVLQKGLKHRQVASTKMNDFSSRSHTIFTIM 296

Query: 319 LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKS 378
           LYK    +L+R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADKS
Sbjct: 297 LYKNCDGELFRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKS 356

Query: 379 AHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLG 438
            HIPFRESKLTRLLQDSLGGNTKT LIATISPAKI A+ET STLEYA+KAKNIKN+PQLG
Sbjct: 357 IHIPFRESKLTRLLQDSLGGNTKTALIATISPAKINADETSSTLEYAAKAKNIKNRPQLG 416

Query: 439 SFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTN 498
           + ++KDIL+K++S EL K+++D   TKSK+GIY+S ++Y+E+V+DL+N +TE+ E KR  
Sbjct: 417 ALMMKDILVKNISSELAKIKSDFLSTKSKDGIYMSHEHYQEIVNDLENCQTEIQESKRQI 476

Query: 499 DSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMN 558
           +SL  +N LL K+KK+  E  +   S++  L+S ++ + +K+ + +   T+L+   T ++
Sbjct: 477 ESLTSQNNLLLKDKKASQEVTELQNSKIKKLQSTIEYLYDKIERQHHNETELA---TTIH 533

Query: 559 RIQTELKSLIEVYQQKHETSKHKFQRLLKDELAT-LTAKILSQWDTLKNVNSG----NYQ 613
           +++  L ++ +   + +ET + + Q  +K+ L   +T+   S    L+ V       N  
Sbjct: 534 KLKEALHTM-QGSLKSYETHELRLQNDIKEVLYQGITSYRESMNQHLEKVKVSMLDKNLS 592

Query: 614 IHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIF-QLISDNVGDIRGMTEEH 672
           I  +I++I     + L++ + N   +  + +  L+KETP ++ +  ++ V  ++     +
Sbjct: 593 IKENINNITTIFDDTLKSVEANGSDMCDTLV-KLIKETPSMYLKEFNETVSSLKSELSSY 651

Query: 673 YTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNS 732
              +    +++SEE N  ++YLD   F+N+  E++    + V   ++  SD LL  + + 
Sbjct: 652 SNALTNKLTEISEENNHLREYLDQHLFKNSTQEVLDLRMESVYQKVKNDSDQLLSKLVSM 711

Query: 733 IQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMT 792
           +  ++  +  ++ NS+ D   ++I+ E  LF P + +W  S D INQ D+    F    T
Sbjct: 712 VGAHVEESRTLMVNSMKDTVNEIIDNERSLFQPIRDRWIASCDNINQCDASHQNFEAKST 771

Query: 793 KSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNIL 852
             +D +  +   S +S + +++   KH  ++  +  +++  ++ L      I +K + +L
Sbjct: 772 SGLDKLKELSDASLKSSEDAVNK-AKHRTDSFHDFVQKLCCDQSLKKQMHDISDK-HRML 829

Query: 853 HLVTGDLTVTAQESMDGIQNLDRSIRTLIH 882
                D     +ES  G +++D SI+ +IH
Sbjct: 830 EDHFDDNVKYFKESSKGFEDMDCSIKKIIH 859

>NCAS0H00880 Chr8 complement(160883..163897) [3015 bp, 1004 aa] {ON}
           Anc_6.16
          Length = 1004

 Score =  524 bits (1350), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 275/583 (47%), Positives = 400/583 (68%), Gaps = 5/583 (0%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328
           GIYIQNL++FHI+ AKE             VA+TK+ND SSRSHTIFTITLYK+ KD+L+
Sbjct: 300 GIYIQNLQEFHITNAKEGLSLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYKEHKDNLF 359

Query: 329 RLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKL 388
           RLSK+NLVDLAGSEN+N++GA+N RAKE+GSINQSLLTLGRVINSLADKS H+PFRESKL
Sbjct: 360 RLSKMNLVDLAGSENINRSGAMNQRAKETGSINQSLLTLGRVINSLADKSPHVPFRESKL 419

Query: 389 TRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLK 448
           TRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLGS I+KDILLK
Sbjct: 420 TRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSVILKDILLK 479

Query: 449 DVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELL 508
           +++ EL K+++DL  TKSK+GIY+S ++Y+E++ +L++ KTE+ E KR  + L  +N +L
Sbjct: 480 NITSELAKVKSDLMSTKSKDGIYMSHEHYQELIMELESSKTEVQESKRMIEKLSSQNSML 539

Query: 509 GKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLI 568
            K+K+S  E  +  + +L+NL+  + ++  KL   N + TKL EQ+  + + + +L SL+
Sbjct: 540 LKDKRSANEVNELQRIKLNNLKDSMSNLNEKLEIQNGKETKLMEQIGQLEKSREKLNSLV 599

Query: 569 EVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNL 628
           + YQ K    K +   +L + L  L   + S  D ++  + GN+ +  ++  I+ E+ ++
Sbjct: 600 KNYQTKQSQLKTQISNILNENLFELKKILNSHKDAIRQ-SEGNFDVEMNLKVIKDEITSM 658

Query: 629 LETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFN 688
           LE T+   E +YK  I++ L++TP   Q I ++V  +  M   +Y E+  N SD+SEE+N
Sbjct: 659 LEKTQHKTEMMYKEFIEEFLEQTPINLQKIFEHVTQVEFMVTGYYNEITENLSDISEEYN 718

Query: 689 TFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSI 748
             KQYLD  FFQNNH +++  H +  +  + + S +L    +  +  +L  N +++ ++ 
Sbjct: 719 NLKQYLDNDFFQNNHEDLLNIHINATSDILAQSSAELFNKFKIMMDAHLMENKKLMIDNF 778

Query: 749 NDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNES 808
                DVI KEM+LF PK++KWEESI+LIN+ DS++N F +NMT  V  I + + +S+ S
Sbjct: 779 RTATNDVITKEMELFKPKRNKWEESIELINRCDSINNGFHHNMTGQVSKIKTNLASSSSS 838

Query: 809 MDRSISTIKKHIIE----NDINSQEQINSNELLTNSFKAIQEK 847
           +  +I++IK  ++E    +D + +  + ++ +    F  I EK
Sbjct: 839 IHNAIASIKSQVLEQLSNDDSDVKTALENDPMFNKHFNEIIEK 881

 Score =  223 bits (567), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 111/203 (54%), Positives = 140/203 (68%), Gaps = 20/203 (9%)

Query: 21  EKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYT 80
           E  ++NITVAVRCRGRN+REI +KSP+           E+SINT+G +GI AQ+ +KTYT
Sbjct: 25  EDTELNITVAVRCRGRNEREINSKSPVVVTVPDITGAQEISINTTGETGITAQMNSKTYT 84

Query: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGD- 139
           VDKV+GP + Q L+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G  
Sbjct: 85  VDKVFGPAADQDLIFQEVAEPLFRDFVKGYNCTVLVYGMTSTGKTYTMTGDEKLYQNGTM 144

Query: 140 VNGQAGIAPRILVKLFECLQD-----------DYVVKCSFVELYNEDLRDLLSEGQDDFS 188
           ++  AGI PRIL KLF+ L +           D+VVKCSFVELYNEDL+DLL        
Sbjct: 145 LSDAAGIIPRILFKLFDTLDNHRHSDVTGSTTDFVVKCSFVELYNEDLKDLL-------- 196

Query: 189 NGTENSSKQPESLNASKKLRIFD 211
           N   N  +Q +    S+KLRIFD
Sbjct: 197 NYDSNDEQQQQQQLGSRKLRIFD 219

>YEL061C Chr5 complement(36535..39537) [3003 bp, 1000 aa] {ON}
           CIN8Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 1000

 Score =  511 bits (1317), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/603 (46%), Positives = 398/603 (66%), Gaps = 31/603 (5%)

Query: 263 VPPTQT-GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYK 321
            P  QT GIYIQNL++FHI+ A E             VA+TK+ND SSRSHTIFTITLYK
Sbjct: 308 APNDQTNGIYIQNLQEFHITNAMEGLNLLQKGLKHRQVASTKMNDFSSRSHTIFTITLYK 367

Query: 322 KFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHI 381
           K +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L DKS HI
Sbjct: 368 KHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDKSGHI 427

Query: 382 PFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFI 441
           PFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLGSFI
Sbjct: 428 PFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGSFI 487

Query: 442 IKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSL 501
           +KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K E+ E KR  +SL
Sbjct: 488 MKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKNEVQECKREIESL 547

Query: 502 VQENELLGKEKKSGAE-------RADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQV 554
             +N LL K+K    E       + +SLK+ +D+LR+QL            +  K   ++
Sbjct: 548 TSKNALLVKDKLKSKETIQSQNCQIESLKTTIDHLRAQLD-----------KQHKTEIEI 596

Query: 555 TDMNRIQTELKSLIEVYQQK-HETSK------HKFQRLLKDELATLTAKILSQWDTLKNV 607
           +D N    +L+ L EV Q   H+  K       KF+  +  E+  L + +  Q +T++  
Sbjct: 597 SDFN---NKLQKLTEVMQMALHDYKKRELDLNQKFEMHITKEIKKLKSTLFLQLNTMQQE 653

Query: 608 NS-GNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIR 666
           +      I  ++D I+ EV+ L+ T +E AE +YK C+  +L E+PK F ++ + +  IR
Sbjct: 654 SILQETNIQPNLDMIKNEVLTLMRTMQEKAELMYKDCVKKILNESPKFFNVVIEKIDIIR 713

Query: 667 GMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLL 726
              ++ Y  +A N SD+SEE N  KQYL   FF+NNH E++  H D    N++K +++ +
Sbjct: 714 VDFQKFYKNIAENLSDISEENNNMKQYLKNHFFKNNHQELLNRHVDSTYENIEKRTNEFV 773

Query: 727 QSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNK 786
           ++ +  + ++L  N +++  ++      VI++EMDLF PK+ KWE S DLIN  DS++N+
Sbjct: 774 ENFKKVLNDHLDENKKLIMQNLTTATSAVIDQEMDLFEPKRVKWENSFDLINDCDSMNNE 833

Query: 787 FRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQE 846
           F N+M  ++  I S +  S+ SM+ SIS +K  + E++ N+   + +N    + F+ +  
Sbjct: 834 FYNSMAATLSQIKSTVDTSSNSMNESISVMKGQVEESE-NAISLLKNNTKFNDQFEQLIN 892

Query: 847 KSN 849
           K N
Sbjct: 893 KHN 895

 Score =  228 bits (581), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 111/192 (57%), Positives = 142/192 (73%), Gaps = 11/192 (5%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NITVAVRCRGRN+REI  KS +           E+SINT+G +GI AQ+ AK YTVD
Sbjct: 33  EELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGITAQMNAKRYTVD 92

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD E    G+++ 
Sbjct: 93  KVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELSD 151

Query: 143 QAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DLL    D  SNG+ N+    +
Sbjct: 152 AAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL----DSNSNGSSNTGFDGQ 207

Query: 200 SLNASKKLRIFD 211
            +   KKLRIFD
Sbjct: 208 FM---KKLRIFD 216

>Skud_5.28 Chr5 complement(35653..38649) [2997 bp, 998 aa] {ON}
           YEL061C (REAL)
          Length = 998

 Score =  511 bits (1317), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 300/707 (42%), Positives = 446/707 (63%), Gaps = 37/707 (5%)

Query: 264 PPTQT----GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITL 319
           P TQ     GIYIQNL++FHI+ A E             VA+TK+ND SSRSHTIFTITL
Sbjct: 304 PMTQNDQSNGIYIQNLQEFHITNALEGLNLLQRGLKHRQVASTKMNDFSSRSHTIFTITL 363

Query: 320 YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379
           YKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVIN+L D+S 
Sbjct: 364 YKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVINALVDRSG 423

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+
Sbjct: 424 HIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNIKNKPQLGA 483

Query: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499
           F++KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL++ K E+ E KR  +
Sbjct: 484 FMMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESHKNEVQECKREIE 543

Query: 500 SLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNR 559
           SL  +N LL K+K    E   S  S++++L++ +  +  +L + +    ++S     + +
Sbjct: 544 SLASKNSLLVKDKLKSRETIQSQNSQMESLKATINHLKAQLDKQHKAELEISGFNNKLQK 603

Query: 560 IQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQ---IHT 616
           +   ++  ++ Y+++      KF+  +  E+ +L   +  Q D ++  N   +Q   I  
Sbjct: 604 MTEVMQVALQDYKKRELDLNKKFETHISKEIKSLKTALFLQLDNMQQKNI--FQETDIQP 661

Query: 617 HIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEM 676
           ++D ++ EV+ L+ET +E AE +YK C+  +L E+PK F +I + +  IR   +  Y  +
Sbjct: 662 NLDMVKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDIIRIEFQNFYKNI 721

Query: 677 ARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNY 736
           A N SD+SEE N  KQYL   FF+NNH E++  H D    N++K ++  +++ + ++ ++
Sbjct: 722 AENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYENIEKKTNQFVENFKMTLNDH 781

Query: 737 LSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVD 796
           L  N +++  ++ +    VI++EMDLF P+++KWE S DLIN+ DS++N+F NNM  ++ 
Sbjct: 782 LEENKKLIMQNMTNATSAVIDQEMDLFEPRRAKWENSFDLINKCDSMNNEFYNNMAATLS 841

Query: 797 DIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVT 856
            I   +  S+ SM+ SIS +K  + E++ N+   + +N    + FK +  K     H++ 
Sbjct: 842 QIKKTVDTSSNSMNESISVMKGQVEESE-NAISLLKNNTKFNDQFKQLISK-----HIIL 895

Query: 857 GD---LTVTAQES----MDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNRGPELHSTLI 909
            D    ++T+  S    +D I N    I T  HG++  ++TK   I    +     S  +
Sbjct: 896 KDNIESSITSTHSHITNVDDIYNTIEDIMT-NHGNKE-NATKDEMIDNILKEIPNLSKRL 953

Query: 910 PLKPSSSNLNRLSDSTKSSPRKRSQGSEDETHAS---------KIPK 947
           PL+   SN+N  S     SP+K +   EDE  +S         KIPK
Sbjct: 954 PLRI--SNINGCSVQDIISPKKHT--IEDENPSSENADSEGSRKIPK 996

 Score =  220 bits (560), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 111/192 (57%), Positives = 136/192 (70%), Gaps = 11/192 (5%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NITVAVRCRGRN+REI  KS +           EVSINT+G +GI AQ+ AK YTVD
Sbjct: 35  EELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSKEVSINTTGDTGITAQMNAKRYTVD 94

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP +SQ L+FE+ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD E    G++N 
Sbjct: 95  KVFGPGASQDLIFEEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD-EKLYNGELND 153

Query: 143 QAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L+KLF+ L   Q DYVVKCSF+ELYNE+L+DLL    +  SN   +      
Sbjct: 154 AAGIIPRVLLKLFDTLELQQSDYVVKCSFIELYNEELKDLLDNNSNGSSNNGFDGQ---- 209

Query: 200 SLNASKKLRIFD 211
                KKLRIFD
Sbjct: 210 ---FMKKLRIFD 218

>Smik_5.26 Chr5 complement(38891..41899) [3009 bp, 1002 aa] {ON}
            YEL061C (REAL)
          Length = 1002

 Score =  511 bits (1315), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 305/715 (42%), Positives = 451/715 (63%), Gaps = 35/715 (4%)

Query: 254  NANAGGKTHVPPT--QTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRS 311
            N N G +  + P     GIYIQNL++FHI+ A E             VA+TK+ND SSRS
Sbjct: 300  NNNNGQRNSLAPNDQSNGIYIQNLQEFHITNAMEGLKLLQKGLKHRQVASTKMNDFSSRS 359

Query: 312  HTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVI 371
            HTIFTITLYKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGRVI
Sbjct: 360  HTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGRVI 419

Query: 372  NSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
            N+L DKS HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNI
Sbjct: 420  NALVDKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAKNI 479

Query: 432  KNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTEL 491
            KNKPQLG+FI+KDIL+K+++ EL K+++DL  TKSKEGIY++Q +YK +  DL+++K E+
Sbjct: 480  KNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMNQDHYKNLNSDLESYKNEV 539

Query: 492  TELKRTNDSLVQENELLGKEKKSGAE-------RADSLKSELDNLRSQLKSVTNKLAQTN 544
             E KR  +SL  +N LL KEK    E       + +SLK+ +D+LR+QL        + +
Sbjct: 540  QECKREIESLTSKNSLLVKEKLKSKETIQSQNSQIESLKATIDHLRTQLDKQHKTELEIS 599

Query: 545  TQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTL 604
              N+KL +++T++      ++  ++ Y+++      KF+  +  E+  +   + SQ  TL
Sbjct: 600  GFNSKL-QKLTEV------MQMALQDYKRRELDLNKKFETHITTEIKNMKTTLFSQLSTL 652

Query: 605  KNVNS-GNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVG 663
            +  N      I  ++D I+ EV+ L+ET +E AE +YK C+  +L E+PK F  I + + 
Sbjct: 653  QQRNILQETDIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNAIVEKI- 711

Query: 664  DIRGMT-EEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMS 722
            DI G+  E  Y  +A N SD+SEE N  KQY    FF+NNH E++  H D     ++K +
Sbjct: 712  DIIGVDFERFYKNIAENLSDISEENNNLKQYFTNHFFRNNHQELLSHHVDSTYEKIEKKT 771

Query: 723  DDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDS 782
            +  +++ + ++ ++L  N +++  ++      VI++EM LF PK+ KWE S DLIN+ DS
Sbjct: 772  NQFVENFKKALNDHLEENKKLIMKNLTTTTSAVIDQEMSLFEPKRVKWEHSFDLINECDS 831

Query: 783  LSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFK 842
            ++N+F N+M  ++  I S +  S+ SM++SIS +K  + E++ N+   + +N    + FK
Sbjct: 832  MNNEFYNSMATTLSQIKSTVDTSSNSMNKSISVMKGQVEESE-NAISLLKNNIKFNDQFK 890

Query: 843  AIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLI--HGDQYIHSTKGVHIPP-QN 899
             +  K   +   +   +T T    +  I ++  +I  ++  +G++  ++TK   I    N
Sbjct: 891  QLINKHTILKDNIESSITST-NSHITNIDDIYNTIEKIMNNYGNKE-NATKDEMIENLLN 948

Query: 900  RGPELHSTLIPLKPSSSNLNRLSDSTKSSPRKR-------SQGSEDETHASKIPK 947
              P L S  +PL+ S++N N + +    SP+K        S G+ D   + KI K
Sbjct: 949  EIPNL-SKRMPLRISNTNSNSMQNII--SPKKHAIEDENSSNGNPDSESSRKILK 1000

 Score =  219 bits (557), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 101/172 (58%), Positives = 130/172 (75%), Gaps = 5/172 (2%)

Query: 12  GEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIE 71
            +IG    +  +++NITVAVRCRGRN+REI  KS +           E+SINT+G +GI 
Sbjct: 23  SQIG-CHTVHNEELNITVAVRCRGRNEREISMKSSVVVNVPDITGSKEISINTTGDTGIT 81

Query: 72  AQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGD 131
           AQ+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD
Sbjct: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVASPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141

Query: 132 VEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLL 180
            E    G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DLL
Sbjct: 142 -EKLYNGELSDSAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLL 192

>NDAI0D00870 Chr4 complement(195749..198958) [3210 bp, 1069 aa] {ON}
            Anc_6.16
          Length = 1069

 Score =  512 bits (1319), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 304/691 (43%), Positives = 437/691 (63%), Gaps = 35/691 (5%)

Query: 253  LNANAGGKTHVP--PTQT-----------GIYIQNLKDFHISTAKEXXXXXXXXXXXXXV 299
            LN N+  +T+ P  PT +           GIYIQNL++FHIS AKE             V
Sbjct: 317  LNTNSNTRTNPPKLPTSSLETPPQDDNNNGIYIQNLQEFHISNAKEGLALLQKGLKYRQV 376

Query: 300  ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGS 359
            A+TK+ND SSRSHTIFTITLYK+ +  L+RLSK+NLVDLAGSEN+N++GA+N RAKE+GS
Sbjct: 377  ASTKMNDFSSRSHTIFTITLYKEHQGTLFRLSKMNLVDLAGSENINRSGAINQRAKETGS 436

Query: 360  INQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETC 419
            INQSLLTLGRVINSLAD++ HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETC
Sbjct: 437  INQSLLTLGRVINSLADRNNHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETC 496

Query: 420  STLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKE 479
            STLEYASKAKNIKNKPQLGS I KDILLK+++ EL ++++DL  TKSKEGIY+SQ++Y++
Sbjct: 497  STLEYASKAKNIKNKPQLGSIISKDILLKNITTELSQVKSDLLSTKSKEGIYMSQEHYQK 556

Query: 480  MVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNK 539
            ++++LDN KTE  E KR  + L  +N LL K+K++  E  +  + +L   +  +  +  K
Sbjct: 557  LMNELDNHKTEADESKRIIERLSSQNALLLKDKRTSNEVNELQRIKLSKFQDSINMLQEK 616

Query: 540  LAQTNTQNTKLSEQVTDMNRIQTE---LKSLIEVYQQKHETSKHKFQRLLKDELATLTAK 596
            +     QN K    V+ ++++QT     K +IE Y+ +    K K +++L+D+L +L   
Sbjct: 617  IE---IQNGKEQMLVSSVSKLQTSCDTFKKMIENYECQQIDVKSKIEQILEDDLLSLRNL 673

Query: 597  ILSQWDTLKNVNSG-NYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIF 655
            +    + +K +NSG ++ I +++D I+ EV+ +L TT+E AE  YK  I+  LK+TP+ F
Sbjct: 674  LQDHQNKIKTLNSGTDFDIGSNLDMIQNEVIKMLGTTQEKAEKTYKQFIEGFLKQTPENF 733

Query: 656  QLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVA 715
            + I +++ DI    + H+  +A+N SD+SEE+N  KQYL+   FQNNH ++I  H +  +
Sbjct: 734  KKIGEDINDINIKIQNHHAAVAQNLSDISEEYNNLKQYLNENLFQNNHEDLINAHINSTS 793

Query: 716  SNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESID 775
              +   +D L  + ++ +  +L +N  ++ NS      +VINKEM+LF P+K KWEESID
Sbjct: 794  QTLTNSADVLFNTFKDMMNKHLESNRNLMLNSFKAATDEVINKEMELFIPRKKKWEESID 853

Query: 776  LINQSDSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIE-----NDINSQEQ 830
            LINQ DSL+N F+  +T  +    S I  S   M  + + +K  +       N IN++  
Sbjct: 854  LINQCDSLNNGFQKEVTDGLSYTRSKITASINQMYDNSTRLKTEMSADNGGYNSINTKNV 913

Query: 831  INSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIR-----TLIHGDQ 885
            +  N+++   F  +  K N+I      +    A  S++ + +L+ SI+     T I G  
Sbjct: 914  VEDNQIIRTQFNELARK-NSIFQDNVENSLKCAVASVNNLNHLEDSIKMAVRDTRIKGGP 972

Query: 886  YIHSTKGVHIPPQN--RGPELHSTLIPLKPS 914
                  GV    +N   GP     L PL+P+
Sbjct: 973  -TEGEVGVPFKKENGKEGP-TKPGLQPLQPT 1001

 Score =  217 bits (553), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 128/161 (79%), Gaps = 4/161 (2%)

Query: 25  INITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKV 84
           +NITVAVRCRGRN+REI+ KS +           EVSINT+   GI AQ+ +KTYTVDKV
Sbjct: 52  LNITVAVRCRGRNEREIKLKSSVIVTVPDINGSNEVSINTTDDVGITAQMNSKTYTVDKV 111

Query: 85  YGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQA 144
           +GP ++Q+L+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G+++  A
Sbjct: 112 FGPSANQQLIFDEVAEPLFLDFIKGYNCTVLVYGMTSTGKTYTMTGDEKL-YNGELSESA 170

Query: 145 GIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSE 182
           GI PRIL KLF+ L   Q+DYVVKCSF+ELYNEDL+DLL++
Sbjct: 171 GIIPRILFKLFDTLEMNQEDYVVKCSFIELYNEDLKDLLND 211

>Suva_5.6 Chr5 complement(12298..15297) [3000 bp, 999 aa] {ON}
           YEL061C (REAL)
          Length = 999

 Score =  507 bits (1306), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 277/602 (46%), Positives = 409/602 (67%), Gaps = 10/602 (1%)

Query: 252 SLNANAGGKTHVPPT--QTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSS 309
           ++N N   ++ + P     GIYIQNL++FHI+ A E             VA+TK+ND SS
Sbjct: 295 NINTNNSQRSSMAPNDQSNGIYIQNLQEFHITNAMEGLNLLQRGLKHRQVASTKMNDFSS 354

Query: 310 RSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGR 369
           RSHTIFTITLYKK +D+L+R+SK+NLVDLAGSEN+N++GALN RAKE+GSINQSLLTLGR
Sbjct: 355 RSHTIFTITLYKKHQDELFRISKMNLVDLAGSENINRSGALNQRAKEAGSINQSLLTLGR 414

Query: 370 VINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAK 429
           VIN+LADKS HIPFRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAK
Sbjct: 415 VINALADKSGHIPFRESKLTRLLQDSLGGNTKTALIATISPAKVTSEETCSTLEYASKAK 474

Query: 430 NIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKT 489
           NIKNKPQLG+FI+KDIL+K+++ EL K+++DL  TKSKEGIY+SQ +YK +  DL+++K 
Sbjct: 475 NIKNKPQLGAFIMKDILVKNITMELAKIKSDLLSTKSKEGIYMSQDHYKNLNSDLESYKN 534

Query: 490 ELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLR---SQLKSVTNKLAQTNTQ 546
           E+ E KR  +SL  +N LL K+K    +   S  S++++L+   +QLK+  +K  +T  +
Sbjct: 535 EVQECKRDIESLSSKNSLLLKDKLKSKDTIQSQNSQMESLKLTINQLKAQLDKQHKTELE 594

Query: 547 NTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN 606
            +  + ++  +  I   ++  ++ Y+++      KF+  +  E+ +L   + SQ   ++ 
Sbjct: 595 ISGFNNKLQKLTEI---MQLALQDYKRRELDLNKKFETHISKEIKSLKTTLFSQLSGMEQ 651

Query: 607 VN-SGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDI 665
            N S    I  ++D I+ EV+ L+ET +E AE +YK C+  +L E+PK F +I + +  I
Sbjct: 652 NNISQETNIQPNLDIIKNEVLTLMETMQEKAELMYKDCVKKILNESPKFFNVIVEKIDII 711

Query: 666 RGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDL 725
           R   +  Y  +A N SD+SEE N  KQYL   FF+NNH E++  H D    +++K + + 
Sbjct: 712 RVDFQRFYNNIAENLSDISEENNNLKQYLKNHFFKNNHQELLNHHIDSTYEDIEKKTSEF 771

Query: 726 LQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSN 785
           +++ +N++ ++L  N +++  ++ +    VIN+EMDLF PK+ KWE S DLIN+ DS++N
Sbjct: 772 VENFKNTLNDHLEENKKLIMQNLTNATSAVINQEMDLFEPKRVKWENSFDLINKCDSMNN 831

Query: 786 KFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQ 845
           +F NNM  ++  I + +  S+ SM++SIS +K  + E++ N+   + +N+   + FK + 
Sbjct: 832 EFYNNMATTLSQIKNTVDTSSNSMNKSISVMKGQVEESE-NAVSLLKNNKKFNDQFKQLV 890

Query: 846 EK 847
            K
Sbjct: 891 NK 892

 Score =  218 bits (554), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 112/204 (54%), Positives = 143/204 (70%), Gaps = 14/204 (6%)

Query: 12  GEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIE 71
            +IG    +  +++NITVAVRCRGRN+REI  KS +           EVSINT+G +GI 
Sbjct: 23  AQIG-CHGVPNEELNITVAVRCRGRNEREIGMKSSVVVNVPDITGSEEVSINTTGDTGIT 81

Query: 72  AQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGD 131
           AQ+ AK YTVDKV+GP +SQ L+F++ A PLF DF++GYNCT+LVYGMTSTGKTYTMTGD
Sbjct: 82  AQMNAKRYTVDKVFGPGASQDLIFDEVAGPLFQDFIKGYNCTVLVYGMTSTGKTYTMTGD 141

Query: 132 VEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLL-SEGQDDF 187
            E    G+++  AGI PR+L+KLF+ L   Q+DYVVKCSF+ELYNE+L+DLL +   +  
Sbjct: 142 -EKLYNGELSDAAGIIPRVLLKLFDTLELQQNDYVVKCSFIELYNEELKDLLDNNSNNSS 200

Query: 188 SNGTENSSKQPESLNASKKLRIFD 211
           +NG E            KKLRIFD
Sbjct: 201 NNGFEGP--------FMKKLRIFD 216

>ZYRO0C07898g Chr3 complement(600676..603600) [2925 bp, 974 aa] {ON}
           some similarities with uniprot|P27895 Saccharomyces
           cerevisiae YEL061C CIN8 Kinesin motor protein involved
           in mitotic spindle assembly and chromosome segregation
          Length = 974

 Score =  500 bits (1287), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/672 (40%), Positives = 423/672 (62%), Gaps = 15/672 (2%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL 327
           +G+YIQNL+DFHI++A++             VATTK+ND SSRSHTIFTITLY++ + ++
Sbjct: 275 SGVYIQNLQDFHITSARDGLQLLQKGLRNRQVATTKMNDFSSRSHTIFTITLYREHQGEM 334

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESK 387
           +++SK+NLVDLAGSEN++++GA + RAKE+GSINQSLLTLGRVINSLADKSAH+PFRESK
Sbjct: 335 FKVSKMNLVDLAGSENISRSGAQHQRAKEAGSINQSLLTLGRVINSLADKSAHVPFRESK 394

Query: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILL 447
           LTRLLQDSLGGNTKT LIATISPAKI +EETCSTL+YASKAKNIKN+PQL SFI+KDIL+
Sbjct: 395 LTRLLQDSLGGNTKTALIATISPAKINSEETCSTLQYASKAKNIKNRPQLRSFIMKDILV 454

Query: 448 KDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENEL 507
           K+++ EL K+++DL  TK +EG+Y+SQ NYKE+ +DL+++KTE+ E KR  + L  +N L
Sbjct: 455 KNITAELAKVKSDLLSTKLREGVYMSQDNYKEITNDLESYKTEIQESKRIIERLSSQNSL 514

Query: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSL 567
           L K+KK+  E  +  + +L N++  +  ++ KL   + +  +L +   ++    +  +S+
Sbjct: 515 LLKDKKASNEVNELQRIKLQNMKDVMSGLSEKLESQHKKEQELVDMTCNLKSTLSLTQSV 574

Query: 568 IEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIH--------THID 619
           I+ Y Q+ +    + Q +L  E       +++  + ++  +SGN  +H         +++
Sbjct: 575 IKEYGQREKQISERMQMILGQEFLQFRQMLVNNIEDIRTNHSGNDILHEGEQNGIQQNLN 634

Query: 620 SIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARN 679
            +R EV+ LL   ++ AE +YK  I+ +L+E P +FQ IS+ V  +      ++  +  N
Sbjct: 635 VLRQEVVELLGLAQKRAEKMYKDWIEKILEEAPTVFQAISNKVDQVEVTVNTYHQRLTEN 694

Query: 680 FSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLST 739
            SD+SE +N  KQY +  FF+NNH E++ +H D     +Q  +D LLQ  +  + ++L  
Sbjct: 695 LSDISEGYNNLKQYFNDHFFKNNHEEVLNSHIDKTYQQLQFSADGLLQKFKQMMDDHLKD 754

Query: 740 NAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIA 799
           N  ++  S+     + I+KEM LF P++ KWEES DLIN  DS+SN F  +M  ++ DI 
Sbjct: 755 NKTLMMKSLQSATTEAIDKEMQLFEPQRKKWEESFDLINNCDSISNGFNGDMRSALSDIK 814

Query: 800 SVIRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDL 859
           S   +S + + RS+S +K  +   + ++   ++ NE++      I  K +++ + +   +
Sbjct: 815 STFGSSTDVISRSVSKVKDEVKGYE-DASTILDGNEVVKRQIADIINKDSSLRNGLYKSI 873

Query: 860 TVTAQESMDGIQNLDRSIR-TLIHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSSNL 918
             ++Q  +     L   IR T+   +  +H  K    PP  +  E      PLKP+    
Sbjct: 874 K-SSQGHISAFDELKERIRNTIASENSTLHQNKIATTPPLGQNSERS----PLKPTVLQP 928

Query: 919 NRLSDSTKSSPR 930
           N+L ++ +   R
Sbjct: 929 NQLPENWRYGLR 940

 Score =  210 bits (534), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 145/209 (69%), Gaps = 24/209 (11%)

Query: 6   LGNDPGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTS 65
           +G+ P G  G   A   +++NITVAVR RGRN+REI AKS +           EV+INT+
Sbjct: 1   MGSSPAG--GGEDA---EELNITVAVRSRGRNEREIRAKSSVVVSVPDVMGSHEVAINTT 55

Query: 66  GGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKT 125
              GI AQ+ +KTY VDKV+GP ++Q+L+F++ AEPLF DF++GYNCT+LVYGMTSTGKT
Sbjct: 56  DDVGITAQMNSKTYAVDKVFGPSANQQLIFKEIAEPLFGDFLKGYNCTVLVYGMTSTGKT 115

Query: 126 YTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSE 182
           YTMTGD ++  + +++  AGI PRIL KLFE L    +DYVVKCSFVELYNE+L+DLL  
Sbjct: 116 YTMTGDEKLYND-ELSDSAGIIPRILFKLFETLDLRDEDYVVKCSFVELYNEELKDLL-- 172

Query: 183 GQDDFSNGTENSSKQPESLNASKKLRIFD 211
             DD     ENSS         +KLRI+D
Sbjct: 173 --DD---SVENSS--------MRKLRIYD 188

>Kpol_1032.6 s1032 (9109..12123) [3015 bp, 1004 aa] {ON}
           (9109..12123) [3015 nt, 1005 aa]
          Length = 1004

 Score =  475 bits (1222), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 237/557 (42%), Positives = 392/557 (70%), Gaps = 1/557 (0%)

Query: 264 PPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKF 323
           P  QTGIYIQNLK+FHI++AKE             VA+TK+ND SSRSHTIFTI LYK+ 
Sbjct: 297 PDKQTGIYIQNLKEFHITSAKEGIELLQRGLQYRQVASTKMNDFSSRSHTIFTINLYKEH 356

Query: 324 KDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPF 383
              ++R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADK+ HIPF
Sbjct: 357 DGKIFRISKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNIHIPF 416

Query: 384 RESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK 443
           RESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYA+KAK+IKNKPQLGS I K
Sbjct: 417 RESKLTRLLQDSLGGNTKTALIATISPAKLNSEETCSTLEYAAKAKSIKNKPQLGSIITK 476

Query: 444 DILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQ 503
           DIL+K+++ EL K++ADL  TKS++G+Y+SQ +YKE+ +DL+++KTE+ E KR  D L  
Sbjct: 477 DILVKNIASELAKVKADLLSTKSRDGVYMSQIHYKELTNDLESYKTEVQECKRVIDGLTT 536

Query: 504 ENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTE 563
           +N LL K+KK+  E  +  K +L +++  +  + + + + + +   L + +  +     E
Sbjct: 537 QNGLLLKDKKASNEVHNLQKIKLQSMKDSISHLHDSIEKQHRKEQTLVDLILKLKSKSIE 596

Query: 564 LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTL-KNVNSGNYQIHTHIDSIR 622
           +++ I+ + ++ + ++ K +++  +EL  L + ++   + + K +   N  +  +I+ I+
Sbjct: 597 MQATIKYHSEREQVTQAKMKQIFNEELLRLKSLLIENLERINKKIVINNTDLGMNIEKIK 656

Query: 623 GEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSD 682
            EV ++++TT+  A  +YK C++ L+KE+P +   ++D++  ++ +++ +  +++ + S+
Sbjct: 657 DEVKSIIDTTQAEANHVYKDCMEQLMKESPILLGSLNDDIIKMQKISDLYNEQLSISISE 716

Query: 683 LSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQ 742
           L+ E N  KQYL+G FF+++H E++  H +    N+++ S  +++ ++  ++ YL  +  
Sbjct: 717 LNIEHNDLKQYLNGSFFKSDHEEILNEHIEKTYDNIRRASTGIVEQLKTGLELYLEESRN 776

Query: 743 MVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVI 802
           ++ +S+ +   D++  EM+LFAPKK KWE+S ++IN+ DSL+NK+  +++  + ++ + +
Sbjct: 777 IIIDSLKNTTSDIVKSEMELFAPKKKKWEDSFEMINKCDSLNNKYFGDISALLSNMKTSV 836

Query: 803 RNSNESMDRSISTIKKH 819
            ++++ +D  +S ++K+
Sbjct: 837 TSTSDLVDDHVSQMRKY 853

 Score =  221 bits (563), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 106/193 (54%), Positives = 141/193 (73%), Gaps = 20/193 (10%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           D++NI VAVRCRGRN+REI+AKS +           E++INT+   GI  Q+ +KTYTVD
Sbjct: 11  DELNIIVAVRCRGRNEREIKAKSSVVVSVPDVAGSSEIAINTTEDVGIAGQMNSKTYTVD 70

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP ++Q+L+FE+ AEPLF+DF+RGYNCT+LVYGMTSTGKTYTMTGD E    G+++ 
Sbjct: 71  KVFGPSANQRLIFEEVAEPLFNDFIRGYNCTVLVYGMTSTGKTYTMTGD-ERLYNGELSD 129

Query: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L KLF+ ++   DDY++KCSF+ELYNE+L+DLL E Q               
Sbjct: 130 SAGIIPRVLFKLFDAMEFQNDDYIIKCSFIELYNEELKDLLDECQ--------------- 174

Query: 200 SLNA-SKKLRIFD 211
           ++N+ +KKLRIFD
Sbjct: 175 AINSTAKKLRIFD 187

>CAGL0B03641g Chr2 (363897..366863) [2967 bp, 988 aa] {ON} similar
           to uniprot|P27895 Saccharomyces cerevisiae YEL061c CIN8
           Kinesin-like protein
          Length = 988

 Score =  467 bits (1201), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 254/620 (40%), Positives = 404/620 (65%), Gaps = 4/620 (0%)

Query: 264 PPTQTG-IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK 322
           P  Q+  IYIQNL++FHI++A E             VA+TK+ND SSRSH+IFTITLYK+
Sbjct: 302 PIDQSASIYIQNLEEFHITSAMEGLQLLQKGLKQRQVASTKMNDFSSRSHSIFTITLYKE 361

Query: 323 FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIP 382
              +L+R+SK+NLVDLAGSEN++++GA+N RAKE+GSINQSLLTLGRVINSLADKS HIP
Sbjct: 362 QNGELFRVSKMNLVDLAGSENISRSGAMNQRAKEAGSINQSLLTLGRVINSLADKSEHIP 421

Query: 383 FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFII 442
           FRESKLTRLLQDSLGGNTKT LIATISPAK+ +EETCSTLEYASKAKNIKNKPQLG+FI+
Sbjct: 422 FRESKLTRLLQDSLGGNTKTALIATISPAKMTSEETCSTLEYASKAKNIKNKPQLGAFIM 481

Query: 443 KDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLV 502
           KDIL++ ++ EL K+++DL  TKSKEG+Y+S ++YK++  D++ +KTEL E KR  +SL 
Sbjct: 482 KDILVRSITSELAKIKSDLLSTKSKEGVYMSHEHYKDLHYDIECYKTELEESKRAIESLT 541

Query: 503 QENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562
            +N +L +E+ S  +     K+ + +L+  + ++ + L +  T+ T +   + D+     
Sbjct: 542 AQNAMLQQERLSLKDDNACYKANIASLKDNVVTLQSSLKEQITKETNIRSLLKDVQGANE 601

Query: 563 ELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNS-GNYQIHTHIDSI 621
           E+K  I +++ K +  +      + DE++ +   +    + L+N     + +I  ++  +
Sbjct: 602 EMKKTIHLFEFKQQELQQSISTFISDEISNIRDTLKKHIEYLQNNGDLKDTEISGNLMRL 661

Query: 622 RGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFS 681
             EV+ +++  +E A   Y  C+  +LKETP++F+ +S  + +I  + EE+++++A   S
Sbjct: 662 EKEVVKVIKAAEEEASKSYGECVKMMLKETPRLFESVSGRLDNISKLAEENHSKIAETLS 721

Query: 682 DLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNA 741
           D+SEE+N  KQYL   FF+NNH E++  H     + +++ S  L+Q+    +  ++  N 
Sbjct: 722 DVSEEYNNLKQYLTNNFFKNNHEELLSHHVQNTYAQLEENSAQLMQNFTMMLDKHIQENK 781

Query: 742 QMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASV 801
           + +  +I  V  +VIN E+ +F  +++KWE+S  LINQ DS+++ F   +  ++ +I  V
Sbjct: 782 RHMLENILGVTDEVINNELQMFGEQRAKWEKSSALINQCDSVNHSFHQALGSNLVEIRDV 841

Query: 802 IRNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLVTGDLTV 861
           + +S +++  +IS+I+     N  + +E I  N+++      I++K N  L L     T 
Sbjct: 842 VSSSRDNIGATISSIQSR-TRNRQSIEEMIQGNDVIRQQITRIKQK-NKSLSLFKEHSTE 899

Query: 862 TAQESMDGIQNLDRSIRTLI 881
           TA  S+  +  ++ +++ ++
Sbjct: 900 TATTSIGSVNKVEGNLKVIM 919

 Score =  223 bits (567), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 140/192 (72%), Gaps = 17/192 (8%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NI VAVRCRGRN+REI+AKS +           EVSINT+   GI A++ +KTYTVD
Sbjct: 30  EELNILVAVRCRGRNEREIKAKSSVVVDVPDNGVTNEVSINTTDDVGIAAKMNSKTYTVD 89

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP +SQKLV+E+ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD ++   G++  
Sbjct: 90  KVFGPSASQKLVYEEIAEPLFQDFIKGYNCTILVYGMTSTGKTYTMTGDEKLH-NGELGD 148

Query: 143 QAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L +LF+ L+   DDY+VKCSFVELYNE+L+DLL     D +N   NS     
Sbjct: 149 AAGIIPRVLFELFDTLEANKDDYLVKCSFVELYNEELKDLL-----DSTNTATNSD---- 199

Query: 200 SLNASKKLRIFD 211
               +KKLRIFD
Sbjct: 200 ----NKKLRIFD 207

>KLLA0D01045g Chr4 (91110..94007) [2898 bp, 965 aa] {ON} similar to
           uniprot|Q8J1G7 Ashbya gossypii ACR010C CIN8 Kinesin-like
           protein CIN8 and some similarites with YEL061C
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 965

 Score =  446 bits (1147), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 245/573 (42%), Positives = 368/573 (64%), Gaps = 5/573 (0%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL 327
           + IYIQ+L++FHI+ AKE             VA+TK+NDVSSRSHTIFT+TLYK F  + 
Sbjct: 267 SAIYIQHLQEFHITDAKEGLRLLQKGLSHRQVASTKMNDVSSRSHTIFTLTLYKNFNGET 326

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESK 387
           +R+SKINLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADK+AHIPFRESK
Sbjct: 327 FRVSKINLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 386

Query: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILL 447
           LTRLLQDSLGGNTKT LIATISPAKI +EET STLEYA+KAKNIKNKPQLGSF++KDIL+
Sbjct: 387 LTRLLQDSLGGNTKTALIATISPAKINSEETSSTLEYATKAKNIKNKPQLGSFMMKDILV 446

Query: 448 KDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENEL 507
           K++S EL K+++D   TKSKEGIY+S  +Y E+++D++N+KTE+ E +R  + L  +N+L
Sbjct: 447 KNISHELAKLKSDFLSTKSKEGIYMSHLHYNEVMNDIENYKTEIQESRREIEKLSSQNQL 506

Query: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSL 567
           L K+KKS  +  +S + ++ NL+S +  +  K+   +    +L+  +  +      ++  
Sbjct: 507 LHKDKKSSQDTIESQRLQIRNLQSSMDYLYEKIDLKHKNEIELTNMIMKLKDAVRNMQGA 566

Query: 568 IEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLK-NVNSGNYQIHTHIDSIRGEVM 626
           ++ ++   +  +   Q++L D +     KI ++ D LK      ++ I   I++++  + 
Sbjct: 567 LKTHEDHEQRLQSDIQKMLYDNILEYRRKIETKLDNLKQQALEQSFTIDDDINNVKDSLE 626

Query: 627 NLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEE 686
            LLET K++A  + ++    ++ + PK F  +   + D+    +EH   +    S ++ E
Sbjct: 627 TLLETVKKDAIIMCENLAQKVVGDQPKFFNSMLSELNDMFSKVDEHTDRLKEGLSQITAE 686

Query: 687 FNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTN 746
            N  K YLD  FF+NNH E++  H D     +   S  L+  + N I +++  N  ++ +
Sbjct: 687 NNNLKAYLDTHFFRNNHQEILNVHADKTYHQLNLSSKHLMSKITNIISDHVEQNRTLLMD 746

Query: 747 SINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSN 806
           ++     +VI +EM  F P +  WE+S + IN  DSLSNKF+++ T+S++ + S +    
Sbjct: 747 TLKTATTEVITQEMSHFEPVRKTWEQSFNHINVCDSLSNKFKDDTTESLNSLKSHM---- 802

Query: 807 ESMDRSISTIKKHIIENDINSQEQINSNELLTN 839
           ES  R  S I   I +N  + Q++ +   + TN
Sbjct: 803 ESTVRESSLIADKIKDNLCHFQDRNDIANMTTN 835

 Score =  232 bits (592), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/194 (57%), Positives = 145/194 (74%), Gaps = 17/194 (8%)

Query: 21  EKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYT 80
           E D++NITVAVRCRGRN++EI+AKS +           EVSINTSG  GI A++ +KTYT
Sbjct: 9   EGDELNITVAVRCRGRNEKEIKAKSSVVVNCPDVIGANEVSINTSGDIGITARMNSKTYT 68

Query: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDV 140
           VDKV+GP + Q LVF++ A+P+FHDF++GYNCTMLVYGMTSTGKTYTMTGD ++  +G++
Sbjct: 69  VDKVFGPSADQSLVFKEIADPMFHDFIKGYNCTMLVYGMTSTGKTYTMTGDEKL-YDGEL 127

Query: 141 NGQAGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197
           +  AGI PR+L KLF+ L   + DY+VKCSF+ELYNE+L+DLL +GQD  S G       
Sbjct: 128 SEAAGIIPRVLFKLFDTLEVQESDYMVKCSFIELYNEELKDLLDDGQD--SGG------- 178

Query: 198 PESLNASKKLRIFD 211
               N S+KLRI+D
Sbjct: 179 ----NNSRKLRIYD 188

>TBLA0A07230 Chr1 (1803117..1806410) [3294 bp, 1097 aa] {ON}
           Anc_6.16 YEL061C
          Length = 1097

 Score =  449 bits (1154), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 252/589 (42%), Positives = 379/589 (64%), Gaps = 25/589 (4%)

Query: 263 VPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK 322
            P     IYIQNL++F+I+ A +             VA+TK+NDVSSRSHTIFTITLYK+
Sbjct: 327 APDNNNQIYIQNLQEFYINNATDGIKLLQKGLRHRKVASTKMNDVSSRSHTIFTITLYKE 386

Query: 323 FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIP 382
               LYR+SK+NLVDLAGSEN+NK+GA + RAKE+GSINQSLLTLGRVINSLADKS HIP
Sbjct: 387 HNGGLYRVSKMNLVDLAGSENINKSGAQHQRAKEAGSINQSLLTLGRVINSLADKSIHIP 446

Query: 383 FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFII 442
           FRESKLTRLLQDSLGGNTKTVLI+TISPAKI  +ET STLEYASKAKNIKNKP LGSFI+
Sbjct: 447 FRESKLTRLLQDSLGGNTKTVLISTISPAKINVDETSSTLEYASKAKNIKNKPHLGSFIM 506

Query: 443 KDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLV 502
           KD+LLK+++ EL K+++DL  T+ K+G+Y+SQ++YKE+ +DL+++KTE+ E KR N+ L+
Sbjct: 507 KDVLLKNITTELNKIKSDLMSTRLKDGVYMSQQHYKELNNDLESYKTEVQESKRANERLI 566

Query: 503 QENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562
            +N  L K+KK+  E  +  + +++    ++K +   L +   +   L E +  +  + T
Sbjct: 567 SQNGSLLKDKKASNELNELQRIQIEKKNEKIKELYEILDEHYKREDILVELIRQLKNVGT 626

Query: 563 ELKSLIEVYQQK----HETSKHKFQ---RLLKDELATLTAKILSQ-WDTLKN-------- 606
            ++S IE Y+++     E++K   +   + LK+EL+ + + I     D LK+        
Sbjct: 627 SMQSTIENYRERDLEIEESTKKILENEFKFLKNELSQILSNINGNIIDNLKSSIISNNSS 686

Query: 607 ---VNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVG 663
              ++S N+Q   +ID I    + +L+  +E ++ +Y SCI+ +L + P I       + 
Sbjct: 687 IEAIDSSNFQ--KNIDIIENTTLKILKQVQEKSQHIYSSCIERILSDIPNILNKFKIEIN 744

Query: 664 DIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSD 723
            I     + + ++  N SDLSEE+N FK+YL+  F QNN+  +++ H +   S ++  S+
Sbjct: 745 SIDFQYNDQFNKITENLSDLSEEYNNFKEYLNNSFLQNNYELILKNHLESGQSQIESFSN 804

Query: 724 DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSL 783
           +LL ++   I  +   N+++    +N++  D++ KE +   P K KW +SI++IN +D +
Sbjct: 805 NLLLNINKQINEFKLHNSKLYEEKLNNIKNDIVKKETESIKPYKEKWVKSIEIINSTDKI 864

Query: 784 SNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINSQEQIN 832
           +N F N+M   +  I ++I  S+  ++ SI+ IK     N+I   E +N
Sbjct: 865 NNTFHNDMNNRILQINNLILQSHNDINNSINDIKV----NEIRENEAVN 909

 Score =  229 bits (583), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 136/192 (70%), Gaps = 20/192 (10%)

Query: 23  DDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVD 82
           +++NITVAVRCRGRN+RE++AKS +           EVSINTS   GI A + +KTYTVD
Sbjct: 9   EELNITVAVRCRGRNEREVQAKSSVVVSVPDIMGSNEVSINTSDEVGIAAHMNSKTYTVD 68

Query: 83  KVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG 142
           KV+GP +SQ L+F++ AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++ 
Sbjct: 69  KVFGPSASQDLMFKEIAEPLFEDFIKGYNCTILVYGMTSTGKTYTMTGD-EKLYDGELSD 127

Query: 143 QAGIAPRILVKLF---ECLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPE 199
            AGI PR+L KLF   E L DDY++KCSFVELYNEDL+DLL +  D              
Sbjct: 128 SAGIIPRVLFKLFESPEILNDDYIIKCSFVELYNEDLKDLLDDSVD-------------- 173

Query: 200 SLNASKKLRIFD 211
             N  KKLRIFD
Sbjct: 174 --NTYKKLRIFD 183

>SAKL0E01078g Chr5 (80541..83387) [2847 bp, 948 aa] {ON} similar to
           uniprot|P27895 Saccharomyces cerevisiae YEL061C CIN8
           Kinesin motor protein involved in mitotic spindle
           assembly and chromosome segregation
          Length = 948

 Score =  438 bits (1127), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 254/621 (40%), Positives = 389/621 (62%), Gaps = 15/621 (2%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL 327
           + IYIQNL++FHI+ AK+             VA+TK+ND SSRSHTIFTI LYK    ++
Sbjct: 259 SAIYIQNLQEFHITNAKDGINLLQRGLKHRQVASTKMNDFSSRSHTIFTIMLYKNHNGEV 318

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESK 387
           +R+SK+NLVDLAGSEN++++GA N RAKE+GSINQSLLTLGRVINSLADK+AHIPFRESK
Sbjct: 319 FRVSKMNLVDLAGSENISRSGAQNQRAKEAGSINQSLLTLGRVINSLADKNAHIPFRESK 378

Query: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILL 447
           LTRLLQDSLGGNTKT LIATISPAKI AEET STLEYA+KAKNIKNKPQLG+ ++KDIL+
Sbjct: 379 LTRLLQDSLGGNTKTALIATISPAKINAEETSSTLEYATKAKNIKNKPQLGTLVMKDILV 438

Query: 448 KDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENEL 507
           K++++EL K+++D   TKSK+GIY++Q +YKE+  DL+N+KTE+ E KR  + +  +N L
Sbjct: 439 KNITRELAKIKSDFLSTKSKDGIYMTQDHYKELTSDLENYKTEVQECKREIEKMNSQNVL 498

Query: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMN----RIQTE 563
           L K+K++  E ++  + ++ +L  ++  + +K+ + +     L   +  +      +Q  
Sbjct: 499 LLKDKRASHEVSELQRIKIKHLNDKIAHLYDKMDKQHKNEQDLVCTIHTLKDAIYTVQNS 558

Query: 564 LKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNY-QIHTHIDSIR 622
           LK+  E YQ +    K + + +L D + +    I  Q   +K  +S  +  I  +ID I+
Sbjct: 559 LKN-CEDYQLQ---CKSEMEDVLYDHVTSFKQSIHEQLAAMKASHSSRHLGIDGNIDIIQ 614

Query: 623 GEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSD 682
            E+  +LE+    +  + +SC++ +L+  PK F+ I  ++ DI  + + +  E+ +N  D
Sbjct: 615 EELSQVLESICSTSVDVCRSCVEKILESNPKHFESIRRDLLDISTVVDSYSNELVKNLGD 674

Query: 683 LSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQ 742
           +SEE+N F++YL+   F+NNH E +  H D     ++K + +L    +  + ++L  N  
Sbjct: 675 ISEEYNNFREYLNEHLFKNNHEETLSIHVDKTYHMLKKSAGELFSKFKEMMDSHLEENKS 734

Query: 743 MVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVI 802
           ++  S+   + +V+ KE+ LFAP K KWE S++ IN+ DSL+N F + +  ++  +   I
Sbjct: 735 LMIKSLKTASDEVVAKEVKLFAPVKQKWESSLENINKCDSLNNTFDSTVKDALRRLEGNI 794

Query: 803 RNSNESMDRSISTIKKHIIENDINSQEQINSNELLTNSFKAIQEKSNNILHLV--TGDLT 860
             S E    +   +K  + + D    E + +N  + N+   ++EK   +   V  T    
Sbjct: 795 EGSLEFSKNTAGDVKDSLKKFD-GISEVLKNNTKVVNNINEVKEKHTFLRDQVERTSSYI 853

Query: 861 VTAQESMDGIQNLDRSIRTLI 881
             A E  +GI   D+ IR +I
Sbjct: 854 EAANEKFEGI---DQFIRQII 871

 Score =  218 bits (555), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 136/191 (71%), Gaps = 19/191 (9%)

Query: 24  DINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDK 83
           ++NITV+VRCRGRN+REI+AKS +           EVSINT+   GI AQ+ +KTYTVDK
Sbjct: 16  ELNITVSVRCRGRNEREIKAKSSVVVTVPDVTGSNEVSINTTDELGITAQMNSKTYTVDK 75

Query: 84  VYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ 143
           V+GP + Q L+F+  AEPLF DF++GYNCT+LVYGMTSTGKTYTMTGD E   +G+++  
Sbjct: 76  VFGPSADQSLIFKQIAEPLFDDFIKGYNCTVLVYGMTSTGKTYTMTGD-ERLYDGELSDA 134

Query: 144 AGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQPES 200
           AGI PRIL KLF+ L+   +DY+VKCSF+ELYNE+L+DLL+E               P+ 
Sbjct: 135 AGIIPRILFKLFDTLETQDEDYLVKCSFIELYNEELKDLLNE---------------PQE 179

Query: 201 LNASKKLRIFD 211
               KKLRIFD
Sbjct: 180 SGVIKKLRIFD 190

>Kpol_1045.73 s1045 complement(169347..172235) [2889 bp, 962 aa]
           {ON} complement(169349..172237) [2889 nt, 963 aa]
          Length = 962

 Score =  406 bits (1043), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 276/878 (31%), Positives = 458/878 (52%), Gaps = 61/878 (6%)

Query: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136
           + + +D ++  D  Q+ ++ D  +P+F DF+ GYNC+ LVYG T +GKTYT++G+ +   
Sbjct: 56  REFGMDHIFSSDVVQEQLYLDSLKPMFQDFINGYNCSTLVYGKTGSGKTYTLSGEEDSLL 115

Query: 137 EGDVNG-QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192
             + +    G+ PR+L +LF+   C   D+VVKCS+VE+YNE+L+DLL +  +       
Sbjct: 116 HSEASRLSVGVIPRVLEELFDHLSCNNIDHVVKCSYVEIYNEELKDLLVDQHNSL----- 170

Query: 193 NSSKQPESLNAS-KKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDM 251
                   L+AS KKLRI D                   +                    
Sbjct: 171 --------LSASIKKLRIVDSGSPNVKNGANSNCNTRDNSPLTSSKSIPTAIIRKKMGRQ 222

Query: 252 SLNANAGGKT----------------HVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXX 295
           SL A     T                H+       YIQNL++FHI+ AKE          
Sbjct: 223 SLTALKQANTLSISRSNSFNEYSPQRHIQEKTGAPYIQNLEEFHITNAKEGIQLLHRGLK 282

Query: 296 XXXVATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAK 355
              +A++K    SSR+ TIFTI LYK+ + +++R+SK N VDLAG+E+ +K    N R K
Sbjct: 283 NRQIASSKNQKYSSRASTIFTIVLYKEEEGEIFRVSKWNFVDLAGAEHSHKIEGTNQRFK 342

Query: 356 ESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           +   INQ +  L +++NSL +K + IPF++SKLT L++D+L GN+K++ I T+   K + 
Sbjct: 343 DINIINQGIQNLNKIVNSLHEKESVIPFKDSKLTYLIKDTLEGNSKSIFILTLRFNKDSL 402

Query: 416 EETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQK 475
           +E   TLE+ +K +++K  P LG  I K+ L+K +S EL K+++DL  TKSKEG+Y+S +
Sbjct: 403 DEMIETLEFGNKVRSLKCYPLLGPSINKETLIKSISNELAKVKSDLLSTKSKEGVYMSHE 462

Query: 476 NYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKS 535
           +Y  +  DLD  K E+ +LK+  D L +++  L K+K++  E  +  + +L ++R  +  
Sbjct: 463 HYDVLTKDLDKHKVEIMDLKKVIDELNEQSTTLRKDKRAFEEVNEVQRIKLQSMRDSVSM 522

Query: 536 V-TNKLAQTNTQN------TKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKD 588
           + TN   Q   ++       KL E V +MN         I  Y  +  + + + + L  +
Sbjct: 523 MYTNIEKQQRREHDLINSTDKLKETVNNMN-------VTIARYTDRESSVQTQMKTLFNE 575

Query: 589 ELATLTAKILSQWDTL-KNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDL 647
           EL+ L + +L       KN    N +I  +++    E+  +L+ ++   ++L+  CI  +
Sbjct: 576 ELSKLKSMLLKNLRQFEKNELIDNLEIENNLNKAHEEIKQILQISENEIDSLFLDCIKKM 635

Query: 648 LKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMI 707
            +E+PK+F     +V  +   T E+Y  +A   SD+SEEFN  KQY++ +FF+NNH E++
Sbjct: 636 SEESPKLFSSFIQDVSRLENSTSENYNNLAELLSDVSEEFNNLKQYINEKFFKNNHEELL 695

Query: 708 QTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKK 767
           +T+ +     +QK SDD L    + +++YL  N  ++  +I     +VI  EM+ F P+K
Sbjct: 696 KTYVNKTYHQVQKSSDDFLLKFNDLLESYLEGNKSVLLQNIKSATSEVIENEMNHFIPQK 755

Query: 768 SKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIRNSNESMDRSISTIKKHIIENDINS 827
            KWE+SI+LI +S   SN+F+      V  +   ++ ++ES+  ++S +K  I  N++  
Sbjct: 756 EKWEKSIELIEKSKHSSNEFKTKNRVIVGKLQDTLKGTSESLFDTLSEMKSKI--NELQK 813

Query: 828 QEQ-INSNELLTNSFKAIQEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTL------ 880
               I +NE++T  F +I +K N IL         + +ES+     LD SIR +      
Sbjct: 814 AANIIENNEVVTEEFISIMKK-NGILKDTLNINMTSTEESIVAFDKLDDSIRNVFKNEID 872

Query: 881 --IHGDQYIHSTKGVHIPPQNRGPELHSTLIPLKPSSS 916
             I G Q I       +  Q   P + +   P++ S S
Sbjct: 873 TNITGYQSILKEIFDQLDQQRLTPNMRNRKSPVRQSVS 910

>ACR228C Chr3 complement(758111..761500) [3390 bp, 1129 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBL063W
           (KIP1)
          Length = 1129

 Score =  347 bits (890), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 284/873 (32%), Positives = 430/873 (49%), Gaps = 156/873 (17%)

Query: 24  DINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQL------QAK 77
           + NI V VRCR RN+REI  KS              V I+T G +G E  L        K
Sbjct: 52  EYNIKVYVRCRSRNEREIREKS-------------SVVISTLGNNGREVILTNPGTGSNK 98

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM--G 135
           TYT D+V+G +S Q+ +F   A    ++ + GYNCT+  YG T TGKTYTM+GD+ M   
Sbjct: 99  TYTFDRVFGVESDQESMFNQVARAYINEMIEGYNCTVFAYGQTGTGKTYTMSGDITMMGS 158

Query: 136 AEGDVN-----GQAGIAPRILVKLFECLQD---DYVVKCSFVELYNEDLRDLLSEGQD-D 186
           +E D N       AGI PR+LV+LF  L++   DY VK SF+ELYNE LRDLL + +D  
Sbjct: 159 SEDDPNFVLLSEHAGIIPRVLVELFRELREVSEDYSVKVSFLELYNEKLRDLLVDDKDVS 218

Query: 187 FSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXX 246
             +   N    PES+      RI+D                                   
Sbjct: 219 LEDHNFNGMAPPESI------RIYD----------------------------------- 237

Query: 247 XXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLND 306
                SL  +        P    I+++ +++ +I +A+E             VA TK ND
Sbjct: 238 -----SLKTD-----RTSPNGYSIFVKGMEEMYIRSAQEGLKLLMDGSLKRKVAATKCND 287

Query: 307 VSSRSHTIFTIT-----LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSIN 361
           +SSRSHTIFTIT     ++    +   ++ K+NLVDLAGSEN+N++GA N RA+E+G IN
Sbjct: 288 LSSRSHTIFTITTNVTKIHPISGEQYVKVGKLNLVDLAGSENINRSGAENKRAQEAGLIN 347

Query: 362 QSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCST 421
           +SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET ST
Sbjct: 348 KSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVST 407

Query: 422 LEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNY---- 477
           LEYA++AK+IKN PQ+   + K+  + +  QE+ ++R +L  + SKEGIY++Q+ +    
Sbjct: 408 LEYATRAKSIKNTPQVNQLMAKESCIIEYIQEIERLRKELRASHSKEGIYITQEKFETYE 467

Query: 478 ------KEMVDDLDNFKTELTELKRT---NDSLVQENELLGKE----KKSGAERADSLKS 524
                 +E    +DN + +L  LK        L++E +   KE     +   E++  L  
Sbjct: 468 SNSILVEEQQAKIDNLQEQLRRLKEKFLEQTKLIKEKDGQIKELDVANRKYLEQSKDLTI 527

Query: 525 ELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNR--IQTELKSLIEVYQQKHETSKHKF 582
            ++ + S+L+   + +   +  N KL E + D NR  I  +L + ++      ET     
Sbjct: 528 YINGIHSKLEDYEHTMIGIHNNNMKLLEDIND-NRGNIHEDLLAKVD----HIETCNLII 582

Query: 583 QRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKS 642
            R +   L ++   + +  D  K V  G +      + ++ ++  +  TT+E+   +  S
Sbjct: 583 SREITS-LISIRNVLQAYSDRFKTVLGGVF------EELQEKLTQVGRTTEESQLDVDLS 635

Query: 643 CIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTF----KQYLDGQF 698
            +D+  +E   I +   +N+  +R M +EH + M    +DL+    +      Q L G+ 
Sbjct: 636 FVDEKFEEVTDIIKATCENL--VRTM-DEHVSNMKLETTDLTSSCASLLEKECQALHGKL 692

Query: 699 FQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINK 758
                       Q  V S  Q+++  L + V++     L   A  + N +      +I+ 
Sbjct: 693 ------------QKYVESMKQELNSTLQEMVRD-----LDMKASSMLNVVQCTKDGLISH 735

Query: 759 EMDLFAPKKSKWEESIDLINQSDSLSNKFRNNMTKSVDDIASVIR-NSNESMDRSISTIK 817
           + +L A  +S+  E  D+              M + +  I    R N  ESM  S   + 
Sbjct: 736 KKELEADLESQKREHFDIA-----------QTMEEQLQKIVGKERQNIQESMKASYDFLM 784

Query: 818 KHIIENDINSQEQINSNELLTNSFKAIQEKSNN 850
           K ++E ++    Q N  E + +  K +   SNN
Sbjct: 785 KQMVETELR---QKNFEESIVSKVKGLLSHSNN 814

>SAKL0F12298g Chr6 complement(958588..961926) [3339 bp, 1112 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1112

 Score =  339 bits (869), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 248/686 (36%), Positives = 347/686 (50%), Gaps = 149/686 (21%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQA--------- 76
           NI V VRCR RNKREI  KS              V I+T G  G +  L           
Sbjct: 54  NIKVYVRCRSRNKREIGEKSS-------------VVISTMGAQGRDVILSNPSSSSSGSL 100

Query: 77  ----KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDV 132
               KTYT D+V+G +S Q++VF   A+    + ++GYNCT+  YG T TGKTYTM+GD+
Sbjct: 101 TNVKKTYTFDRVFGAESDQEVVFNSVAKNYISEMLQGYNCTVFAYGQTGTGKTYTMSGDI 160

Query: 133 E-MGAEGDVNGQ--------AGIAPRILVKLFECLQD---DYVVKCSFVELYNEDLRDLL 180
             +G+    + Q        AGI PR+LV LF+ L++   DY VK SF+ELYNE L+DLL
Sbjct: 161 NILGSTTHNHDQSSILLSEHAGIIPRVLVDLFKDLKNESTDYSVKVSFLELYNERLKDLL 220

Query: 181 SEGQDDFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXX 240
           ++   +  N  E+             +RIFD                             
Sbjct: 221 ADSNKEDDNNAES-------------IRIFD----------------------------- 238

Query: 241 XXXXXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVA 300
                    ++    N  G +H       I ++ +++ +I +A+E             VA
Sbjct: 239 ---------NIKPEKNTQG-SH------SIMVKGMEEIYIKSAQEGLKLLTEGSIKRQVA 282

Query: 301 TTKLNDVSSRSHTIFTITLYKKFKDDL-----YRLSKINLVDLAGSENVNKAGALNLRAK 355
           +TK ND+SSRSHT+FTIT      D L      +  K+NLVDLAGSEN+N++GA N RA+
Sbjct: 283 STKCNDLSSRSHTVFTITTNVTKVDPLSGEEYVKNGKLNLVDLAGSENINRSGAENKRAQ 342

Query: 356 ESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           E+G IN+SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ 
Sbjct: 343 EAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISM 402

Query: 416 EETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQK 475
           EET STLEYA++AK+IKN PQ+   + KD  + +   E+ ++R +L  T++K+GIY++Q+
Sbjct: 403 EETVSTLEYATRAKSIKNTPQINQSMTKDSCITEYIHEIDRLRKELRATRTKDGIYITQE 462

Query: 476 NYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKS 535
            Y               +L  +N  LV E                  K+ +DNL  Q+K 
Sbjct: 463 KY---------------DLYESNCILVGEQ-----------------KARIDNLEEQIKR 490

Query: 536 VTNKLAQTN--TQNTKLSEQVTDMNRIQT-ELKSLIE----VYQQKHETSKHKFQRLLKD 588
              K  Q    T+ T+   Q  D++  Q  E K L+E      QQK  + +H+   +   
Sbjct: 491 FKEKYVQQVNITKETEQKLQKIDLSYQQVWEKKQLLESSLDYLQQKCNSFEHEITEIHHK 550

Query: 589 ELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAETL--YKSCIDD 646
            L  L + I+ + DT+       Y+  T  D     +   L T K   +TL  Y      
Sbjct: 551 NLKILDS-IVDERDTISEDLVQKYRYITETDHC---ITKELTTLKNVKKTLNNYNKSFKG 606

Query: 647 LLKETPKIFQLISDNVGDIRGMTEEH 672
           +LK    +FQ + D V ++  +TEE 
Sbjct: 607 VLKS---VFQELQDKVINLSAVTEEQ 629

>Skud_2.41 Chr2 (85542..88874) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  338 bits (868), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 252/703 (35%), Positives = 364/703 (51%), Gaps = 123/703 (17%)

Query: 24  DINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDK 83
           D NI V VRCR RNKREI+ KS +              I  S GS        KTY  D+
Sbjct: 49  DSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGK---EIILSNGSHQSYSSSKKTYQFDQ 105

Query: 84  VYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG- 142
           V+G +S Q+ VF   A+    + + GYNCT+  YG T TGKTYTM+GD+ +   GDV   
Sbjct: 106 VFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL--GDVQST 163

Query: 143 -------QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192
                   AGI PR+LV LF+    L  +Y VK +F+ELYNE+L+DLLS+ +DD      
Sbjct: 164 DNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVTFLELYNENLKDLLSDNEDD------ 217

Query: 193 NSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMS 252
                P   ++ +++RIFD                                         
Sbjct: 218 ----DPAVNDSKRQIRIFD----------------------------------------- 232

Query: 253 LNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSH 312
            N N      V   Q         +  I++A E             VA TK ND+SSRSH
Sbjct: 233 -NNNNNSSIMVKGMQ---------EIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSH 282

Query: 313 TIFTIT---LYKKFKD-----DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSL 364
           T+FTIT   + +  KD     +  ++ K+NLVDLAGSEN+N++GA N RA+E+G IN+SL
Sbjct: 283 TVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSL 342

Query: 365 LTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEY 424
           LTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLEY
Sbjct: 343 LTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISPAKISMEETASTLEY 402

Query: 425 ASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDL 484
           A++AK+IKN PQ+   + KD  LKD  QE+ K+R DL  +++K+GI+++Q       D L
Sbjct: 403 ATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ-------DQL 455

Query: 485 DNFKTELTELKRTNDSLVQE-----NELLGKEKKSGAERADSLKSELDN-LRSQLKSVTN 538
           D        L  +N  L+ E     + L G+ KK      + L  +++N L+S+ + + N
Sbjct: 456 D--------LYESNSILIDEQNLKIHNLRGQIKKFKGNYLNQL--DVNNFLQSEKEKLIN 505

Query: 539 KLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQ-KHETSKHKFQRLLKDELAT-LTAK 596
            +   N   +  + ++  ++    EL + I + +    ETS+ ++      EL T +T +
Sbjct: 506 VIRNFNVDFSNFNSEIQKIHHTNLELMNEITLQRDLSQETSQEQYTT--SQELQTKITQQ 563

Query: 597 ILSQWDTLK----NVNSGNYQIHTHIDSIRGEVMNLLETTKENA-ETLYKSCIDDLLKET 651
           +L    TL+    N NS   Q+   +       +N  +   ++A E+L+ +  + L  + 
Sbjct: 564 VLQTLSTLQSSLMNYNSKFSQVINGVTEELSRNVNFHKLKHDSALESLFDTSANQLTIKL 623

Query: 652 PKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYL 694
            ++   IS ++   R  +  HY +      DL+E + + KQ+L
Sbjct: 624 NELVNGISHSLKHFRDDSVSHYNK------DLNEVYLSHKQFL 660

>NCAS0E02640 Chr5 (527838..531146) [3309 bp, 1102 aa] {ON} Anc_7.387
          Length = 1102

 Score =  329 bits (844), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 252/777 (32%), Positives = 383/777 (49%), Gaps = 146/777 (18%)

Query: 27  ITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVYG 86
           I V VRCR RN+REI+ KS +           ++ ++        A+   +TYT D+V+G
Sbjct: 61  IKVYVRCRSRNEREIQEKSSVVISTLGAPQSTQLLLSNPLLPLAYAK---RTYTFDRVFG 117

Query: 87  PDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVE-MGAEGDVNG--- 142
            +S Q+ VF D A+   H+ + GYNCT+  YG T TGKTYTM+GD+  +G + D N    
Sbjct: 118 AESDQESVFNDAAKNYIHEMLEGYNCTVFAYGQTGTGKTYTMSGDLNILGGDLDSNTMVL 177

Query: 143 ---QAGIAPRILVKLFECL--QDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENSSKQ 197
               AGI PR+LV+LF  L   + Y VK SF+ELYNE L+DLL+  Q +  N        
Sbjct: 178 LGEHAGIIPRVLVELFRWLDGNEGYSVKVSFLELYNERLKDLLASEQSEEEN-------- 229

Query: 198 PESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLNANA 257
                    +RIFD                                          N +A
Sbjct: 230 ---------IRIFD------------------------------------------NVSA 238

Query: 258 GGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTI 317
                     + I ++ +++ +I++A +             VA TK ND+SSRSHT+FTI
Sbjct: 239 S---------SSIMVKGMEEIYINSAHQGLQLLMDGSIKRKVAATKCNDLSSRSHTVFTI 289

Query: 318 T-----LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVIN 372
           T     L     +   +  K+NLVDLAGSEN+N++GA N RA+E+G IN+SLLTLGRVIN
Sbjct: 290 TTNITKLDPVSGEQYVKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVIN 349

Query: 373 SLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIK 432
           +L D + HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYA++AK+IK
Sbjct: 350 ALVDHTQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETISTLEYATRAKSIK 409

Query: 433 NKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELT 492
           N PQ+   + KD  + +   E+ ++R +L  ++ K+GI ++Q          D F     
Sbjct: 410 NTPQVNQSMSKDSCINEYVHEIERLRQELKTSRQKDGISITQ----------DQF----- 454

Query: 493 ELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSE 552
           +L  +N  LV E                  K+++ N+  Q++   +K  +    N  L  
Sbjct: 455 DLYESNGILVDEQ-----------------KTKIQNMEEQIQRFKDKYVKQTELNKNLES 497

Query: 553 QV--TDMNRIQ-----TELKSLIEVYQQKHETSKHKFQRLLK--DELATLTAKILSQWDT 603
           ++   ++  IQ     T+L SL+E +Q     S H  +R+ K  D    L  ++  Q   
Sbjct: 498 RLKQNELQTIQLKSQRTQLLSLLENFQ---SNSNHYIERVTKIHDSNTHLIQQLAQQRSE 554

Query: 604 LKNVNSGNYQIHTHIDSIRGEVMNLLETTKENAE--TLYKSCIDDLLKETPKIFQLISDN 661
           L N   G+    T++ S+   +  + +  KE +E   + +S  D        IF  + D 
Sbjct: 555 LHN---GSI---TYVKSVTEAMSGISDQQKELSELRNVLQSYNDKFKHVITGIFTELEDK 608

Query: 662 VGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKM 721
           V D R  T E  T M  N   + +     +  +  +F      EM++  +    + + K 
Sbjct: 609 VKDTRKSTLEPLTSM--NLRLILDMIGELRDDISTRF------EMLKKPRTEDTTKIFKA 660

Query: 722 SDDLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPK-KSKWEESIDLI 777
             D++++  + I  Y  +  +++T SIN      +    D+F  K K + +E +++I
Sbjct: 661 HQDIIETCFSHINEYCDSMEKVLTTSINQFQAHSLPSSFDIFQDKTKKELDELMNII 717

>Ecym_4688 Chr4 (1342239..1345643) [3405 bp, 1134 aa] {ON} similar
           to Ashbya gossypii ACR228C
          Length = 1134

 Score =  329 bits (843), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 209/552 (37%), Positives = 305/552 (55%), Gaps = 98/552 (17%)

Query: 21  EKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYT 80
           E+   NI V VRCR RN REI+ KS +            +  N S G+        KTYT
Sbjct: 51  EEQGYNIKVYVRCRSRNVREIKEKSSVVVSTLGSQGREIILSNQSTGNN-------KTYT 103

Query: 81  VDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM-GAEGD 139
            D+V+G +S Q+ +F+  A     + + GYNCT+  YG T TGKTYTM+GD+ + GA  +
Sbjct: 104 FDQVFGVESDQESLFDKVARAYITEMLEGYNCTVFAYGQTGTGKTYTMSGDISVVGASLE 163

Query: 140 ------VNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDF--- 187
                 ++  AGI PR+LV+LF+ LQ   +DY VK SF+ELYNE LRDLL E ++     
Sbjct: 164 DPNYVLLSEHAGIIPRVLVELFQQLQRESEDYSVKVSFLELYNEKLRDLLVEDKEPLIDE 223

Query: 188 ---SNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXX 244
                G  NS   PE++      RI+D                                 
Sbjct: 224 GGIGGGVANS---PETI------RIYD--------------------------------- 241

Query: 245 XXXXDDMSLN-ANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTK 303
                ++ L+ +N+ G +        I ++ +++ +I +A+E             VA T+
Sbjct: 242 -----NLKLDRSNSSGHS--------IMVKGMEEMYIRSAQEGLKLLMEGSLKRKVAATR 288

Query: 304 LNDVSSRSHTIFTIT-----LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
            ND+SSRSHTIFTIT     ++    +   ++ K+NLVDLAGSEN+N++GA N RA+E+G
Sbjct: 289 CNDLSSRSHTIFTITTNVTKIHPISGEQYVKIGKLNLVDLAGSENINRSGAENKRAQEAG 348

Query: 359 SINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEET 418
            IN+SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAK + EET
Sbjct: 349 LINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKTSMEET 408

Query: 419 CSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNY- 477
            STLEYA++AK+IKN PQ+   + K+  +    +E+ K+R +L    +KEGIY++++ Y 
Sbjct: 409 ASTLEYATRAKSIKNTPQINQLMAKESCILGYIKEIEKLRKNLKANHAKEGIYITEEKYE 468

Query: 478 ---------KEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDN 528
                    +E    +DN +    ++KR  +  +++ +L+ KEK +  +   S+   +  
Sbjct: 469 TYESNCILVEEQQAKIDNLQ---EQIKRFKEKYLEQTKLV-KEKDTQVKMIKSINERITM 524

Query: 529 LRSQLKSVTNKL 540
              +L    +KL
Sbjct: 525 YNKKLTDYLDKL 536

>KAFR0L01710 Chr12 complement(308820..312275) [3456 bp, 1151 aa]
           {ON} Anc_7.387 YBL063W
          Length = 1151

 Score =  327 bits (837), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 199/482 (41%), Positives = 273/482 (56%), Gaps = 104/482 (21%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQ---------A 76
           NI V VRCR RN+REIE KS              V I+T G  G E  L           
Sbjct: 59  NIQVYVRCRSRNQREIEEKSS-------------VVISTMGAQGKEVVLSDPSSVLSHTK 105

Query: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136
           KTY  D+V+G +S Q++VF   A+   H+ ++GYNCT+  YG T TGKTYTM+GD+ +  
Sbjct: 106 KTYIFDQVFGVESDQEVVFNATAQNYIHEMLQGYNCTIFAYGQTGTGKTYTMSGDINIL- 164

Query: 137 EGDVNGQ--------AGIAPRILVKLFECL---QDDYVVKCSFVELYNEDLRDLLSEGQD 185
            GD+  Q        AGI PR+LV LF+ L     +Y VK SF+ELYNE L+DLLS+ ++
Sbjct: 165 -GDLESQDKILLGEHAGIIPRVLVNLFQYLTRESTEYSVKISFLELYNERLKDLLSQSKE 223

Query: 186 DFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXX 245
                TE S            +RIFD                                  
Sbjct: 224 -----TEES------------IRIFD---------------------------------- 232

Query: 246 XXXDDMSLNANAGGKTHVPP-----TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVA 300
                   N    G + +       T + I ++ +++ +I +A E             VA
Sbjct: 233 --------NHIPSGNSKIQKSSRNNTYSSIMVKGMEEIYIKSAHEGLQLLTEGSLKRKVA 284

Query: 301 TTKLNDVSSRSHTIFTITLYKKFKDDL-----YRLSKINLVDLAGSENVNKAGALNLRAK 355
           +TK ND+SSRSHTIFTIT      D +      ++ K+NLVDLAGSEN++++GA N+RA+
Sbjct: 285 STKCNDLSSRSHTIFTITTNITKIDPVSGEQYVKIGKLNLVDLAGSENISRSGAENMRAQ 344

Query: 356 ESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           E+G IN+SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ 
Sbjct: 345 EAGLINKSLLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATVSPAKISM 404

Query: 416 EETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQK 475
           EET STLEYA++AK+IKN PQ+   + KD+ + +  QE+ ++R +L  ++ K+G+Y++Q+
Sbjct: 405 EETISTLEYATRAKSIKNTPQINQSMSKDVCINEYVQEIERLRQELKASRQKDGVYITQE 464

Query: 476 NY 477
            +
Sbjct: 465 QF 466

>TDEL0C01600 Chr3 (276912..280229) [3318 bp, 1105 aa] {ON} Anc_7.387
           YBL063W
          Length = 1105

 Score =  324 bits (831), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 188/469 (40%), Positives = 273/469 (58%), Gaps = 64/469 (13%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVY 85
           N+ V VRCR RN++EIE KS +           EV ++   GS   ++   +TYT D+V+
Sbjct: 41  NMRVYVRCRSRNEQEIEEKSSVVISTLGAKGR-EVILSNGAGSLSHSK---RTYTFDQVF 96

Query: 86  GPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ-- 143
           G +S Q+ VF++ A+    + + GYNCT+  YG T TGKTYTM+GD+ +   GD++ Q  
Sbjct: 97  GAESDQETVFDEVAKDYISEMLEGYNCTVFTYGQTGTGKTYTMSGDISIL--GDLDSQDK 154

Query: 144 ------AGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENS 194
                 +GI PR+LV LF+ L    ++Y VK SF+ELYNE L+DLL+E + +  N     
Sbjct: 155 ILLGEHSGIIPRVLVDLFKQLSQETNEYTVKVSFLELYNEKLKDLLAESEQEEEN----- 209

Query: 195 SKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSLN 254
                       +RIFD                                       + L+
Sbjct: 210 ------------IRIFDNNSGFNCNKNVKQL-------------------------VKLD 232

Query: 255 ANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTI 314
            ++   +    + + I ++ +++F+I +A E             VA TK ND+SSRSHT+
Sbjct: 233 GSSHRTSSASSSSSSIMVKGMEEFYIKSAHEGLELLMTGSLKRKVAATKCNDLSSRSHTV 292

Query: 315 FTITLYKKFKDDL-----YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGR 369
           FTIT      D +      ++ K+NLVDLAGSEN+N++GA N RA+E+G IN+SLLTLGR
Sbjct: 293 FTITTNVARTDPVSNEQYIKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGR 352

Query: 370 VINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAK 429
           VIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ +ET STLEYA++AK
Sbjct: 353 VINALVDNSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMDETVSTLEYATRAK 412

Query: 430 NIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYK 478
           +IKN PQ+   + K+  L +   E+ ++R +L  ++ KEG+Y+++  ++
Sbjct: 413 SIKNTPQVNQSMSKNSCLGEYIHEIERLRQELKASRQKEGMYITEDQFQ 461

>YBL063W Chr2 (101886..105221) [3336 bp, 1111 aa] {ON}
           KIP1Kinesin-related motor protein required for mitotic
           spindle assembly, chromosome segregation, and 2 micron
           plasmid partitioning; functionally redundant with Cin8p
           for chromosomal but not plasmid functions
          Length = 1111

 Score =  323 bits (828), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 249/714 (34%), Positives = 367/714 (51%), Gaps = 121/714 (16%)

Query: 10  PGGEIGSASAMEKDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSG 69
           P    G+A++    D NI V VRCR RNKREIE KS +              I  S GS 
Sbjct: 40  PTCNNGAATS----DSNIHVYVRCRSRNKREIEEKSSVVISTLGPQGK---EIILSNGSH 92

Query: 70  IEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMT 129
                  KTY  D+V+G +S Q+ VF   A+    + + GYNCT+  YG T TGKTYTM+
Sbjct: 93  QSYSSSKKTYQFDQVFGAESDQETVFNATAKNYIKEMLHGYNCTIFAYGQTGTGKTYTMS 152

Query: 130 GDVEMGAEGDVNG--------QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLRD 178
           GD+ +   GDV           AGI PR+LV LF+    L  +Y VK SF+ELYNE+L+ 
Sbjct: 153 GDINIL--GDVQSTDNLLLGEHAGIIPRVLVDLFKELSSLNKEYSVKISFLELYNENLK- 209

Query: 179 LLSEGQDDFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXX 238
                       +++    P   +  +++RIFD                           
Sbjct: 210 ---------DLLSDSEDDDPAVNDPKRQIRIFD--------------------------- 233

Query: 239 XXXXXXXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXX 298
                          N N      V   Q         +  I++A E             
Sbjct: 234 ---------------NNNNNSSIMVKGMQ---------EIFINSAHEGLNLLMQGSLKRK 269

Query: 299 VATTKLNDVSSRSHTIFTIT---LYKKFKD-----DLYRLSKINLVDLAGSENVNKAGAL 350
           VA TK ND+SSRSHT+FTIT   + +  KD     +  ++ K+NLVDLAGSEN+N++GA 
Sbjct: 270 VAATKCNDLSSRSHTVFTITTNIVEQDSKDHGQNKNFVKIGKLNLVDLAGSENINRSGAE 329

Query: 351 NLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISP 410
           N RA+E+G IN+SLLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISP
Sbjct: 330 NKRAQEAGLINKSLLTLGRVINALVDHSNHIPYRESKLTRLLQDSLGGMTKTCIIATISP 389

Query: 411 AKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGI 470
           AKI+ EET STLEYA++AK+IKN PQ+   + KD  LKD  QE+ K+R DL  +++K+GI
Sbjct: 390 AKISMEETASTLEYATRAKSIKNTPQVNQSLSKDTCLKDYIQEIEKLRNDLKNSRNKQGI 449

Query: 471 YVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLR 530
           +++Q       D LD +++    +   N  +    E + K K++   + D     ++NL 
Sbjct: 450 FITQ-------DQLDLYESNSILIDEQNLKIHNLREQIKKFKENYLNQLD-----INNL- 496

Query: 531 SQLKSVTNKL-AQTNTQNTKLSEQVTDMNRI-QTELKSLIEVYQQKH---ETSKHKFQRL 585
             L+S   KL A     N   S   +++ +I  T L+ + EV QQ+    E S+ ++   
Sbjct: 497 --LQSEKEKLIAIIQNFNVDFSNFYSEIQKIHHTNLELMNEVIQQRDFSLENSQKQYNTN 554

Query: 586 LKDELATLTAKILSQWDTLK-NVNSGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCI 644
              +L  ++ ++L   +TL+ ++N+ N +    I  +  E+   + T K   ++  KS +
Sbjct: 555 QNMQLK-ISQQVLQTLNTLQGSLNNYNSKCSEVIKGVTEELTRNVNTHKAKHDSTLKSLL 613

Query: 645 DD----LLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYL 694
           +     L+ +  ++ + IS ++   +  +  HY +      DL+E + + +Q+L
Sbjct: 614 NITTNLLMNQMNELVRSISTSLEIFQSDSTSHYRK------DLNEIYQSHQQFL 661

>NDAI0E04300 Chr5 complement(965403..968963) [3561 bp, 1186 aa] {ON}
           Anc_7.387
          Length = 1186

 Score =  314 bits (804), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 199/531 (37%), Positives = 279/531 (52%), Gaps = 122/531 (22%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQ---------A 76
           NI V VRCR R++REI+ KS              V I+T G  G +  L           
Sbjct: 108 NIKVYVRCRSRSEREIKEKS-------------SVVISTLGPQGNQVILSNPSSPLSYPK 154

Query: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136
           K+Y+ D+V+G +S Q+ VF D A+    + + GYNCT+  YG T TGKTYTM+GD+ +  
Sbjct: 155 KSYSFDRVFGAESDQETVFNDAAKNYISEMLSGYNCTVFAYGQTGTGKTYTMSGDLNILG 214

Query: 137 EGD------VNGQAGIAPRILVKLFE--CLQDDYVVKCSFVELYNEDLRDLLSEGQDDFS 188
             +      +   AGI PR+LV LF+   L++DY VK SF+ELYNE L+DL ++ + +  
Sbjct: 215 NLESKDMILLGEHAGIIPRVLVNLFKMLALENDYSVKISFLELYNERLKDLFAQNESE-- 272

Query: 189 NGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXX 248
                           + +RIFD                                     
Sbjct: 273 ---------------EETIRIFDN------------------------------------ 281

Query: 249 DDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVS 308
                N NA          + I ++ +++ +I +A E             VA+TK ND+S
Sbjct: 282 -----NNNAS---------SSIMVKGMEEIYIKSAHEGLQLLMDGSLKRKVASTKCNDLS 327

Query: 309 SRSHTIFTI----TLYKKFKDDLY-RLSKINLVDLAGSENVNKAGALNLRAKESGSINQS 363
           SRSHT+FTI    T       + Y +  K+NLVDLAGSEN+N++GA N RA+E+G IN+S
Sbjct: 328 SRSHTVFTIATNITKIDPISGEQYIKTGKLNLVDLAGSENINRSGAENKRAQEAGLINKS 387

Query: 364 LLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLE 423
           LLTLGRVIN+L D S HIP+RESKLTRLLQDSLGG TKT +IATISPAKI+ EET STLE
Sbjct: 388 LLTLGRVINALVDHSQHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKISMEETVSTLE 447

Query: 424 YASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQ--------- 474
           YA +AK+IKN PQ+   + KD  + +   E+ ++R +L  ++ K+GI ++Q         
Sbjct: 448 YAIRAKSIKNTPQINQSMSKDTCINEYVSEIERLRLELKTSRQKDGICITQDQLDLYESN 507

Query: 475 -----------KNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKS 514
                       N +E +          TEL +  +S ++ENE + K+ +S
Sbjct: 508 GILVDEQKTKIHNMEEQIQKFKEKYVRQTELNKNLESNLKENEQVTKQLRS 558

>TPHA0E00890 Chr5 (181328..185026) [3699 bp, 1232 aa] {ON} Anc_7.387
           YBL063W
          Length = 1232

 Score =  307 bits (787), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 227/668 (33%), Positives = 319/668 (47%), Gaps = 173/668 (25%)

Query: 22  KDDINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQL------- 74
           KDD NI V VRCR R +REI+ KS              V I+T G +G +  L       
Sbjct: 48  KDD-NIKVYVRCRSRTQREIDEKSS-------------VVISTLGANGNKVILSPNQSRK 93

Query: 75  ---------------------------------QAKTYTVDKVYGPDSSQKLVFEDCAEP 101
                                              +TYT DKV+G +S Q+ +FE  A+ 
Sbjct: 94  LYNTNANGSTRTKNNTNLNNNIKNATTNSNTGTNGRTYTFDKVFGVESDQETLFESVAKN 153

Query: 102 LFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGD------VNGQAGIAPRILVKLF 155
             ++ ++GYNCT+  YG T TGKTYTM+GD+ +    D      +   AGI PR+LV LF
Sbjct: 154 YIYEMLQGYNCTVFAYGQTGTGKTYTMSGDLNILGNLDSKDKILLGEHAGIIPRVLVYLF 213

Query: 156 ECLQD--------------------------------DYVVKCSFVELYNEDLRDLLSEG 183
           + L                                  +Y VK SF+ELYNE L DLLS  
Sbjct: 214 KELSKNDTITNTKVNNNKNNNNNSNNKNEEQINLKNTEYSVKVSFLELYNEKLTDLLSNY 273

Query: 184 QDDFSNGTENSSKQ------PES----LNASKKLRIFDXXXXXXXXXXXXXXXXXHKARS 233
           + D  N  +    Q      P S    LN + K +I +                 +K+ S
Sbjct: 274 KTDALNSNDKLINQTSGNSTPYSITNGLNVNDKFKIKNNNLHDFDGKNVRIMSNQNKSAS 333

Query: 234 DYXXXXXXXXXXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXX 293
                                 N  G        + I ++ +++ +I +A E        
Sbjct: 334 ----------------------NCNG--------SSITVKGMEEIYIKSAHEGLQLLTEG 363

Query: 294 XXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL-----YRLSKINLVDLAGSENVNKAG 348
                VA+TKLND+SSRSHTIFTI       D +      +  K+NLVDLAGSEN+N++G
Sbjct: 364 SLKRKVASTKLNDLSSRSHTIFTIITNVTKVDPVTGKHFVKTGKLNLVDLAGSENINRSG 423

Query: 349 ALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATI 408
           A N RA+E+G IN+SLLTLGRVIN+L D+S HIP+RESKLTRLLQDSLGG TKT +IAT+
Sbjct: 424 AENKRAQEAGLINKSLLTLGRVINALVDRSHHIPYRESKLTRLLQDSLGGKTKTCIIATV 483

Query: 409 SPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKE 468
           SPAKI+ EET STLEYA++AK+IKN PQ+   + KD  + +   E+ ++R +L   ++KE
Sbjct: 484 SPAKISLEETVSTLEYATRAKSIKNTPQINQSLSKDTFIHEYINEIDRLRNELKLARTKE 543

Query: 469 GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDN 528
           GIY++Q       D LD               L + N +L  E+K+   + D+++ ++  
Sbjct: 544 GIYITQ-------DQLD---------------LYESNSILITEQKA---KIDNMEDQIKR 578

Query: 529 LRSQL-------KSVTNKLAQTNTQNTKLSEQ----VTDMNRIQTELKSLIEVYQQKHET 577
            +++        + + NKL Q+   N KLSE+    ++   R Q   K       Q H +
Sbjct: 579 FKAKYVEETESNRILLNKLEQSEDANQKLSEKTKVIISLFKRYQENFKIFNSNINQIHSS 638

Query: 578 SKHKFQRL 585
           +   F  L
Sbjct: 639 NLEVFDSL 646

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score =  255 bits (652), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 182/500 (36%), Positives = 252/500 (50%), Gaps = 123/500 (24%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKT----YTV 81
           NI V VRCR RN++EI+ KS              V ++T G +G +  +   T    Y  
Sbjct: 9   NIKVYVRCRSRNQKEIDEKS-------------SVVVSTLGQNGNQIIISNSTNKNKYIF 55

Query: 82  DKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVN 141
           D V+G +S Q+ +F   A     + + GYNCT+  YG T TGKTYTM+GD+ +   GD+N
Sbjct: 56  DNVFGVESDQESIFNSVAYNYIQEMIDGYNCTLFAYGQTGTGKTYTMSGDLNII--GDLN 113

Query: 142 G--------QAGIAPRILVKLFECLQDD-----------YVVKCSFVELYNEDLRDLLSE 182
                     AGI PR+LV+LF  L+D            Y VK SF+ELYNE L+DLLS 
Sbjct: 114 STKNILLGEHAGIIPRVLVQLFTSLEDSISNQKNTSVKGYTVKISFLELYNERLKDLLSA 173

Query: 183 GQDDFSNGTENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXX 242
             D   N   +S+  P     S  ++IFD                 +K  SD        
Sbjct: 174 DADLPPNSGSSSANDPS---VSSNIKIFD-----------------NKDSSD-------- 205

Query: 243 XXXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATT 302
                                    + I ++ +++  I  A E             V +T
Sbjct: 206 -------------------------SSIIVKGMQEIFIKNAMEGLNLLMKGSLQRKVKST 240

Query: 303 KLNDVSSRSHTIFTIT-----LYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKES 357
           KLND+SSRSHTIFTIT     L  +   +  ++ K+NLVDLAGSEN+ K+G    R++E+
Sbjct: 241 KLNDLSSRSHTIFTITTNIIKLDNQTNKEYIKIGKLNLVDLAGSENITKSGLK--RSQET 298

Query: 358 GSINQSLLTLGRVINSLADKSAH------------------------IPFRESKLTRLLQ 393
           G IN+SLLTLGRVIN+L+DK+ +                        IP+RESKLTRLLQ
Sbjct: 299 GLINKSLLTLGRVINALSDKTNNTHGSNNDNNNSSSSSSISNSHHSHIPYRESKLTRLLQ 358

Query: 394 DSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQE 453
           DSLGG TKT +IATISPAK   +ET STLEYA++A +IKN P++         + D   +
Sbjct: 359 DSLGGMTKTCIIATISPAKTCLDETISTLEYATRAMSIKNNPKINKSQNPSNFINDYINQ 418

Query: 454 LIKMRADLWCTKSK-EGIYV 472
           + +++ +L  +  K  GI++
Sbjct: 419 IDRLKLELQTSTDKIGGIFI 438

>TPHA0J00300 Chr10 (65794..68742) [2949 bp, 982 aa] {ON} Anc_6.16
           YEL061C
          Length = 982

 Score =  230 bits (587), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 176/629 (27%), Positives = 343/629 (54%), Gaps = 26/629 (4%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATT----KLNDVSSRSHTIFTITLYKKFK 324
            IYIQNL++  I+  +E             +A+T      N+ S RSH+IF ITLYK+ +
Sbjct: 271 SIYIQNLQEITITEIEEGMAIIKKGLKNRRIASTGSASDKNEFSKRSHSIFNITLYKEEE 330

Query: 325 -DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPF 383
            ++++R+SK++ V+ AGSE  +   + N      G+ N +L +  ++IN + + S +  F
Sbjct: 331 VNEVFRMSKLSFVNFAGSEYGDNNTSKN------GAFNSNLQSFNKMINGMVNNSTYASF 384

Query: 384 RESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK 443
            +SKLT+LLQ++  G T+T+ IA I+P K   + TCS L  A+K K IKN+P+ GS I K
Sbjct: 385 LDSKLTQLLQNNFDGITRTLFIANIAPLKKQLDATCSVLTMATKIKEIKNEPKKGSVITK 444

Query: 444 DILLKDVSQELIKMRADLWCTKSKE-GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLV 502
           + L+K +S EL+K ++DL   KS + GIY+ +K+Y E+   L+++K ++   K + + L 
Sbjct: 445 ESLIKILSNELVKTKSDLLSYKSNDNGIYMDEKHYSELTKTLESYKEKIQNSKNSINELT 504

Query: 503 QENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562
           ++   +  EK++  E  +  + +L NLR  + ++   L + + + ++L      ++ I  
Sbjct: 505 KKGNEIRIEKRTFEEINERQRIKLQNLRETISNLNCALEKQSKRESELENIKIKLHSILG 564

Query: 563 ELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN-VNSGNYQIHTHIDSI 621
            ++  +E Y  K    ++K + L   EL  L   + S +  +KN +   N  ++T+ID+I
Sbjct: 565 NMQKSVEKYSDKEIHLQNKLKLLYDKELVKLKNSLESNFADIKNRMPDDNDNMNTNIDNI 624

Query: 622 RGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFS 681
           + E++ +   ++   + L  +  + +L  +PK F+ +  N+ ++    E ++ + +   S
Sbjct: 625 KAEILKIANQSQSKVKELLTNSANQVLDTSPKYFEQLDTNLKNLEESVEINHNKYSELLS 684

Query: 682 DLSEEFNTFKQYLDGQFFQNNHIEMIQTHQDIVASNMQKMSDDLLQSVQNSIQNYLSTNA 741
           D+SEEFN    Y++  F +++H E+I T+ +     +Q +S +  ++ +  +  Y+  N 
Sbjct: 685 DISEEFNNLNNYINDNFLKSSHEELIDTYINRTYHEVQGISVEFTENFKKLLDIYVEKNT 744

Query: 742 QMVTNSINDVAMDVINKEMDLFAPKKSKWE----ESIDLINQSDSLSNKFRNNMTKSVDD 797
           + ++ SI  +  +++  E+  F P+K KWE    E I+  N+S +   K +N  ++ +  
Sbjct: 745 KSLSKSITSLTSEIVENELTQFNPEKKKWELASNEIIENFNESIT---KNKNKNSEILAK 801

Query: 798 IASVIRNSNESMDRSISTIKKH--IIENDINSQEQINSNELLTNSFKAIQEKSNNILHLV 855
           + S   +++E    ++S+IKK+  I+E      E  NSN+L+ + F  I  K+  +  L+
Sbjct: 802 LLSESTSTSELFINNMSSIKKNVEIVE---EFSEIFNSNDLIKSEFLEIINKNKKLKDLI 858

Query: 856 TGDLTVTAQESMDGIQNLDRSIRTLIHGD 884
           T +   +++ S+D   NL  +++ +   +
Sbjct: 859 TDNFN-SSENSIDSFDNLKEAMQNVFKNE 886

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 90/167 (53%), Gaps = 23/167 (13%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSI--NTSGGSGI-----EAQLQAKT 78
           NITVAVRCR     E  + SP             +SI  N  G S       E+  + K 
Sbjct: 9   NITVAVRCREPIDEEKHSGSPTI-----------ISIGDNEDGTSNEVIVLDESTGRKKI 57

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVE--MGA 136
           YT+D VYG    QK +F++   P +  F  GYN +++ YG   +GK YT+ G+      A
Sbjct: 58  YTLDAVYGEQDDQKKLFDETVIPFYKSFFDGYNVSIMSYGSRFSGKNYTLYGEYSELQNA 117

Query: 137 EGDVNGQAGIAPRILVKLFECLQ---DDYVVKCSFVELYNEDLRDLL 180
               +   G+ PR+L +LF+ L+   +D+++KCSFVE+YN++LRDLL
Sbjct: 118 NNAESENLGVVPRVLSRLFKDLESNGNDHIIKCSFVEIYNDELRDLL 164

>Smik_2.53 Chr2 (95765..99106) [3342 bp, 1113 aa] {ON} YBL063W
           (REAL)
          Length = 1113

 Score =  225 bits (574), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 154/396 (38%), Positives = 238/396 (60%), Gaps = 38/396 (9%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTIT---LYKKFK 324
           + I ++ +++  I++A E             VA TK ND+SSRSHT+FTIT   + +  K
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIVEQDSK 298

Query: 325 D-----DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379
           D     +  ++ K+NLVDLAGSEN+N++GA N RA+E+G IN+SLLTLGRVIN+L D S 
Sbjct: 299 DHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNTPQVNQ 418

Query: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKN---YKE---MVDD----LDNFKT 489
            + KD  LKD  QE+ K++ DL  +++K+GI+++Q     Y+    ++D+    + N + 
Sbjct: 419 SLSKDTCLKDYIQEIEKLKNDLKNSRNKQGIFITQDQLDLYESNSILIDEQNLKIHNLRE 478

Query: 490 ELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTK 549
           ++ + K    + +  N LL  EK    E+  ++  + D   S   S   K+ Q +  N +
Sbjct: 479 QIKKFKEKYLTQLDINNLLQSEK----EKLVTVIRDFDIDYSHFYS---KIQQIHYTNLE 531

Query: 550 LSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNS 609
           L  QVT       +  S  E  Q+++  +++   ++ +  L TL     S  ++L+N NS
Sbjct: 532 LINQVTQ------QRDSSHENCQKQYTANQNMQLKISQQVLQTLN----SLQNSLRNYNS 581

Query: 610 GNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCID 645
              Q+   I+ +  E+ N + + K N ++ +KS ++
Sbjct: 582 KFSQV---INGVTEELTNSVNSHKVNHDSTFKSLMN 614

 Score =  127 bits (320), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 72/165 (43%), Positives = 91/165 (55%), Gaps = 16/165 (9%)

Query: 24  DINITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDK 83
           D NI V VRCR RNKREI+ KS +              I  S GS        KTY  D+
Sbjct: 50  DSNIHVYVRCRSRNKREIDEKSSVVISTLGPQGK---EIILSNGSHQSYSSSKKTYQFDQ 106

Query: 84  VYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG- 142
           V+G +S Q+ VF   A+    + + GYNCT+  YG T TGKTYTM+GD+ +   GDV   
Sbjct: 107 VFGAESDQETVFNATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL--GDVQST 164

Query: 143 -------QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLR 177
                   AGI PR+LV LF+    L  +Y VK SF+ELYNE+L+
Sbjct: 165 DKLLLGEHAGIIPRVLVDLFKELSTLNREYSVKISFLELYNENLK 209

>Suva_2.54 Chr2 (99000..102332) [3333 bp, 1110 aa] {ON} YBL063W
           (REAL)
          Length = 1110

 Score =  224 bits (572), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 156/443 (35%), Positives = 252/443 (56%), Gaps = 36/443 (8%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKD-- 325
           + I ++ +++  I++A E             VA TK ND+SSRSHT+FTIT     +D  
Sbjct: 239 SSIMVKGMQEIFINSAHEGLNLLMQGSLKRKVAATKCNDLSSRSHTVFTITTNIIEQDSK 298

Query: 326 ------DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA 379
                 +  ++ K+NLVDLAGSEN+N++GA N RA+E+G IN+SLLTLGRVIN+L D S 
Sbjct: 299 EHGQNKNFVKIGKLNLVDLAGSENINRSGAENKRAQEAGLINKSLLTLGRVINALVDHSN 358

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           HIP+RESKLTRLLQDSLGG TKT +IAT+SPAKI+ EET STLEYA++AK+IKN PQ+  
Sbjct: 359 HIPYRESKLTRLLQDSLGGMTKTCIIATVSPAKISMEETASTLEYATRAKSIKNSPQVNQ 418

Query: 440 FIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTND 499
            + KD  LKD  QE+ K+R DL  +++K+GI+++Q       D LD +++    +   N 
Sbjct: 419 SLSKDTCLKDYIQEIEKLRNDLKNSRNKQGIFITQ-------DQLDLYESNSILIDEQNL 471

Query: 500 SLVQENELLGKEKKSGAERAD---SLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTD 556
            +    E + K K+    + D    L+SE + L + +++     +  N +  K+     +
Sbjct: 472 KIHNLREQIKKFKEKYLNQLDINNFLQSEKEKLINIIRNFHVDFSNFNLEIQKIHRSNLE 531

Query: 557 MNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKN-VNSGNYQIH 615
           +    T+ + L +V  ++  T+    Q         ++ ++L   DTL+N + + N +  
Sbjct: 532 VMTEITQQRDLSQVNSRRQYTTNQNLQ-------LEISNQVLQTLDTLQNSLMNYNSKFS 584

Query: 616 THIDSIRGEVMNLLETTK----ENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEE 671
             I+ +  E+   + + K       E+L+ +  + L  +  ++   IS ++ +IR  +  
Sbjct: 585 QVINGVTEELSLNVNSHKVKHDSTLESLFNTTANLLTIKMNELVSSISQSLANIRNDSLS 644

Query: 672 HYTEMARNFSDLSEEFNTFKQYL 694
           HY +      DL+E + + +++L
Sbjct: 645 HYNK------DLNEIYQSHQRFL 661

 Score =  146 bits (369), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 111/197 (56%), Gaps = 26/197 (13%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVY 85
           NI V VRCR RN+REI+ KS +              I  S GS        KTY  D+V+
Sbjct: 52  NIHVYVRCRSRNRREIDEKSSVVISTLGPQGK---EIILSNGSHQSYSSSKKTYQFDQVF 108

Query: 86  GPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNG--- 142
           G +S Q++VF   A+    + + GYNCT+  YG T TGKTYTM+GD+ +   GDV     
Sbjct: 109 GAESDQEMVFHATAKNYIREMLHGYNCTIFAYGQTGTGKTYTMSGDINIL--GDVQSTDN 166

Query: 143 -----QAGIAPRILVKLFE---CLQDDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTENS 194
                 AGI PR+LV LF+    L  +Y VK SF+ELYNE+L+DLLS+ +DD  + T N 
Sbjct: 167 LLLGEHAGIIPRVLVDLFKELSSLNKEYSVKVSFLELYNENLKDLLSDNEDD--DPTAND 224

Query: 195 SKQPESLNASKKLRIFD 211
           SK        K++RIFD
Sbjct: 225 SK--------KQIRIFD 233

>ZYRO0B03234g Chr2 complement(263393..266809) [3417 bp, 1138 aa]
           {ON} similar to uniprot|P28742 Saccharomyces cerevisiae
           YBL063W KIP1 Kinesin-related motor protein required for
           mitotic spindle assembly and chromosome segregation
           functionally redundant with Cin8p
          Length = 1138

 Score =  218 bits (555), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 128/321 (39%), Positives = 194/321 (60%), Gaps = 45/321 (14%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL-- 327
           I ++ +++ +I +A E             VA TK ND+SSRSHTIFTI  +    D +  
Sbjct: 268 ITVKGMEERYIKSAYEGLQLLTKGSLKRKVAATKCNDLSSRSHTIFTIVTHVARTDPVSG 327

Query: 328 ---YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPFR 384
               ++ K+NLVDLAGSEN+N++GA N+RA+E+G IN+SLLTLGRVIN+L + S+HIP+R
Sbjct: 328 EQYVKIGKLNLVDLAGSENINRSGAENMRAQEAGLINKSLLTLGRVINALVEHSSHIPYR 387

Query: 385 ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKD 444
            SKLTRLLQDSLGG TKT +IATISPA+I+ +ET STLEYA++AK+IKN PQ+   + KD
Sbjct: 388 GSKLTRLLQDSLGGKTKTCIIATISPARISMDETVSTLEYATRAKSIKNTPQVNQSLSKD 447

Query: 445 ILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQE 504
             + +   E+ ++R +L  ++ +EG+Y++Q+ Y               +L  +N  LV+E
Sbjct: 448 SCIMEYIYEIERLRQELKASRQREGMYITQEQY---------------DLYESNSLLVEE 492

Query: 505 NELLGKEKKSGAERADSLKSELDNLRSQLKSVT------NKLAQTNTQNTKLSEQVTDMN 558
            +++                 + N+  Q+K          KL++   +  + S++V D  
Sbjct: 493 QKVV-----------------IQNMGEQIKRFKEKYVEQTKLSKEAHRQFQESQKVCDTL 535

Query: 559 RIQTELKSLIEVYQQKHETSK 579
           RIQ   K ++E +++ H T K
Sbjct: 536 RIQK--KFMLETFEKYHTTCK 554

 Score =  129 bits (325), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 73/175 (41%), Positives = 97/175 (55%), Gaps = 17/175 (9%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVY 85
           NI V VRCR RN+REI+ KS +            +  N S           KTY  D+V+
Sbjct: 44  NIKVYVRCRSRNQREIDEKSSVVVSTMGRKGKSVILSNPSS----PLSHPKKTYMFDEVF 99

Query: 86  GPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ-- 143
           G DS Q+ +F + A+    + + GYNCT+  YG T TGKTYTM+GD  M   GD++ Q  
Sbjct: 100 GADSDQESIFTEVAKNYIQEMLEGYNCTVFAYGQTGTGKTYTMSGD--MSIWGDLDSQDK 157

Query: 144 ------AGIAPRILVKLFECLQD---DYVVKCSFVELYNEDLRDLLSEGQDDFSN 189
                 AGI PR+LV LF+ L     ++ VK SF+ELYNE L+DLL++   D  N
Sbjct: 158 ILLGEHAGIIPRVLVNLFKQLSKETTEHSVKISFLELYNERLKDLLADNDSDEDN 212

>TPHA0D01270 Chr4 (264339..266429) [2091 bp, 696 aa] {ON} Anc_8.678
           YPL155C
          Length = 696

 Score =  135 bits (340), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 107/384 (27%), Positives = 166/384 (43%), Gaps = 96/384 (25%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           + +D+++  D S   ++ +  +PL      GYN T+  YGMT +GKT+TM+G  E     
Sbjct: 109 FRLDRIFDCDVSNLEIYSELCKPLIDKLAMGYNATLFAYGMTGSGKTFTMSGTQE----- 163

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLLSEGQDDFSNGT 191
                 G+ P  +  LF  + ++       Y +  S++E+YNE L DLL    +  + G 
Sbjct: 164 ----DTGLIPLSISHLFNTINEENLLGKKKYEMLVSYMEIYNEKLYDLLDTNVEGVNFGY 219

Query: 192 ENSSKQPE----SLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXX 247
            ++ + P     S N+++ LRI                                      
Sbjct: 220 SSNLQTPPRFGNSFNSAQDLRI-------------------------------------- 241

Query: 248 XDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDV 307
            DD                Q GI +  L +   S+  +             ++ T+ N  
Sbjct: 242 RDD---------------AQYGIKVVGLSEHRCSSKDDLMKWVRIGDKNKKISETEYNSR 286

Query: 308 SSRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLT 366
           SSRSH+I  + L     +  +   S ++L DLAGSE   KA +   R KE   IN+SLL 
Sbjct: 287 SSRSHSILLVRLIATDLETGIVTTSTLSLCDLAGSE---KATSQQERRKEGAFINKSLLA 343

Query: 367 LGRVINSLADKS-------------------AHIPFRESKLTRLLQDSLGGNTKTVLIAT 407
           LG VI  L+ +S                   +HIP+R+SKLTR+LQ +L GN+    I T
Sbjct: 344 LGTVIAKLSSESNQHRNADNVNHQETSNPNNSHIPYRDSKLTRILQPALSGNSIITTICT 403

Query: 408 ISPAKIAAEETCSTLEYASKAKNI 431
           +     A+ ET +TL +AS+AKN+
Sbjct: 404 VDIRSDASSETLNTLRFASRAKNV 427

>KLTH0G03850g Chr7 (308053..309474) [1422 bp, 473 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W
          Length = 473

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 76/173 (43%), Positives = 105/173 (60%), Gaps = 8/173 (4%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK----FKDD 326
           +++ L++F +++  E             V  T +N+ SSRSHTIFTI + +K        
Sbjct: 169 FVEGLQEFEVNSVDEILDYLRQGSERKTVGATLVNEQSSRSHTIFTINVEQKENSPLGHV 228

Query: 327 LYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAH--IPFR 384
           L R S I L+DLAGSE  N +GA   R KE  +IN+SL TLGRVI  LA K     IP+R
Sbjct: 229 LERRSSIRLIDLAGSERANASGATGERLKEGSNINKSLSTLGRVIAMLAKKKQPRLIPYR 288

Query: 385 ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQL 437
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+++K   QL
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDF--EETMSTLRYATLARSVKTFAQL 339

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 19/100 (19%)

Query: 91  QKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQAGIAPRI 150
           Q  ++E  A       + GYN  +  YG T +GK++TMTG  E+          GI PR+
Sbjct: 63  QAQLYEQLARDYLLHALDGYNTCIFAYGQTGSGKSHTMTGSAEL---------PGIVPRM 113

Query: 151 LVKLFECLQ-----DD-----YVVKCSFVELYNEDLRDLL 180
             +LFE  +     DD     + ++CS++E+YNE +RDLL
Sbjct: 114 CQELFEVREMYESSDDQASTQFKIRCSYLEIYNETVRDLL 153

>KLLA0B00759g Chr2 (59965..61335) [1371 bp, 456 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1 Kinesin-related motor protein
           required for mitotic spindle assembly and chromosome
           segregation; functionally redundant with Cin8p
          Length = 456

 Score =  130 bits (326), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 157/290 (54%), Gaps = 13/290 (4%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLYRL 330
           ++Q++  F ++  +E             VA+T++N  SSRSH IFT+++ ++  D   R 
Sbjct: 149 FVQDITTFKVNRVEEVLEYLSIGDSKRSVASTRMNMESSRSHAIFTLSIKQQEPDGSIRE 208

Query: 331 SKINLVDLAGSENVNKAGALN--LRAKESGSINQSLLTLGRVINSLADKSAH-IPFRESK 387
           S + LVDLAGSE  N    ++   R KE  +IN+SL TLGR I+ LA  S H IP+R+S 
Sbjct: 209 SDLKLVDLAGSERANATMGIDNGKRMKEGANINKSLSTLGRCISQLAKNSKHLIPYRDSL 268

Query: 388 LTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKDIL- 446
           LT +L+++LGGN+KT +IA ISP  I  EE+ STL YA+ AK IK +  +   I+ +I  
Sbjct: 269 LTWVLKENLGGNSKTCMIACISP--IDLEESLSTLRYATTAKEIKLRATMNE-IVPNINE 325

Query: 447 -LKDVSQELIKMRADLWCTKSKEGIYVSQKNYK-EMVDDLDNFKTELTELKRTNDSLVQE 504
            +K   +     R +L   KS+     S+ N K E     +        + + ND L  E
Sbjct: 326 DMKAAVEAAASSRKELEMLKSEMSSLQSEYNIKSEQWKTHEKLLVRFNHITKLNDYL--E 383

Query: 505 NELLGKEKKSGAERADSLKS--ELDNLRSQLKSVTNKLAQTNTQNTKLSE 552
           N+L  +  KS + + ++  S  E+ N+++ L  V   L   N  +TK+ E
Sbjct: 384 NQLTNEITKSQSLQNENKLSRLEMSNVQTALLGVVGALFSNNNHDTKIME 433

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 17/120 (14%)

Query: 68  SGIEAQLQAKTYTVDKVYGPDSSQK-LVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTY 126
           S +E  L  +++  D ++   SSQ  +  E C++ + H  + GYN  +  YG T +GKTY
Sbjct: 28  STVEPPL--RSFNFDHIFDTSSSQTDIPGELCSKYVLHA-LEGYNACIFAYGQTGSGKTY 84

Query: 127 TMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDDYV----VKCSFVELYNEDLRDLLSE 182
           TM G          N   GI P +   LF+ L+ D      V  ++ E+YNE L DLL +
Sbjct: 85  TMRG---------TNSNPGIIPLLCRDLFDALELDKTTVSSVSITYFEIYNEKLIDLLGD 135

>KAFR0H02410 Chr8 complement(460353..462329) [1977 bp, 658 aa] {ON}
           Anc_8.678 YPL155C
          Length = 658

 Score =  131 bits (330), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 156/383 (40%), Gaps = 95/383 (24%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           Y  D V+ P      +++  A PL      G+N T+  YGMT +GKTYTM GD E     
Sbjct: 133 YKFDHVFSPHVDNFEIYKTTAIPLIDKLFTGFNATLFCYGMTGSGKTYTMMGDNE----- 187

Query: 139 DVNGQAGIAPRILVKLFECLQDD-----YVVKCSFVELYNEDLRDLLSEGQDDFSNGTEN 193
                 GI P  +  LF  + +      Y V  S++E+YNE + DLL + + +       
Sbjct: 188 ---NPDGIVPLSVSLLFNQVLNSRNDKKYDVILSYLEIYNEKIYDLLDDDRTNHLLTPSR 244

Query: 194 SSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDMSL 253
            +  P  LN+S+ LRI                                       DD+  
Sbjct: 245 FTSTPSRLNSSE-LRI--------------------------------------RDDL-- 263

Query: 254 NANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHT 313
                        + G+ I  L +    T++E              + T+ N  SSRSH 
Sbjct: 264 -------------EYGVKITGLNEERCDTSQELMKWIKYGDSNRKTSETEYNLRSSRSHA 310

Query: 314 IFTITLY-KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVIN 372
           +  + L      D     S + L DLAGSE   +A     R KE   IN+SLL LG VI+
Sbjct: 311 VILVRLVTHNVIDGSKTSSTLTLCDLAGSE---RAAGQQERRKEGAFINKSLLALGTVIS 367

Query: 373 SLADKSA------------------------HIPFRESKLTRLLQDSLGGNTKTVLIATI 408
            L+ +S                         HIP+R+SKLTRLLQ +L GN+    I TI
Sbjct: 368 KLSAESLSNSKHVSNPMGPPASPSLNSNGNNHIPYRDSKLTRLLQPALSGNSAVTTICTI 427

Query: 409 SPAKIAAEETCSTLEYASKAKNI 431
            P      ET +TL +AS+AKN+
Sbjct: 428 DPRMETYAETINTLRFASRAKNV 450

>SAKL0G05016g Chr7 (415990..417504) [1515 bp, 504 aa] {ON} weakly
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 504

 Score =  129 bits (323), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 107/175 (61%), Gaps = 8/175 (4%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK---FKDDL 327
           +++ L +F +   +E             V  T +N+ SSRSH IFTI++ +       DL
Sbjct: 198 FVEGLNEFKVCKVEEILEYMKQGDRLRTVGVTNMNNSSSRSHAIFTISIKQSETTLAGDL 257

Query: 328 Y-RLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAH--IPFR 384
             R S I LVDLAGSE V+  GA   R KE  +IN+SL TLGRV++ LA K+    IP+R
Sbjct: 258 TERRSSIKLVDLAGSERVSTTGARGDRLKEGSNINKSLTTLGRVVSVLAKKNRPKLIPYR 317

Query: 385 ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           +S LT +L+++LGGN+KTV+IA +SP     EET STL YA+ AK +KN  ++ S
Sbjct: 318 DSALTWVLKENLGGNSKTVMIACVSPCDY--EETISTLRYATTAKEVKNTARVNS 370

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 82/181 (45%), Gaps = 26/181 (14%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKV- 84
           NI VAVR R    RE   +  I           +  I+TS     E   Q K +T D   
Sbjct: 4   NIKVAVRLRSPLPRE-HGQPIITQVTSPTSFVIQQHISTSSLLATEEFTQGKIFTFDHCF 62

Query: 85  -YGPDSS--QKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVN 141
            Y  ++S  Q+++++          + GYN  +L YG T +GK++TM G  E+      N
Sbjct: 63  KYSENASHDQEVIYDTIGREYLLHTLDGYNTCILAYGQTGSGKSFTMMGP-EVSKHFHNN 121

Query: 142 GQA----------GIAPRILVKLFE-C---------LQDDYVVKCSFVELYNEDLRDLLS 181
             A          GI PR+   LF+ C         ++  + + CS++E+YNE +RDLLS
Sbjct: 122 QTALDRAIEDSAIGIIPRVCCDLFDICNMCNSEEDGIKTQFEIYCSYLEIYNEQVRDLLS 181

Query: 182 E 182
           E
Sbjct: 182 E 182

>Kwal_47.18608 s47 complement(896394..897833) [1440 bp, 479 aa] {ON}
           YGL216W (KIP3) - kinesin-related protein involved in
           mitosis [contig 192] FULL
          Length = 479

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/304 (33%), Positives = 165/304 (54%), Gaps = 34/304 (11%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL--- 327
           +++ L++F +S+ ++             + +T +N+ SSRSHTIFTI++ +K K  L   
Sbjct: 169 FVEGLREFDVSSVEDILNYVKQGNEKRMMGSTLVNEYSSRSHTIFTISIKQKEKSALGHV 228

Query: 328 -YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAH--IPFR 384
             R S I L+DLAGSE    A     R KE  +IN+SL TLGRVI+ LA +     IP+R
Sbjct: 229 IERHSSIKLIDLAGSERAKAAKTSGDRLKEGSNINKSLSTLGRVISMLAKRKQPKLIPYR 288

Query: 385 ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIKD 444
           ++ LT +L++SLGGN+KT +IA +SP     EET STL YA+ A+N+K   QL +   ++
Sbjct: 289 DAALTWVLKESLGGNSKTCMIACVSPCDY--EETLSTLRYATLARNVKTCAQLNA---QE 343

Query: 445 ILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQE 504
            L  D  ++++ MR  L   ++     +SQ   + +V      + ++ ++K TN  L   
Sbjct: 344 SL--DGKEQMVAMREQLDELQNA----LSQAGDQRLV------REQMEKIKLTNQFLEAR 391

Query: 505 NELLGKEKKSGAE---RADSLKSELDNLRSQLKSVTNKL-----AQTNTQNTKLSEQVTD 556
            E   +E+K  A+   +     +E DNLR  L  + + +     A+  +    L E+ TD
Sbjct: 392 IE---RERKMAADYYAQWTKASNERDNLRHTLGGIVSSIQNPQAAEIRSSLQALKERSTD 448

Query: 557 MNRI 560
           + ++
Sbjct: 449 IGKL 452

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 20/95 (21%)

Query: 100 EPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQ 159
           E L H  + GY+  +  YG T +GK++TMTG  E           GI  R+  +LFE  +
Sbjct: 73  EYLLHA-LDGYHTCVFAYGQTGSGKSHTMTGSPE---------SPGIVSRMCQELFEVRE 122

Query: 160 -----DDYV-----VKCSFVELYNEDLRDLLSEGQ 184
                DD V     ++CS++E+YNE +RDLL  G+
Sbjct: 123 IYESSDDQVNTQFKIRCSYLEIYNETVRDLLGTGR 157

>SAKL0G18920g Chr7 complement(1634668..1636617) [1950 bp, 649 aa]
           {ON} weakly similar to uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a
           kinesin, colocalizes with Myo2p; kinesin heavy chain
           homolog
          Length = 649

 Score =  125 bits (315), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 76/174 (43%), Positives = 105/174 (60%), Gaps = 8/174 (4%)

Query: 268 TGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK-DD 326
           +GIY++ L   ++++ +E             V++T +N  SSRSH+I  I L K+   ++
Sbjct: 195 SGIYVKGLNTNYVTSEQELLDYIKQGESQRNVSSTSMNLESSRSHSIVRINLEKRNALEE 254

Query: 327 LYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLAD-------KSA 379
             + S + LVDLAGSE V K  A  +  +E+  IN SL  LG VIN+L          SA
Sbjct: 255 NIQHSFLYLVDLAGSEKVGKTNAAGVTLEEAKKINSSLSALGNVINALTQVESKSKRTSA 314

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKN 433
           HIP+R+SKLTRLLQDSLGGN+KT LI   S ++   +ET STL + S+AK IKN
Sbjct: 315 HIPYRDSKLTRLLQDSLGGNSKTTLILNCSTSRFNEQETLSTLRFGSRAKKIKN 368

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 43/127 (33%), Positives = 66/127 (51%), Gaps = 15/127 (11%)

Query: 62  INTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTS 121
           I  S  S    Q   + +T D+V+   S+Q+ V+E  A  +   F +GYN T+L YG T 
Sbjct: 58  IECSSPSKSSTQNNDRLFTFDRVFDTGSTQESVYEFVAGDMLKSFFQGYNGTILAYGQTG 117

Query: 122 TGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQ-DDY-----VVKCSFVELYNED 175
           +GK++TM G  E           G+ PRI   +F+ ++  DY      V  SF+E+Y E 
Sbjct: 118 SGKSHTMFGPKE---------NRGVIPRICHDIFKQIETPDYEDCIFTVSVSFMEVYLEK 168

Query: 176 LRDLLSE 182
           + DLL++
Sbjct: 169 IYDLLAQ 175

>TDEL0A06240 Chr1 (1092814..1094727) [1914 bp, 637 aa] {ON}
           Anc_8.678 YPL155C
          Length = 637

 Score =  123 bits (308), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 123/444 (27%), Positives = 191/444 (43%), Gaps = 102/444 (22%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           +A  +T D+V+  + +   ++E  + P+    ++G+N T+  YGMT +GKT+TMTG    
Sbjct: 108 EAGEFTFDRVFPANCTNLDIYEASSRPMIDKLLQGFNATVFAYGMTGSGKTFTMTG---- 163

Query: 135 GAEGDVNGQAGIAPRILVKLFECLQD-------DYVVKCSFVELYNEDLRDLL-SEGQDD 186
                   +AG+ P  +  LF  + +        Y V  S++E+YNE + DLL  E ++ 
Sbjct: 164 -----TEDEAGLIPLSVTYLFSKILEHSMRGTSKYEVVVSYLEIYNEKIYDLLDCESENK 218

Query: 187 FSNGTENS---SKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXX 243
           F N T +    S  P S     +LRI                                  
Sbjct: 219 F-NSTPSRMFLSGTPRSSGGPVELRI---------------------------------- 243

Query: 244 XXXXXDDMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTK 303
                DD+               + G+ I  L +    +++E              + T 
Sbjct: 244 ----RDDL---------------KYGVRITGLTEKRCESSEELSRWIQIGDKNRKTSETI 284

Query: 304 LNDVSSRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQ 362
            N  SSRSH I  + L     +      S ++L DLAGSE   KA +   R KE   IN+
Sbjct: 285 YNTRSSRSHAIVLVRLNNTDLRSGETVSSTLSLCDLAGSE---KAVSQYERRKEGAFINK 341

Query: 363 SLLTLGRVINSL------------------ADKSAHIPFRESKLTRLLQDSLGGNTKTVL 404
           SLL LG VI+ L                   + + HIP+R+SKLTR+LQ +L GN+    
Sbjct: 342 SLLALGTVISKLSSESLSKNGPPTFTSTNPTEPNTHIPYRDSKLTRILQPALSGNSIITT 401

Query: 405 IATISPAKIAAEETCSTLEYASKAKN----IKNKPQL--GSFIIKDILLKDVSQELIKMR 458
           I TI     AA ET +T+ +AS+AKN    +  +P +  GS+  KD  +++++Q+L K  
Sbjct: 402 ICTIDTRNEAASETVNTIRFASRAKNVTLQVAKRPAVGTGSYNEKDQTIENLTQQLEKQH 461

Query: 459 ADLWCTKSKEGIYVSQKNYKEMVD 482
             +   K +  +  S  N    VD
Sbjct: 462 QLVMRLKQRTSMTSSSHNDDSTVD 485

>Smik_6.352 Chr6 (564913..567060) [2148 bp, 715 aa] {ON} YPL155C
           (REAL)
          Length = 715

 Score =  121 bits (303), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 108/398 (27%), Positives = 163/398 (40%), Gaps = 106/398 (26%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    +   V+E  ++P+    + G+N T+  YGMT +GKT+TM+G+ +     
Sbjct: 163 FKFDHVFASHCTNLEVYEKTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLLSEGQDDFSNGT 191
               + G+ P  +  LF  + +        + V  S++E+YNE + DLL  G ++  +  
Sbjct: 218 ----ELGLIPLSVSYLFTNIMEQSMNGDKKFDVVISYLEIYNERIYDLLESGLEESGSRL 273

Query: 192 ENSSKQPESLNASKKLRIFDXXXXXXXXXXXXXXXXXHKARSDYXXXXXXXXXXXXXDDM 251
              S+   S N S  L +                    K R D                 
Sbjct: 274 GTPSRSYMSKNNSNALGV------------------ELKIRDD----------------- 298

Query: 252 SLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRS 311
                         +Q G+ +  L +    ++++             +  T  N  SSRS
Sbjct: 299 --------------SQYGVKVIGLTERRCESSEDLLRWIAVGDKSRKIGETDYNARSSRS 344

Query: 312 HTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRV 370
           H I  I L     +D   R S ++L DLAGSE   +A     R KE   IN+SLL LG V
Sbjct: 345 HAIVLIRLTSTDVRDGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTV 401

Query: 371 INSL-ADK------------------------------------SAHIPFRESKLTRLLQ 393
           I+ L ADK                                    S HIP+R+SKLTRLLQ
Sbjct: 402 ISKLSADKTNSVGSIIPTTPTSSGNSSSSSSSSSGSIVSNSNTSSNHIPYRDSKLTRLLQ 461

Query: 394 DSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
            +L G++    I T+     AA ET +TL +AS+AKN+
Sbjct: 462 PALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 499

>Smik_7.48 Chr7 (79575..81992) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (302), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 104/177 (58%), Gaps = 8/177 (4%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK- 324
           TQ+ I + NL   H +T ++              + T+ N+VSSRSH +  I + +  K 
Sbjct: 265 TQSHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKL 324

Query: 325 DDL---YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA----DK 377
            DL   +  + ++++DLAGSE         +R  E  +IN+SLL LG  IN+L      +
Sbjct: 325 VDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 378 SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           S HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  +SSQ  V+++   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQSRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF  + D     ++ +  S++E+YNE +RDLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKIADLRDEKNFEISLSYLEIYNERIRDLL 250

>Skud_7.53 Chr7 (90098..92515) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  120 bits (300), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 105/177 (59%), Gaps = 8/177 (4%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK- 324
           TQ  I + NL   H +T ++              + T+ N+VSSRSH++  I + +  K 
Sbjct: 265 TQNHIKVANLSYHHPTTVEDVMDLVVQGNINRTTSPTEANEVSSRSHSVLQIHIMQTNKL 324

Query: 325 DDL---YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA----DK 377
            DL   +  + ++++DLAGSE  +      +R  E  +IN+SLL LG  IN+L      +
Sbjct: 325 VDLTSQHTFATLSIIDLAGSERASATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 378 SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           + HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 385 TCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  +SSQ  V+++   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDENSSQVRVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF  + D     ++ +  S++E+YNE + DLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKISDLKDEKNFEISLSYLEIYNERISDLL 250

>YGL216W Chr7 (84885..87302) [2418 bp, 805 aa] {ON}
           KIP3Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 805

 Score =  119 bits (299), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 103/177 (58%), Gaps = 8/177 (4%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK- 324
           TQ  I + NL   H +T ++              + T+ N+VSSRSH +  I + +  K 
Sbjct: 265 TQNHIKVANLSYHHPNTVEDVMDLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKL 324

Query: 325 DDL---YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA----DK 377
            DL   +  + ++++DLAGSE         +R  E  +IN+SLL LG  IN+L      +
Sbjct: 325 VDLTSQHTFATLSIIDLAGSERAAATRNRGIRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 378 SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           S HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 385 SCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++   SSQ  V+++   PL    + G+N T+  YG T  GKTYT++G        
Sbjct: 153 FVFDKLFDETSSQARVYKETTSPLLDSVLDGFNSTVFAYGATGCGKTYTVSG-------- 204

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF  + D     D+ +  S++E+YNE +RDLL
Sbjct: 205 -TPSQPGIIFLAMEELFNKITDLKDEKDFEISLSYLEIYNERIRDLL 250

>Suva_7.44 Chr7 (79883..82300) [2418 bp, 805 aa] {ON} YGL216W (REAL)
          Length = 805

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 72/177 (40%), Positives = 103/177 (58%), Gaps = 8/177 (4%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK- 324
           TQ  I + NL   H +T ++              + T+ N+VSSRSH +  I + +  K 
Sbjct: 265 TQNHIKVANLSYHHPTTVEDVMNLVVQGNINRTTSPTEANEVSSRSHAVLQIHIMQTNKL 324

Query: 325 DDL---YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA----DK 377
            DL   +  + ++++DLAGSE         LR  E  +IN+SLL LG  IN+L      +
Sbjct: 325 VDLTSQHTFATLSVIDLAGSERAAATRNRGLRLHEGANINRSLLALGNCINALCLNDGSR 384

Query: 378 SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           + HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 385 TCHIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 67/129 (51%), Gaps = 18/129 (13%)

Query: 61  SINTSGGSGIEAQLQAK----TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLV 116
           SIN++G +   +Q +       +  DK++  +SSQ  V+++   PL    + GYN T+  
Sbjct: 131 SINSNGTNKFASQRRRHGGEIKFVFDKLFDENSSQTQVYKETTSPLLDSVLDGYNSTVFA 190

Query: 117 YGMTSTGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVEL 171
           YG T  GKTYT++G            Q G+    + +LF  + D     ++ +  S++E+
Sbjct: 191 YGATGCGKTYTVSG---------TPSQPGVIFLAMEELFNKIDDLKDEKNFEISLSYLEI 241

Query: 172 YNEDLRDLL 180
           YNE +RDLL
Sbjct: 242 YNERIRDLL 250

>Ecym_4066 Chr4 (146761..148197) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii ACR228C - AER441C - ADR145C
          Length = 478

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 71/174 (40%), Positives = 104/174 (59%), Gaps = 7/174 (4%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYK----KFKDD 326
           YI+ L D  +++ +E             VA T +N+ SSRSH I TI + +     F D 
Sbjct: 173 YIEGLSDRIVNSCEELLKCIEEGSARRSVAGTAVNENSSRSHAICTINIQQTEIDSFGDT 232

Query: 327 LYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA-DKSAHIPFRE 385
           + R+S I LVDLAGSE    +   + R KE  +IN+SL+TL RV+  L+ +K   +P+RE
Sbjct: 233 VERVSSIKLVDLAGSERTKVSKTKDERFKEGTNINKSLMTLRRVVTMLSNNKVTGVPYRE 292

Query: 386 SKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           S LTR+L+D+L GN+ T ++A ISP     EE+ STL YAS AK+++ +  L +
Sbjct: 293 SLLTRVLRDNLDGNSITCILACISPCDY--EESISTLRYASTAKHVRTEAHLNT 344

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/170 (28%), Positives = 79/170 (46%), Gaps = 27/170 (15%)

Query: 26  NITVAVRCRGRNKREIEAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVY 85
           NI VA+R R +  RE    S I           E+++     + +   ++  T+  D+V+
Sbjct: 4   NIKVAIRIRDKISRETSRPSVIKRKTSN-----EITLQKDNTANVITTVE-HTFYFDQVF 57

Query: 86  GPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQAG 145
              S+QK ++ + A       + GY+  ++ YG T  GKTYTM     MG E +     G
Sbjct: 58  DESSNQKQIYHELAREYILKALEGYHTCVIAYGQTGAGKTYTM-----MGTEQE----PG 108

Query: 146 IAPRI---LVKLFECLQDD---------YVVKCSFVELYNEDLRDLLSEG 183
           I P +   L K+ +  QD+         + V  S+ ++YNE + D+LS G
Sbjct: 109 IIPLVSHELFKIIDMCQDEGPDEDALVHFKVTVSYFQIYNEQIYDMLSGG 158

>KAFR0F04210 Chr6 complement(826173..828191) [2019 bp, 672 aa] {ON}
           Anc_3.528 YGL216W
          Length = 672

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 110/177 (62%), Gaps = 20/177 (11%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFK--DDLYRLSKIN----LVDLAGSENVNKAGALNLR 353
           + T+ N+VSSRSH++  I + +  K  DD+   ++I+    ++DLAGSE         +R
Sbjct: 241 SPTEANEVSSRSHSVLQIHVKQVLKNFDDIGSTNQIDSTLSIIDLAGSERAITTKNRGIR 300

Query: 354 AKESGSINQSLLTLGRVINSLA--DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPA 411
             E  +IN+SLL LG  IN+L    KS HIP+R+SKLTRLL+ SLGGN KTV+I  +SP+
Sbjct: 301 LYEGANINKSLLALGNCINALCINKKSCHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPS 360

Query: 412 KIAAEETCSTLEYASKAKNIKNKP---------QLGSFIIKDILLKDVSQELIKMRA 459
            +  +ET +TL+YA++AK IK K           +GS++    L+ +  QE+ K++A
Sbjct: 361 SLHYDETLNTLKYANRAKEIKTKVIRNQTSLNRHVGSYL---KLITEQKQEIDKLKA 414

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 57/110 (51%), Gaps = 17/110 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  DS+Q+ +FED   PL    + G+N T+  YG T  GKTYT+ G  E     
Sbjct: 92  FIFDKLFDDDSTQEQIFEDTTRPLLDSVLDGFNGTVFAYGATGCGKTYTINGTSE----- 146

Query: 139 DVNGQAGIAPRILVKLFE----CLQDD----YVVKCSFVELYNEDLRDLL 180
                 GI  R + +LF      LQD       +  S++E+YNE +RDLL
Sbjct: 147 ----DPGIIFRTMNELFGKIEILLQDSNRSKIEISLSYLEIYNETIRDLL 192

>Ecym_3415 Chr3 (782976..784964) [1989 bp, 662 aa] {ON} similar to
           Ashbya gossypii ADR145C
          Length = 662

 Score =  114 bits (286), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 88/245 (35%), Positives = 131/245 (53%), Gaps = 16/245 (6%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL- 327
           G+Y+Q+     +S   E              ++T +N  SSRSH I  I L K+  D+L 
Sbjct: 215 GVYVQSATVISVSDGDELLHCIHLGESQRCKSSTDMNFESSRSHAIVKINLLKR--DNLE 272

Query: 328 --YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKS---AHIP 382
              + S + LVDLAGSE V+K  A+    +E+  IN SL +LG VIN+L  K     HIP
Sbjct: 273 GSIQKSDLFLVDLAGSEKVSKTNAVGATLEEAKKINLSLSSLGNVINALTQKDKKRTHIP 332

Query: 383 FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQL--GSF 440
           +R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK I+NK  +     
Sbjct: 333 YRDSQLTRLLRDSLGGNSKTTLILNCACDKSNEAETLTTLRFGSRAKQIENKAIVNRSDL 392

Query: 441 IIKDILLKDVSQELIKMRADLWCTK----SKEGIYVSQKNYKEMVDDLDNFKTELTELKR 496
            +K  L + ++  L++ R   +  +      E + +   N +    D ++ +TE T+LK 
Sbjct: 393 FLKKKLERQIA--LLEKREQEYQNRITLLEHEVLALRANNIRAPSPDTEDIETENTKLKA 450

Query: 497 TNDSL 501
             DSL
Sbjct: 451 QMDSL 455

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 46/129 (35%), Positives = 73/129 (56%), Gaps = 18/129 (13%)

Query: 63  NTSGGS--GIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMT 120
           +TS GS  G++ +  ++++  D V+G +S+Q  V++  AE +   F  GYN T+L YG T
Sbjct: 69  DTSPGSTNGVQGESPSRSFHFDYVFGTNSTQDDVYDFVAEEMLDQFFTGYNSTILAYGQT 128

Query: 121 STGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECL-------QDDYVVKCSFVELYN 173
            +GK+YTM G ++           G+ PRI  ++FE +         +YVV  SF+E+Y 
Sbjct: 129 GSGKSYTMFGPID---------NRGLIPRICHEIFERIGLLKSSADIEYVVSVSFLEIYL 179

Query: 174 EDLRDLLSE 182
           E + DLL E
Sbjct: 180 EKVYDLLGE 188

>ADR145C Chr4 complement(959805..961712) [1908 bp, 635 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL079W
           (SMY1)
          Length = 635

 Score =  114 bits (285), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 147/279 (52%), Gaps = 35/279 (12%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDL- 327
           G+Y++      +S   E               +T +N  SSRSH I  I L K+  D+L 
Sbjct: 188 GVYVEGATIVSVSDGDELLNCIHLGEAQRYKGSTDMNLESSRSHAIVKINLLKR--DNLE 245

Query: 328 --YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA--DKSAHIPF 383
              + S + LVDLAGSE V K  A+    +E+  IN SL +LG VIN+L   +K  HIP+
Sbjct: 246 GNIQKSDLFLVDLAGSEKVAKTNAVGATLEEAKKINLSLSSLGNVINALTQKEKRTHIPY 305

Query: 384 RESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK 443
           R+S+LTRLL+DSLGGN+KT LI   +  K    ET +TL + S+AK+IKNK  +      
Sbjct: 306 RDSQLTRLLRDSLGGNSKTTLILNCACDKSNESETLTTLRFGSRAKHIKNKAIVNK---S 362

Query: 444 DILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRT--NDSL 501
           D+ LK       K+   +   + KE      ++YK  ++ L++   E+ EL+ T  +  L
Sbjct: 363 DLFLKK------KLERKIAQLEKKE------QDYKTRIELLEH---EVKELQATASHRPL 407

Query: 502 VQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKL 540
            +E +LL +  K        L++++D+L+  L   T+ L
Sbjct: 408 PEEVDLLAENTK--------LRAQVDSLKVLLNPRTDSL 438

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 71/130 (54%), Gaps = 16/130 (12%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           +A+ +  D V+G D+ Q+ VF+  AE +   F  GYN T+L YG T +GK+YTM G    
Sbjct: 56  EARAFRFDYVFGTDARQEEVFDYVAEEMLDQFFTGYNSTILAYGQTGSGKSYTMFGP--- 112

Query: 135 GAEGDVNGQAGIAPRILVKLFE-------CLQDDYVVKCSFVELYNEDLRDLLSEGQDDF 187
                  G  G+ PRI  ++FE       C   +YVV  SF+E+Y E + DLL E  +  
Sbjct: 113 ------PGHRGLIPRICQQIFERIGLLKNCADIEYVVSVSFLEIYLEKVYDLLGESINKA 166

Query: 188 SNGTENSSKQ 197
           S+  +NS K+
Sbjct: 167 SSPKKNSDKR 176

>CAGL0I07029g Chr9 (675486..677603) [2118 bp, 705 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216w KIP3
           kinesin-related protein required for nuclear migration
          Length = 705

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 97/179 (54%), Gaps = 10/179 (5%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK- 324
           T   I + NL     +T +E              + T+ N+VSSRSH +  I + +K + 
Sbjct: 268 TDNKITVANLSQHFPTTVQEVMDLVIRGNFNRTTSPTEANEVSSRSHAVLQIHIVQKNRT 327

Query: 325 ---DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA------ 375
               + +    ++++DLAGSE          R  E  +IN+SLL LG  IN+L       
Sbjct: 328 PDIKEEHTFGTLSIIDLAGSERAAATKNRGARLHEGANINRSLLALGNCINALCINGNDE 387

Query: 376 DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
               H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 388 RPRCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 446

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 58/107 (54%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D++Q+ V++     L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 156 FVFDKLFDTDATQREVYQSTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE----- 210

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
                 GI  + + +LF+ ++D      + +  SF+E+YNE +RDLL
Sbjct: 211 ----NPGIVFQAMEELFQKMEDLKDTKSFQISLSFLEIYNERIRDLL 253

>NCAS0E00550 Chr5 complement(93778..96132) [2355 bp, 784 aa] {ON}
           Anc_3.528
          Length = 784

 Score =  112 bits (279), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 100/175 (57%), Gaps = 10/175 (5%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKD-DL- 327
           I + NL   +  T +E              + T+ N+VSSRSH +  I + +  +  DL 
Sbjct: 267 ISVSNLSYHNPQTVQEVIDLVIKGNINRTTSPTEANEVSSRSHAVLQIHIMQTNRTADLT 326

Query: 328 --YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA------DKSA 379
             +  + ++++DLAGSE          R  E  +IN+SLL LG  IN+L       ++S 
Sbjct: 327 SEHTFATLSIIDLAGSERAAATKNRGERLYEGANINRSLLALGNCINALCLTDGGTNRSC 386

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           HIP+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 387 HIPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSSHYDETLNTLKYANRAKEIKTK 441

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 60/107 (56%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D+SQ+ V++     L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 151 FVFDKLFDQDASQETVYQSTTSGLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE----- 205

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
               Q GI  R++ +LFE ++D      + +  S++E+YNE +RDLL
Sbjct: 206 ----QPGIIFRVMQELFERMEDLKDTKRFELSLSYLEIYNETIRDLL 248

>SAKL0F01760g Chr6 (146659..149088) [2430 bp, 809 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 809

 Score =  111 bits (278), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/174 (36%), Positives = 97/174 (55%), Gaps = 8/174 (4%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK---- 324
           GI + NL      T ++              + T  N+ SSRSH +  I + +K +    
Sbjct: 251 GISVANLSHHTPQTVQDVMDLVVRGNMNRTTSPTDANETSSRSHAVLQINVVQKNRTAEL 310

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA----DKSAH 380
            + +  + ++++DLAGSE  +       R  E  +IN+SLL LG  IN+L       + H
Sbjct: 311 SEAHTFATLSIIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRRSTCH 370

Query: 381 IPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           +P+R+SKLTRLL+ SLGGN KTV+I  I+P+    +ET +TL+YA++AK IK K
Sbjct: 371 VPYRDSKLTRLLKFSLGGNCKTVMIVCIAPSSAHYDETLNTLKYANRAKEIKTK 424

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 59/108 (54%), Gaps = 14/108 (12%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D++Q  V+E    PL    + G+N T+  YG T  GKT+T++G  E     
Sbjct: 136 FVFDKLFDEDATQTEVYESTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTPE----- 190

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLLS 181
               Q G+    + +LF+ ++D      + +  S++E+YNE +RDLLS
Sbjct: 191 ----QPGVIFLTMQELFQRIEDLKDSKHFDLTLSYLEIYNESIRDLLS 234

>Kwal_47.19093 s47 complement(1092732..1095191) [2460 bp, 819 aa]
           {ON} YGL216W (KIP3) - 1:1 [contig 188] FULL
          Length = 819

 Score =  110 bits (275), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 98/175 (56%), Gaps = 11/175 (6%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK-----FK 324
           I + NL    +ST ++              + T  N+ SSRSH +  + + ++       
Sbjct: 241 ITVANLSHHPLSTVEDVMDLVIKGNTNRTTSATDANETSSRSHAVLQVHITQRNRTAELT 300

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA-----DKSA 379
           +D ++ + ++L+DLAGSE  +       R  E  +IN+SLL LG  IN+L          
Sbjct: 301 ED-HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCVSGRKRGGY 359

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 360 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSNHYDETLNTLKYATRAKEIKTK 414

 Score = 68.6 bits (166), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D+V+  DSSQ  V+E    PL    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 125 FVFDRVFDMDSSQIEVYEATTRPLLDSVLDGFNGTVFAYGATGCGKTYTVSGTPE----- 179

Query: 139 DVNGQAGIAPRILVKLF---ECLQDD--YVVKCSFVELYNEDLRDLL 180
                 GI    + +LF   E LQD   + +  S++E+YNE +RDLL
Sbjct: 180 ----NPGIIFLTMQELFAKMEELQDTKRFELSASYLEIYNETIRDLL 222

>TDEL0D05960 Chr4 complement(1079683..1081884) [2202 bp, 733 aa]
           {ON} Anc_3.528 YGL216W
          Length = 733

 Score =  109 bits (272), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 9/144 (6%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDL----YRLSKINLVDLAGSENVNKAGALNLRAK 355
           + T  N+ SSRSH +  I + +  +       +  +K++++DLAGSE          R +
Sbjct: 275 SATDANETSSRSHAVLQINIVQSSRTAEITSDHTFAKLSIIDLAGSERAASTKNRGERLQ 334

Query: 356 ESGSINQSLLTLGRVINSLA-----DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISP 410
           E  +IN+SLL LG  IN+L       ++ H+P+R+SKLTRLL+ SLGGN KTV+I  +SP
Sbjct: 335 EGANINRSLLALGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSP 394

Query: 411 AKIAAEETCSTLEYASKAKNIKNK 434
           +    +ET +TL+YA++AK IK K
Sbjct: 395 SSTHYDETLNTLKYANRAKEIKTK 418

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 8/105 (7%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  +++Q+ V+      L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 129 FVFDKLFDENATQEEVYSGTTSELLDAVLDGFNGTVFAYGATGCGKTYTVSGTPERP--- 185

Query: 139 DVNGQAGIAPRILVKLFECLQD--DYVVKCSFVELYNEDLRDLLS 181
              G   +A + L    E L+D   + +  S++E+YNE +RDLLS
Sbjct: 186 ---GVIFLAMQELFARMEELEDTRKFEISVSYLEIYNETIRDLLS 227

>ZYRO0E08668g Chr5 complement(694586..696922) [2337 bp, 778 aa] {ON}
           similar to uniprot|P53086 Saccharomyces cerevisiae
           YGL216W KIP3 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 778

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 96/175 (54%), Gaps = 11/175 (6%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK-----FK 324
           I + NL  ++    ++              + T  N+ SSRSH +  I + +       K
Sbjct: 244 IRVSNLSHYNPQKVEDVMDLVIKGNMNRTTSATDANEASSRSHAVLQIHIMQHNRTADLK 303

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLA-----DKSA 379
            D +  + ++++DLAGSE          R  E  +IN+SLL LG  IN+L       +S 
Sbjct: 304 SD-HTFATLSIIDLAGSERAATTKNRGNRLYEGANINRSLLALGNCINALCLNDGTRRSC 362

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +TL+YA++AK IK K
Sbjct: 363 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNTLKYANRAKEIKTK 417

 Score = 68.2 bits (165), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (54%), Gaps = 14/108 (12%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D+++  DS+QK V+E    PL    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 128 FVFDRLFDVDSTQKDVYESTMIPLLDSVLDGFNGTVFAYGATGCGKTYTISGSPE----- 182

Query: 139 DVNGQAGIAPRILVKLF---ECLQD--DYVVKCSFVELYNEDLRDLLS 181
                 GI  + + +LF   E L+D   + +  SF+E+YNE +RDLL 
Sbjct: 183 ----NPGIIFQAMQELFNRIENLKDTKHFELSLSFLEIYNESIRDLLC 226

>KNAG0B00520 Chr2 (85045..87216) [2172 bp, 723 aa] {ON} Anc_3.528
           YGL216W
          Length = 723

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 88/142 (61%), Gaps = 9/142 (6%)

Query: 302 TKLNDVSSRSHTIFTITLYKKFK-DDLYR---LSKINLVDLAGSENVNKAGALNLRAKES 357
           T+ N VSSRSH +  I + ++ K  DL        ++++DLAGSE          R  E 
Sbjct: 291 TEANSVSSRSHAVLQIHIMQRNKLVDLKEHQTFGTLSIIDLAGSERAAATKNRGRRLHEG 350

Query: 358 GSINQSLLTLGRVINSLAD-----KSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAK 412
            +IN+SLL LG  IN+L       ++ H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+ 
Sbjct: 351 ANINRSLLALGNCINALCSNDGSHRNQHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSS 410

Query: 413 IAAEETCSTLEYASKAKNIKNK 434
              +ET +TL+YA++AK IK K
Sbjct: 411 AHYDETLNTLKYANRAKEIKTK 432

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 54/108 (50%), Gaps = 14/108 (12%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D SQ+ V+      L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 143 FVFDKLFDTDVSQEDVYRGTTSTLLDSVLDGFNGTVFAYGATGCGKTYTVSGTRE----- 197

Query: 139 DVNGQAGIAPRILVKLFECLQ-----DDYVVKCSFVELYNEDLRDLLS 181
                 GI  R + +LF  +       D+ +  SF+E+YNE + DLLS
Sbjct: 198 ----NPGIIFRTMEELFVKMDALAGTKDFELTVSFLEIYNETIHDLLS 241

>KLTH0G01606g Chr7 (116364..118823) [2460 bp, 819 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 819

 Score =  108 bits (269), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 65/175 (37%), Positives = 96/175 (54%), Gaps = 11/175 (6%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK-----FK 324
           I + NL    + T ++              + T  N+ SSRSH +  + + +K       
Sbjct: 241 ITVANLSHHPLFTVEDVMDLVVKGNINRTTSATDANETSSRSHAVLQVHITQKNRTAELT 300

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA----- 379
           +D ++ + ++L+DLAGSE  +       R  E  +IN+SLL LG  IN+L          
Sbjct: 301 ED-HKFATLSLIDLAGSERASATKNRGERLHEGANINRSLLALGNCINALCAGGKRGGGF 359

Query: 380 HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNK 434
           H+P+R+SKLTRLL+ SLGGN KTV+I  ISP     +ET +TL+YA++AK IK K
Sbjct: 360 HVPYRDSKLTRLLKFSLGGNCKTVMIVCISPTSNHYDETLNTLKYATRAKEIKTK 414

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D+V+   +SQ+ V+E    PL    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 125 FVFDRVFDMHASQEEVYEATTRPLLDSVLDGFNSTVFAYGATGCGKTYTVSGTAE----- 179

Query: 139 DVNGQAGIAPRILVKLF---ECLQD--DYVVKCSFVELYNEDLRDLL 180
                 GI    + +LF   E L+D   + +  S++E+YNE +RDLL
Sbjct: 180 ----NPGIIFLTMQELFAKMEQLKDTKKFELTASYLEIYNESIRDLL 222

>NDAI0I02960 Chr9 complement(699469..702075) [2607 bp, 868 aa] {ON}
           Anc_3.528
          Length = 868

 Score =  107 bits (267), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 91/148 (61%), Gaps = 13/148 (8%)

Query: 300 ATTKLNDVSSRSHTIFTITLYK-KFKDDL---YRLSKINLVDLAGSENVNKAGALNLRAK 355
           ++T+ N+VSSRSH +  I + +   K DL   +  + ++++DLAGSE          R  
Sbjct: 337 SSTEANEVSSRSHAVLQIHIMQTNTKIDLTSEHTFATLSIIDLAGSERAAATKNRGERLY 396

Query: 356 ESGSINQSLLTLGRVINSLA---------DKSAHIPFRESKLTRLLQDSLGGNTKTVLIA 406
           E  +IN+SLL LG  IN+L          +   HIP+R+SKLTRLL+ SLGGN KTV+I 
Sbjct: 397 EGANINKSLLALGNCINALCIPTNNTRRRNIRYHIPYRDSKLTRLLKFSLGGNCKTVMIV 456

Query: 407 TISPAKIAAEETCSTLEYASKAKNIKNK 434
            ISP+    +ET +TL+YA++AK IK K
Sbjct: 457 CISPSSSHYDETLNTLKYANRAKEIKTK 484

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  +SSQ  V+      L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 191 FVFDKIFDENSSQDEVYLGTTSSLLDSVLDGFNGTVFAYGATGCGKTYTVSGTQE----- 245

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
                 GI  R++ +LFE ++D      + +  S++E+YNE + DLL
Sbjct: 246 ----NPGIIFRVMQELFERMEDLKDEKTFQLSISYLEIYNEMIYDLL 288

>Kpol_423.8 s423 (11134..13554) [2421 bp, 806 aa] {ON}
           (11134..13554) [2421 nt, 807 aa]
          Length = 806

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 89/144 (61%), Gaps = 9/144 (6%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKD-DL---YRLSKINLVDLAGSENVNKAGALNLRAK 355
           + T  N+ SSRSH +  I + +  +  DL   +  + ++++DLAGSE          R  
Sbjct: 292 SATDANETSSRSHAVLQIHISQTNRTVDLTSSHVFATLSIIDLAGSERAASTKNRGERLY 351

Query: 356 ESGSINQSLLTLGRVINSLA-----DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISP 410
           E  +IN+SLL LG  IN+L       +S H+P+R+SKLTRLL+ SLGGN KTV+I  +SP
Sbjct: 352 EGANINKSLLALGNCINALCLNDGTRRSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVSP 411

Query: 411 AKIAAEETCSTLEYASKAKNIKNK 434
           +    +ET +TL+YA++AK IK K
Sbjct: 412 SSTHYDETLNTLKYANRAKEIKTK 435

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 56/107 (52%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++   SSQ  V+      L    + G+N T+  YG T  GKTYT++G  E     
Sbjct: 146 FIFDKLFNEGSSQLAVYRSTTSLLLDSVLDGFNGTVFAYGATGCGKTYTISGTPE----- 200

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF+ +++     ++ +  S++E+YNE +RDLL
Sbjct: 201 ----QPGIIFLAMEELFQKIENIKDTKNFELTLSYLEIYNESIRDLL 243

>AER441C Chr5 complement(1480055..1482511) [2457 bp, 818 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL216W
           (KIP3)
          Length = 818

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 89/145 (61%), Gaps = 12/145 (8%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFK------DDLYRLSKINLVDLAGSENVNKAGALNLR 353
           + T  N+ SSRSH +  + + +  +      D +Y  + ++++DLAGSE  +       R
Sbjct: 274 SPTDANETSSRSHAVLQVHVVQSSRTVDLKEDKMY--ATLSIIDLAGSERASATKNRGER 331

Query: 354 AKESGSINQSLLTLGRVINSLA----DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATIS 409
             E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN KTV+I  +S
Sbjct: 332 LHEGSNINKSLLALGNCINALCMTGRRAVCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVS 391

Query: 410 PAKIAAEETCSTLEYASKAKNIKNK 434
           P+    +ET +TL+YA++AK+IK K
Sbjct: 392 PSSAHYDETLNTLKYANRAKDIKTK 416

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D+SQ+ VF+    PL    + G+N T+  YG T  GKT+T++G  +     
Sbjct: 128 FMFDKLFDVDASQQDVFQCTTMPLLDSILDGFNGTVFAYGATGCGKTFTISGTPD----- 182

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
                 GI    + +LF+ + +      + +  S++E+YNE +RDLL
Sbjct: 183 ----SPGIIFLTMQELFQRINNLKDTKTFELTVSYLEIYNETIRDLL 225

>TPHA0D03480 Chr4 complement(731687..734230) [2544 bp, 847 aa] {ON}
           Anc_3.528 YGL216W
          Length = 847

 Score =  106 bits (264), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/193 (36%), Positives = 101/193 (52%), Gaps = 11/193 (5%)

Query: 253 LNANAGGKTHV--PPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSR 310
           LN N   K  V    +   I + NL      T +E              + T  N+ SSR
Sbjct: 225 LNPNVSSKKLVIREDSDQKITVSNLSHHKPQTVQEVMDFVIRGNMNRTTSPTDANETSSR 284

Query: 311 SHTIFTITLYKKFK-DDLYR---LSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLT 366
           SH +  I + +  +  DL      + ++++DLAGSE          R  E  +IN+SLL 
Sbjct: 285 SHAVLQIHIAQTDRTPDLISNSTFATLSIIDLAGSERAASTKNRGERLIEGANINKSLLA 344

Query: 367 LGRVINSLA-----DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCST 421
           LG  IN+L       ++ H+P+R+SKLTRLL+ SLGGN KTV+I  ISP+    +ET +T
Sbjct: 345 LGNCINALCISDGTRRTCHVPYRDSKLTRLLKFSLGGNCKTVMIVCISPSSTHYDETLNT 404

Query: 422 LEYASKAKNIKNK 434
           L YA++AK+IK K
Sbjct: 405 LTYANRAKDIKTK 417

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 55/107 (51%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++   ++Q  V+      L    + G+N T+  YG T  GKT+T++G  E     
Sbjct: 128 FVFDKLFDETANQTNVYNSTTSSLLDSVLDGFNGTVFAYGATGCGKTFTISGTPE----- 182

Query: 139 DVNGQAGIAPRILVKLF---ECLQD--DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF   E L+D  +  +  S++E+YNE +RDLL
Sbjct: 183 ----QPGIIFLTMDELFKRIESLKDTKNIELTLSYLEIYNETIRDLL 225

>TBLA0C04960 Chr3 complement(1210067..1212472) [2406 bp, 801 aa]
           {ON} Anc_3.528 YGL216W
          Length = 801

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 103/181 (56%), Gaps = 19/181 (10%)

Query: 270 IYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYK--KFKDDL 327
           I + NL  +  +T +E              ++T  N+ SSRSH +  I L +  K  +D+
Sbjct: 226 ISVSNLSTYSPATIEEVMDLIIQGNLNRTTSSTHANETSSRSHAVLQIHLTQQNKLNNDI 285

Query: 328 ----YRLSKINLVDLAGSENVNKAGALNLRAK---ESGSINQSLLTLGRVINSL------ 374
                  S ++++DLAGSE   +A +   R +   E  +IN+SLL LG  IN+L      
Sbjct: 286 NSTEQLFSTLSIIDLAGSE---RAASTKNRGETLLEGANINKSLLALGNCINALCINTSS 342

Query: 375 -ADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKN 433
            + +  HIP+R+SKLTRLL+ SLGGN KTV+I  +SP+    +ET +TL+YA++AK IK 
Sbjct: 343 HSQQQIHIPYRDSKLTRLLKFSLGGNCKTVMIVCVSPSSKHYDETLNTLKYANRAKEIKT 402

Query: 434 K 434
           K
Sbjct: 403 K 403

 Score = 68.2 bits (165), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK+   +S+Q+ VF+   EPL    + GYN T+  YG T  GKTYT++G  E     
Sbjct: 110 FIFDKLLDQNSTQQHVFQSTTEPLLDSILDGYNGTVFAYGATGCGKTYTISGTPE----- 164

Query: 139 DVNGQAGIAPRILVKLF---ECLQD--DYVVKCSFVELYNEDLRDLL 180
                 GI    L  LF   E L+D  +  +  S++E+YNE ++DLL
Sbjct: 165 ----NPGIIFLTLQSLFNKIENLKDTKEISISLSYLEIYNESIKDLL 207

>Ecym_1200 Chr1 (402658..405159) [2502 bp, 833 aa] {ON} similar to
           Ashbya gossypii AER441C
          Length = 833

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 88/145 (60%), Gaps = 12/145 (8%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFK------DDLYRLSKINLVDLAGSENVNKAGALNLR 353
           + T  N+ SSRSH +  I + +  +      D  Y  + ++++DLAGSE  +       R
Sbjct: 276 SPTDANETSSRSHAVLQIHVVQSSRSVDLKEDKTY--ATLSIIDLAGSERASATKNRGER 333

Query: 354 AKESGSINQSLLTLGRVINSLA----DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATIS 409
             E  +IN+SLL LG  IN+L         H+P+R+SKLTRLL+ SLGGN KTV+I  +S
Sbjct: 334 LHEGSNINKSLLALGNCINALCMTGRRTYCHVPYRDSKLTRLLKFSLGGNCKTVMIVCVS 393

Query: 410 PAKIAAEETCSTLEYASKAKNIKNK 434
           P+    +ET +TL+YA++AK+IK K
Sbjct: 394 PSSAHYDETLNTLKYANRAKDIKTK 418

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 57/107 (53%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  +++Q+ VF     PL    + G+N T+  YG T  GKT+T++G  E     
Sbjct: 130 FMFDKLFDVEATQQDVFLGTTRPLLDSIIDGFNGTVFAYGATGCGKTFTISGTPE----- 184

Query: 139 DVNGQAGIAPRILVKLFECLQD-----DYVVKCSFVELYNEDLRDLL 180
                 GI    + +LF+ +++      + +  S++E+YNE +RDLL
Sbjct: 185 ----NPGIIFLTMQELFQRIENLKDTKTFQLTVSYLEIYNEMIRDLL 227

>CAGL0D04994g Chr4 complement(482176..484254) [2079 bp, 692 aa] {ON}
           similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141c KAR3 kinesin-related protein
          Length = 692

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 87/137 (63%), Gaps = 4/137 (2%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKI-NLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF I L  K +    +   I NLVDLAGSE +N +  +  R +E+ 
Sbjct: 551 ASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLNSSMVVGERLRETQ 610

Query: 359 SINQSLLTLGRVINSLAD---KSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           SIN+SL  LG VI++L     +  HIPFR SKLT LLQ SL G++KT++   ISPA +  
Sbjct: 611 SINKSLSCLGDVIHALNSPDGQKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHL 670

Query: 416 EETCSTLEYASKAKNIK 432
            ET ++L +ASK  N K
Sbjct: 671 NETINSLRFASKVNNTK 687

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 58/131 (44%), Gaps = 18/131 (13%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           Q   +  DK++    +   +F++  + L    + GYN  +  YG T +GKTYTM      
Sbjct: 393 QVIPFKFDKIFDQQETNDEIFKEVGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM------ 445

Query: 135 GAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQDDFS 188
                +N   GI P  +  +F  +         Y V C F+E+YNE++ DLL  G     
Sbjct: 446 -----LNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRSGAPSQE 500

Query: 189 NGTENSSKQPE 199
           N   N+  + E
Sbjct: 501 NNDRNADSKHE 511

>TPHA0D03200 Chr4 complement(659182..661356) [2175 bp, 724 aa] {ON}
           Anc_3.479 YPR141C
          Length = 724

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 89/139 (64%), Gaps = 8/139 (5%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSK---INLVDLAGSENVNKAGALNLRAKE 356
           A T  N+ SSRSH++F I  Y K K+++   S    +NLVDLAGSE +N + A+  R +E
Sbjct: 582 AATNSNERSSRSHSVFMI--YLKGKNEITGDSSEGILNLVDLAGSERLNSSQAVGARLRE 639

Query: 357 SGSINQSLLTLGRVINSLA---DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           + +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT++   ISP K 
Sbjct: 640 TQNINKSLSCLGDVIHALGQNDNTKRHIPFRNSKLTYLLQYSLTGSSKTLMFVNISPTKS 699

Query: 414 AAEETCSTLEYASKAKNIK 432
              ET ++L +ASK  + K
Sbjct: 700 HLNETINSLRFASKVNSTK 718

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 64/127 (50%), Gaps = 21/127 (16%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           +++ Y  D+++    S   VF++  + L    + G+N  +  YG T +GKTYTM      
Sbjct: 426 ESQIYKFDRIFDQADSNTEVFKEIGQ-LVQSSLDGHNVCIFAYGQTGSGKTYTM------ 478

Query: 135 GAEGDVNGQAGIAPRILVKLF---ECLQDD---YVVKCSFVELYNEDLRDLLSEGQDDFS 188
                +N   G+ P  +  +F   E +++    Y + C F+E+YNE + DLL   +D+ +
Sbjct: 479 -----LNDNDGMIPATISHIFDWTESMKEKGWIYDISCQFIEIYNEGIIDLL---RDNST 530

Query: 189 NGTENSS 195
           +G E  S
Sbjct: 531 DGNEAGS 537

>Kpol_505.39 s505 complement(87351..89429) [2079 bp, 692 aa] {ON}
           complement(87351..89429) [2079 nt, 693 aa]
          Length = 692

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 87/139 (62%), Gaps = 8/139 (5%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSK---INLVDLAGSENVNKAGALNLRAKE 356
           ATT  N+ SSRSH+IF I L  +  +++   S    +NLVDLAGSE +N +     R +E
Sbjct: 550 ATTAANERSSRSHSIFIIHL--RGSNNITGESSYGILNLVDLAGSERLNSSQVEGARLRE 607

Query: 357 SGSINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           + +IN+SL  LG VI++L    A   HIPFR SKLT LLQ SL GN+KT++   ISP + 
Sbjct: 608 TQNINKSLSCLGDVIHALGSSDASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPTQQ 667

Query: 414 AAEETCSTLEYASKAKNIK 432
             +ET ++L +ASK    K
Sbjct: 668 QIQETLNSLRFASKVNTTK 686

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 18/110 (16%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D+++      K VF++  + L    + GYN  +  YG T +GKT+TM          
Sbjct: 397 FQFDRIFDQHEVNKDVFDEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM---------- 445

Query: 139 DVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSE 182
            +N   G+ P  +  +F+          +Y V C FVE+YNE++ DLL E
Sbjct: 446 -LNPNDGMIPATIDHIFDWTDSLKERGWEYEVSCQFVEIYNENIIDLLRE 494

>KAFR0B06590 Chr2 complement(1368106..1370226) [2121 bp, 706 aa]
           {ON} Anc_3.479 YPR141C
          Length = 706

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/139 (46%), Positives = 86/139 (61%), Gaps = 8/139 (5%)

Query: 300 ATTKLNDVSSRSHTIFTITLY---KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKE 356
           A+TK N+ SSRSH+IF I L+    K  +D Y +  +NLVDLAGSE +N +     R +E
Sbjct: 566 ASTKSNEHSSRSHSIFIIHLHGKNSKTNEDSYGI--LNLVDLAGSERINSSQVSGERLRE 623

Query: 357 SGSINQSLLTLGRVI---NSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           +  IN+SL  LG VI   NS   K  HIPFR SKLT LL+ SL GN+KT++   IS +  
Sbjct: 624 TQHINKSLSCLGDVIHALNSSEHKERHIPFRNSKLTHLLKYSLSGNSKTLMFVNISASLN 683

Query: 414 AAEETCSTLEYASKAKNIK 432
              ET ++L +ASK  + K
Sbjct: 684 HVNETINSLRFASKVNSTK 702

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 55/112 (49%), Gaps = 18/112 (16%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           Y  DK++    S   +F++  + L    + GYN  +  YG T +GKT+TM          
Sbjct: 421 YKFDKIFDQFESNSEIFKEVGQ-LVQSALDGYNVCIFAYGQTGSGKTFTM---------- 469

Query: 139 DVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQ 184
            +N   GI P  +  +F  + +      +Y + C FVE+YNE++ DLL E Q
Sbjct: 470 -LNPSDGIIPSTVRHIFTWIDNLKERGWEYQINCQFVEIYNENIIDLLREKQ 520

>ZYRO0D12650g Chr4 (1071620..1073056) [1437 bp, 478 aa] {ON} some
           similarities with uniprot|P28742 Saccharomyces
           cerevisiae YBL063W KIP1
          Length = 478

 Score =  101 bits (252), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 67/178 (37%), Positives = 97/178 (54%), Gaps = 11/178 (6%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITL-----YKKFKD 325
           +++ L++  +   +E             V +T +N  SSRSH IF I++     +KK   
Sbjct: 179 FVEGLEEIAVHNVEELISCIHKGNENRTVRSTNMNQESSRSHAIFHISVNQKETHKKTGT 238

Query: 326 DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLAD----KSAHI 381
            +   S   LVDLAGSE +  A A     +E  SIN+SL  LGRVI+ LA+    +S  I
Sbjct: 239 VVECHSTCKLVDLAGSERLGSAAADGKIRQEGTSINKSLSILGRVISLLAEGDRQRSQMI 298

Query: 382 PFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLGS 439
           P+RES LT +L+++LGGN+ T L+A +SP      E+ STL YAS  K +K    + S
Sbjct: 299 PYRESALTWILKENLGGNSNTCLVACVSPENYY--ESLSTLRYASLTKKVKTNATINS 354

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 59/122 (48%), Gaps = 25/122 (20%)

Query: 76  AKTYTVDKVYGP----DSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGD 131
           AK +  D  +G     D  Q +++E          + GYN  +L YG T +GKT+TM G+
Sbjct: 49  AKEFRYDHCFGSTDSVDRDQSIIYESLVRGYVLHTLEGYNSCILAYGQTGSGKTFTMMGE 108

Query: 132 VEMGAEGDVNGQAGIAPRILVKLFE----CLQD--------DYVVKCSFVELYNEDLRDL 179
                     G  GI PR   +LFE    C QD        D+ VKCSF E+YNE + DL
Sbjct: 109 ---------KGNEGIVPRFCRELFEVFHMCHQDDQESDIITDFQVKCSFFEIYNEQVIDL 159

Query: 180 LS 181
           LS
Sbjct: 160 LS 161

>KNAG0A07880 Chr1 complement(1254698..1256992) [2295 bp, 764 aa]
           {ON} Anc_3.479 YPR141C
          Length = 764

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/134 (47%), Positives = 86/134 (64%), Gaps = 7/134 (5%)

Query: 300 ATTKLNDVSSRSHTIFTITLY---KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKE 356
           A+T  N+ SSRSH+IF I L+    K K++      +NLVDLAGSE V+ +     R +E
Sbjct: 623 ASTLSNEHSSRSHSIFIIELHGVNHKTKEE--SCGVLNLVDLAGSERVHSSQVTGERLRE 680

Query: 357 SGSINQSLLTLGRVINSLADKSA--HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIA 414
           + +IN+SL  LG VI +L DK+   HIPFR SKLT LLQ SL GN+KT++   ISP+   
Sbjct: 681 TQNINRSLSCLGDVIYALNDKNTKRHIPFRNSKLTYLLQYSLVGNSKTLMFVNISPSSSH 740

Query: 415 AEETCSTLEYASKA 428
             ET ++L +ASK 
Sbjct: 741 INETINSLRFASKV 754

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 60/120 (50%), Gaps = 22/120 (18%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           ++  DK++    S   VF++  + L    + GYN  +  YG T +GKTYTM         
Sbjct: 471 SFKFDKIFDTGESNDEVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM--------- 520

Query: 138 GDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQDDFSNGT 191
             ++   G+ P  +  +F+ +++      +Y + C FVE+YNE++ DLL   +    NGT
Sbjct: 521 --LHPNDGVIPATISHIFDWVENLKERGWEYKISCQFVEIYNENIVDLLRSNE----NGT 574

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 48/86 (55%), Gaps = 3/86 (3%)

Query: 472 VSQKNYKEMVDD-LDNFKTELTELKRTNDSLVQENELLGKEKKSGAE-RADSLKSELDNL 529
           V+QK Y+ M +  L +F+ +  E    N+  +QE   L KE +   + +A+ LKS+ D+L
Sbjct: 283 VTQK-YENMKEPWLKSFEVKWKENVEINEKCIQEITELRKELEENLQPKAEKLKSKFDSL 341

Query: 530 RSQLKSVTNKLAQTNTQNTKLSEQVT 555
           + Q   +  KL Q   ++ K+ E+++
Sbjct: 342 KEQRDELIAKLKQQQKEHRKIEEEIS 367

>Kpol_1050.103 s1050 complement(235625..237718) [2094 bp, 697 aa]
           {ON} complement(235625..237718) [2094 nt, 698 aa]
          Length = 697

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/133 (42%), Positives = 90/133 (67%), Gaps = 4/133 (3%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKI-NLVDLAGSENVNKAGALNL-RAKES 357
           A T +N+ SSRSH++F + +    KD   R   + NLVDLAGSE +N++G ++  R +E+
Sbjct: 562 AKTAMNNRSSRSHSVFIVEVEGFNKDSEERCKGVLNLVDLAGSERMNRSGLVDKERIEET 621

Query: 358 GSINQSLLTLGRVINSLADKSA--HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
             IN+SL ++G VI++L   S   HIPFR +KLT LL+ SL G++KT+++ T+SP+  + 
Sbjct: 622 KQINKSLSSVGDVIHALRQGSGSLHIPFRNTKLTYLLKHSLQGSSKTLMLVTVSPSNSSR 681

Query: 416 EETCSTLEYASKA 428
            ET ++L +A+K 
Sbjct: 682 NETMNSLRFATKV 694

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 18/112 (16%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  D S + VF +  E L    + G+N  +  YG T +GKTYTM          
Sbjct: 408 FQFDKIFNYDESNRQVFGEVKE-LVQSALDGHNVCIFTYGQTGSGKTYTM---------- 456

Query: 139 DVNGQAGIAPRILVKLFEC------LQDDYVVKCSFVELYNEDLRDLLSEGQ 184
            +N + GI P  L  + +       L   Y +K  FVE+YN+ + DLL++G+
Sbjct: 457 -LNEEDGIIPSTLDHIIDWTSSMKKLGWQYGLKIKFVEIYNDRIFDLLNDGK 507

>KLLA0A01606g Chr1 (139355..141664) [2310 bp, 769 aa] {ON} similar
           to uniprot|P53086 Saccharomyces cerevisiae YGL216W KIP3
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 769

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 61/146 (41%), Positives = 86/146 (58%), Gaps = 12/146 (8%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKK-----FKDDLYRLSKINLVDLAGSENVNKAGALNLRA 354
           + T  N+ SSRSH +  I + +       K D    + ++++DLAGSE          R 
Sbjct: 270 SPTDANETSSRSHAVLQIHVAQMNRTADIKQD-QTFATLSIIDLAGSERAAVTKNRGERL 328

Query: 355 KESGSINQSLLTLGRVINSLADKS------AHIPFRESKLTRLLQDSLGGNTKTVLIATI 408
            E  +IN+SLL LG  IN+L   S       H+P+R+SKLTRLL+ SLGGN KTV+I  +
Sbjct: 329 LEGANINRSLLALGNCINALCVSSTRTGFSCHVPYRDSKLTRLLKFSLGGNCKTVMIVCV 388

Query: 409 SPAKIAAEETCSTLEYASKAKNIKNK 434
           SP+    +ET +TL+YA++AK IK K
Sbjct: 389 SPSSGHYDETLNTLKYANRAKEIKTK 414

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 59/107 (55%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D+++  D +Q+ V+E+   PL    + G+N T+  YG T  GKT+T++G  E     
Sbjct: 124 FIFDRIFDMDVTQQEVYENTTRPLLDSVLDGFNGTVFAYGATGCGKTFTISGTSE----- 178

Query: 139 DVNGQAGIAPRILVKLF---ECLQD--DYVVKCSFVELYNEDLRDLL 180
               Q GI    + +LF   E L+D   + ++ SF+E+YNE + DLL
Sbjct: 179 ----QPGIIFLTMQELFIRMEQLKDTKKFQLQLSFLEIYNEQIHDLL 221

>TBLA0C03940 Chr3 complement(946819..949038) [2220 bp, 739 aa] {ON}
           Anc_3.479 YPR141C
          Length = 739

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 94/175 (53%), Gaps = 13/175 (7%)

Query: 271 YIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLY-KKFKDDLYR 329
           Y+ N+K F I    +              ++T LN  SSRSH IF I L     K +   
Sbjct: 563 YVTNIKRFKIENISDTIGLINKSKIKRMTSSTGLNSHSSRSHGIFIIYLEGYNHKTNEKC 622

Query: 330 LSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSL------------ADK 377
           +SK+NLVDLAGSE +N +     R KE+ SIN+SL  LG VI++L              K
Sbjct: 623 ISKLNLVDLAGSERINFSKVQGDRLKETQSINKSLSCLGDVIHALNRGNKNHLNSNDLQK 682

Query: 378 SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIK 432
           + HIPFR SKLT LL+ SL G++KT++   +S  +    ET ++L +A+K  N K
Sbjct: 683 TRHIPFRNSKLTYLLKYSLIGDSKTLMFVNVSSNEAHLNETINSLRFATKVNNTK 737

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (45%), Gaps = 18/109 (16%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           ++  D V+  D     VF +  E L    + GYN  +  YG T +GKTYTM         
Sbjct: 443 SFEFDHVFKQDEGNSEVFNEI-EQLIQSALDGYNVCIFAYGQTGSGKTYTM--------- 492

Query: 138 GDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
             +N   G+ P  +  +F  +        +Y V C F+ELYNE++ DL 
Sbjct: 493 --LNPNDGVIPMTIKYIFNSMDSLKKNGWEYNVSCEFIELYNENIIDLF 539

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 47/182 (25%), Positives = 87/182 (47%), Gaps = 28/182 (15%)

Query: 477 YKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSV 536
           YKE    L + ++++   +   D+L  +N LL  E  S   + DSL S       ++KS 
Sbjct: 93  YKEYSLQLKSLQSDVNNHQSVRDNLSNKNSLLENEILSLKFKLDSLSSNNSVFVEKVKSK 152

Query: 537 TNKLAQTNTQNTKLSEQVTD-----MNRIQT----ELKSLIEVYQQKHETSKHKFQRL-- 585
            N+L + N       + + D     +N++++    EL S+I  Y++K+E++  KF +L  
Sbjct: 153 ENQLKELNEIKILKEKNIVDNHHLEINQLKSTHDNELSSIIRQYKKKYEST--KFSKLES 210

Query: 586 -------LKDELATLTAKILSQWDTLKNVNS-----GNYQIHTHIDSIRGEVMNLLETTK 633
                  + ++L+ ++  I+   +  KN+NS      N Q  ++ID ++       E TK
Sbjct: 211 FGNQKKDINEKLSVISKDII---NNEKNLNSELRKVDNNQSKSNIDWLKENQTQYNEKTK 267

Query: 634 EN 635
           EN
Sbjct: 268 EN 269

>YPR141C Chr16 complement(815734..817923) [2190 bp, 729 aa] {ON}
           KAR3Minus-end-directed microtubule motor that functions
           in mitosis and meiosis, localizes to the spindle pole
           body and localization is dependent on functional Cik1p,
           required for nuclear fusion during mating; potential
           Cdc28p substrate
          Length = 729

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 4/133 (3%)

Query: 300 ATTKLNDVSSRSHTIFTITLY-KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF I L     K   +    +NLVDLAGSE +N +  +  R +E+ 
Sbjct: 588 ASTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQ 647

Query: 359 SINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT++   ISP+    
Sbjct: 648 NINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHI 707

Query: 416 EETCSTLEYASKA 428
            ET ++L +ASK 
Sbjct: 708 NETLNSLRFASKV 720

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 18/117 (15%)

Query: 70  IEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMT 129
           I+   Q   +  DK++    +   VF++  + L    + GYN  +  YG T +GKT+TM 
Sbjct: 427 IQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM- 484

Query: 130 GDVEMGAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
                     +N   GI P  +  +F  +        DY V C F+E+YNE++ DLL
Sbjct: 485 ----------LNPGDGIIPSTISHIFNWINKLKTKGWDYKVNCEFIEIYNENIVDLL 531

>ZYRO0B04290g Chr2 (353283..355478) [2196 bp, 731 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 731

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 85/140 (60%), Gaps = 8/140 (5%)

Query: 299 VATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSK---INLVDLAGSENVNKAGALNLRAK 355
            A+T  N+ SSRSH++F I L  K  + L        +NLVDLAGSE +N +  L  R +
Sbjct: 576 TASTSANERSSRSHSVFIIFL--KGSNHLTGEQSDGILNLVDLAGSERINSSQVLGERLR 633

Query: 356 ESGSINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAK 412
           E+ +IN+SL  LG V+++L    A   HIPFR SKLT LLQ SL GN+KT++   IS  +
Sbjct: 634 ETQNINKSLSCLGDVVHALGSNDAAKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISACE 693

Query: 413 IAAEETCSTLEYASKAKNIK 432
               ET ++L +ASK  + K
Sbjct: 694 SHLNETLNSLRFASKVNSTK 713

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 61/117 (52%), Gaps = 18/117 (15%)

Query: 77  KTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGA 136
           + +  D+++  + + + VFE+  + L    + GYN  +  YG T +GKTYTM        
Sbjct: 426 QNFKFDRIFDQNETNENVFEEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-------- 476

Query: 137 EGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQDDF 187
              +N + GI P  +  +F  +++      +Y + C F+E+YNE++ DLL   QDD 
Sbjct: 477 ---LNPRNGIIPATISHIFSWIENLKERGWNYEINCQFIEIYNENIADLLRSDQDDI 530

>Skud_16.435 Chr16 complement(769308..771497) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 82/133 (61%), Gaps = 4/133 (3%)

Query: 300 ATTKLNDVSSRSHTIFTITLY-KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF I L     K        +NLVDLAGSE +N +  +  R +E+ 
Sbjct: 588 ASTASNEHSSRSHSIFMIHLSGSNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQ 647

Query: 359 SINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT++   ISP+    
Sbjct: 648 NINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHI 707

Query: 416 EETCSTLEYASKA 428
            ET ++L +ASK 
Sbjct: 708 NETLNSLRFASKV 720

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 65/130 (50%), Gaps = 25/130 (19%)

Query: 68  SGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYT 127
           + I++  Q   +  DK++   ++ + VF++  + L    + GYN  +  YG T +GKT+T
Sbjct: 425 TKIQSTTQVHEFKFDKIFDQQNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFT 483

Query: 128 M--TGDVEMGAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDL 179
           M  TGD             GI P  +  +F  +        DY V C F+E+YNE++ DL
Sbjct: 484 MLNTGD-------------GIIPSTISHIFSWINKLKTKGWDYKVNCEFIEIYNENIVDL 530

Query: 180 L---SEGQDD 186
           L   S G+DD
Sbjct: 531 LRNDSIGKDD 540

>Suva_16.469 Chr16 complement(811946..814141) [2196 bp, 731 aa] {ON}
           YPR141C (REAL)
          Length = 731

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 82/133 (61%), Gaps = 4/133 (3%)

Query: 300 ATTKLNDVSSRSHTIFTITLYK-KFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF I L     K        +NLVDLAGSE +N +  +  R +E+ 
Sbjct: 587 ASTASNEHSSRSHSIFIIHLSGLNAKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQ 646

Query: 359 SINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT++   ISP+    
Sbjct: 647 NINKSLSCLGDVIHALGQPDSAKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHI 706

Query: 416 EETCSTLEYASKA 428
            ET ++L +ASK 
Sbjct: 707 NETLNSLRFASKV 719

 Score = 64.7 bits (156), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 18/112 (16%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           Q   +  DK++   ++ + VF++  + L    + GYN  +  YG T +GKT+TM      
Sbjct: 432 QVHEFKFDKIFDQRNTNEDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------ 484

Query: 135 GAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
                +N   GI P  +  +F  +        DY V C F+E+YNE++ DLL
Sbjct: 485 -----LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>TDEL0F03640 Chr6 complement(666365..668479) [2115 bp, 704 aa] {ON}
           Anc_3.479 YPR141C
          Length = 704

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/137 (45%), Positives = 83/137 (60%), Gaps = 4/137 (2%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKI-NLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF + L  +      R   I NLVDLAGSE +N +  +  R +E+ 
Sbjct: 560 ASTACNERSSRSHSIFIVHLSGENVLTGERSHGILNLVDLAGSERINTSQVIGERLRETQ 619

Query: 359 SINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           SIN+SL  LG VI++L    A   HIPFR SKLT LLQ SL GN+KT++   IS      
Sbjct: 620 SINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISGNPNHT 679

Query: 416 EETCSTLEYASKAKNIK 432
            ET ++L +ASK  + K
Sbjct: 680 NETLNSLRFASKVNSTK 696

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 55/120 (45%), Gaps = 24/120 (20%)

Query: 67  GSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTY 126
           GSG       + +  D+++    +   VF++  + L    + GYN  +  YG T +GKTY
Sbjct: 397 GSG------PQIFKFDRIFNEKETNYDVFQEIGQ-LVQSSLDGYNVCIFAYGQTGSGKTY 449

Query: 127 TMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
           TM           +N   GI P  +  +F   ++       Y V C FVE+YNE + DLL
Sbjct: 450 TM-----------LNPTDGIIPATITHIFNWTKNLKERGWRYDVSCQFVEIYNETIADLL 498

>NCAS0F03470 Chr6 complement(695163..697259) [2097 bp, 698 aa] {ON}
           Anc_3.479 YPR141C
          Length = 698

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 85/139 (61%), Gaps = 8/139 (5%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKK---FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKE 356
           A+T  N+ SSRSH+IF I L        ++ Y +  +NLVDLAGSE +N +     R +E
Sbjct: 559 ASTGSNEHSSRSHSIFIIHLRGSNSLTGEESYGI--LNLVDLAGSERINSSQVTGDRLRE 616

Query: 357 SGSINQSLLTLGRVINSLADK---SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           + +IN+SL  LG VI++L        HIPFR SKLT LLQ SL GN+KT++   ISP+  
Sbjct: 617 TQNINRSLSCLGDVIHALGGPDQGKRHIPFRNSKLTYLLQYSLTGNSKTLMFVNISPSAN 676

Query: 414 AAEETCSTLEYASKAKNIK 432
              ET ++L +ASK  + K
Sbjct: 677 HINETINSLRFASKVNSTK 695

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 18/114 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++    +   VF++  + L    + GYN  +  YG T +GKTYTM          
Sbjct: 404 FKFDKIFNQTDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 452

Query: 139 DVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQDD 186
            +  + GI P  +  +F   ++       Y + C FVE+YNE++ DLL    +D
Sbjct: 453 -LRPKDGIIPSTIKHIFNWTKNLKERGWHYEIDCQFVEIYNENIIDLLRSSSND 505

>Smik_16.388 Chr16 complement(687227..689416) [2190 bp, 729 aa] {ON}
           YPR141C (REAL)
          Length = 729

 Score = 98.6 bits (244), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 82/133 (61%), Gaps = 4/133 (3%)

Query: 300 ATTKLNDVSSRSHTIFTITLY-KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
           A+T  N+ SSRSH+IF I L     K        +NLVDLAGSE +N +  +  R +E+ 
Sbjct: 588 ASTASNEHSSRSHSIFIIHLSGSNTKTGAQSYGTLNLVDLAGSERINISQVVGDRLRETQ 647

Query: 359 SINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAA 415
           +IN+SL  LG VI++L    +   HIPFR SKLT LLQ SL G++KT++   ISP+    
Sbjct: 648 NINKSLSCLGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHI 707

Query: 416 EETCSTLEYASKA 428
            ET ++L +ASK 
Sbjct: 708 NETLNSLRFASKV 720

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 18/112 (16%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           Q   +  DK++    +   VF++  + L    + GYN  +  YG T +GKT+TM      
Sbjct: 432 QVHEFKFDKIFDQKDTNADVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTFTM------ 484

Query: 135 GAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
                +N   GI P  +  +F  +        DY V C F+E+YNE++ DLL
Sbjct: 485 -----LNPGDGIIPSTISHIFNWINKLKTKGWDYEVNCEFIEIYNENIVDLL 531

>AGR253W Chr7 (1218744..1220873) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR141C (KAR3)
          Length = 709

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 90/168 (53%), Gaps = 4/168 (2%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLY-KKFKDDL 327
           G YI N+    +++  +              A T+ N+ SSRSH++F + +  +      
Sbjct: 538 GTYITNVTRMKMTSTSQVDTILKKASKMRSTAATRSNERSSRSHSVFMVHINGRNLHTGE 597

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA---HIPFR 384
               K+NLVDLAGSE +N +     R +E+ +IN+SL  LG VI +L    A   +IPFR
Sbjct: 598 TSQGKLNLVDLAGSERINSSAVTGERLRETQNINKSLSCLGDVIYALNTPDAGKRYIPFR 657

Query: 385 ESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIK 432
            SKLT LLQ SL G++KT++   I P      ET ++L +ASK  + K
Sbjct: 658 NSKLTYLLQYSLVGDSKTLMFVNIPPDPNHISETLNSLRFASKVNSTK 705

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 58/116 (50%), Gaps = 18/116 (15%)

Query: 71  EAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTG 130
           E ++ +  +  D ++ P  + K +FE+  + L    + GYN  +  YG T +GKTYTM  
Sbjct: 407 EGRILSYNFQFDMIFEPSHTNKEIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM-- 463

Query: 131 DVEMGAEGDVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLL 180
                    +N   G+ P  L  +F+   +      +Y ++C ++E+YNE + DLL
Sbjct: 464 ---------LNAGDGMIPMTLSHIFKWTANLKERGWNYEMECEYIEIYNETILDLL 510

>KLLA0B10956g Chr2 (958985..961057) [2073 bp, 690 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 690

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 59/141 (41%), Positives = 87/141 (61%), Gaps = 12/141 (8%)

Query: 299 VATTKLNDVSSRSHTIFTITLYK------KFKDDLYRLSKINLVDLAGSENVNKAGALNL 352
           +A T  N+ SSRSH++FTI ++       +  D +     +NLVDLAGSE ++ +     
Sbjct: 551 IAATNSNERSSRSHSVFTIRIHGTNSITGEASDGV-----LNLVDLAGSERIDTSNVTGD 605

Query: 353 RAKESGSINQSLLTLGRVINSLADKS-AHIPFRESKLTRLLQDSLGGNTKTVLIATISPA 411
           R +E+ +IN+SL  LG VI +L  K   HIPFR SKLT LLQ SL G++KT++   +SP+
Sbjct: 606 RLRETQNINKSLSCLGDVIYALNGKDMKHIPFRNSKLTYLLQYSLIGDSKTLMFVNVSPS 665

Query: 412 KIAAEETCSTLEYASKAKNIK 432
               +ET ++L +ASK  + K
Sbjct: 666 SNHVKETLNSLRFASKVNSTK 686

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 20/126 (15%)

Query: 63  NTSGGSGIEAQLQAKT--YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMT 120
           N +G   IE   + +   +  DKV+  ++S + VFE+  + L    + GYN  +  YG T
Sbjct: 386 NRNGSQAIEISNEDRNSRFLFDKVFSSNASNRDVFEEVGQ-LIQSSLDGYNVCIFAYGQT 444

Query: 121 STGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFEC---LQD---DYVVKCSFVELYNE 174
            +GKTYTM  D +           G+ P  L  +F+    L++   DY  +  F+E+YNE
Sbjct: 445 GSGKTYTMMNDPD-----------GVIPMTLDHIFDWTHLLKERGWDYSFEAQFIEIYNE 493

Query: 175 DLRDLL 180
            + DLL
Sbjct: 494 QIVDLL 499

>Kpol_1004.25 s1004 (54983..56503) [1521 bp, 506 aa] {ON}
           (54983..56503) [1521 nt, 507 aa]
          Length = 506

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 99/193 (51%), Gaps = 24/193 (12%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328
            +YI+N+ +  +S   +               +T +N  SSRSH I +IT+ K+   DL 
Sbjct: 188 SMYIENITEIEVSNIDQMIKCVKMGFRNRTTRSTNMNVNSSRSHAIVSITI-KRTDIDLN 246

Query: 329 RLSKI------NLVDLAGSENVNKA-GALNLRAKESGSINQSLLTLGRVINSLADK---- 377
             S I        VDLAGSE         N R KE  SIN+SL TL RV+ SL  +    
Sbjct: 247 TNSSIISDSICRFVDLAGSERSTATQNCHNDRLKEGNSINKSLSTLRRVLTSLKKREELK 306

Query: 378 -------SAH---IPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASK 427
                  SAH   +PFRES LT +L+D+LGGN+KT +IA ISP     EE+ STL YA  
Sbjct: 307 YNSNSNSSAHNIVVPFRESLLTWILKDNLGGNSKTCIIACISPTNF--EESASTLRYADI 364

Query: 428 AKNIKNKPQLGSF 440
           A+ IK    + ++
Sbjct: 365 AQTIKTNSIINTY 377

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 56/123 (45%), Gaps = 24/123 (19%)

Query: 75  QAKTYTVDKVY----GPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTG 130
           + K +  DK +    G  +SQ   ++        D + GYNC +L YG T +GKTYTM G
Sbjct: 53  EEKIFKFDKCFDEGFGKINSQSEFYKGSINHFVKDALNGYNCCILAYGQTGSGKTYTMMG 112

Query: 131 DVEMGAEGDVNGQAGIAPRILVKLFECLQ-------------DDYVVKCSFVELYNEDLR 177
           + +       N   G+ PR    LF  ++              +Y V CS  E+YNE + 
Sbjct: 113 ESK-------NDTRGVIPRFCEDLFHEIESIKIKDSSDLSQRSEYKVVCSIFEIYNEQII 165

Query: 178 DLL 180
           DLL
Sbjct: 166 DLL 168

>SAKL0F03168g Chr6 (261405..263525) [2121 bp, 706 aa] {ON} similar
           to uniprot|P17119 Saccharomyces cerevisiae YPR141C KAR3
           Minus-end-directed microtubule motor that functions in
           mitosis and meiosis localizes to the spindle pole body
           and localization is dependent on functional Cik1p
           required for nuclear fusion during mating potential
           Cdc28p substrate
          Length = 706

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/134 (44%), Positives = 83/134 (61%), Gaps = 6/134 (4%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSK--INLVDLAGSENVNKAGALNLRAKES 357
           A T  N+ SSRSH++F I L + +  +     +  +NLVDLAGSE +N +     R +E+
Sbjct: 565 AATGSNERSSRSHSVFIIKL-RGYNSNTGEECQGTLNLVDLAGSERINASQVTGDRLRET 623

Query: 358 GSINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIA 414
            +IN+SL  LG VI++LA   A   HIPFR SKLT LLQ SL G++KT++   ISP    
Sbjct: 624 QNINKSLSCLGDVIHALASPDASKRHIPFRNSKLTYLLQYSLLGDSKTLMFVNISPCLDH 683

Query: 415 AEETCSTLEYASKA 428
             ET ++L +ASK 
Sbjct: 684 FNETLNSLRFASKV 697

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 60/120 (50%), Gaps = 18/120 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++ P++S   +FE+  + L    + GYN  +  YG T +GKTYTM          
Sbjct: 413 FKFDKIFDPENSNDDIFEEIRQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 461

Query: 139 DVNGQAGIAPRILVKLFECLQ------DDYVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192
            ++ Q G+ P  L  +F+ +        +Y +   F+E+YNE + DLL    +D  + TE
Sbjct: 462 -LHPQNGMIPSTLDHIFQWIHLLKERGWEYEISSQFIEIYNETIIDLLRGLNNDTEDITE 520

>NDAI0B05770 Chr2 complement(1400232..1402523) [2292 bp, 763 aa]
           {ON} Anc_3.479
          Length = 763

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/147 (43%), Positives = 88/147 (59%), Gaps = 17/147 (11%)

Query: 299 VATTKLNDVSSRSHTIFTITLYKKFKDDL-----YRLSKINLVDLAGSENVNKAGALNLR 353
            A+T  N+ SSRSH+IF I L  K  +++     Y +  +NLVDLAGSE +N +     R
Sbjct: 613 TASTLSNEHSSRSHSIFIIHL--KGTNEITGEKSYGI--LNLVDLAGSERINSSQVTGER 668

Query: 354 AKESGSINQSLLTLGRVINSLAD--------KSAHIPFRESKLTRLLQDSLGGNTKTVLI 405
            +E+ +IN+SL  LG VI++L          K  HIPFR SKLT LLQ SL GN+KT++ 
Sbjct: 669 LRETQNINRSLSCLGDVIHALTGSEKDKENAKKRHIPFRNSKLTYLLQYSLIGNSKTLMF 728

Query: 406 ATISPAKIAAEETCSTLEYASKAKNIK 432
             ISP+     ET ++L +ASK  + K
Sbjct: 729 VNISPSINYVNETLNSLRFASKVNSAK 755

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 18/114 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++  + +   VF++  + L    + GYN  +  YG T +GKTYTM          
Sbjct: 453 FKFDKIFNQNETNDDVFKEVGQ-LVQSSLDGYNVCIFAYGQTGSGKTYTM---------- 501

Query: 139 DVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSEGQDD 186
            ++ + GI P  +  +F    +       Y ++C FVE+YNE++ DLL    D+
Sbjct: 502 -LHPKDGIIPATISHIFNWTNNLKERGWKYEIECEFVEIYNENIVDLLRNEHDN 554

>ZYRO0F07414g Chr6 (600148..602112) [1965 bp, 654 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 654

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 84/157 (53%), Gaps = 21/157 (13%)

Query: 302 TKLNDVSSRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           T  N  SSRSH I  I L K   K+     S ++L DLAGSE   KA   N R KE   I
Sbjct: 294 TTYNTRSSRSHAIVMIRLTKTDLKEGTSVSSTLSLCDLAGSE---KAVTHNERRKEGAFI 350

Query: 361 NQSLLTLGRVINSLADKS-------------AHIPFRESKLTRLLQDSLGGNTKTVLIAT 407
           N+SLL LG VI+ L+ +S              HIP+R+SKLTR+LQ +L GN     I T
Sbjct: 351 NKSLLALGTVISKLSAESTSHRNGGSSSPVTGHIPYRDSKLTRILQPALSGNGVVTTICT 410

Query: 408 ISPAKIAAEETCSTLEYASKAKNIK----NKPQLGSF 440
           I     A+ ET +TL +AS+AKN+      KP L S 
Sbjct: 411 IDTRPDASSETLNTLRFASRAKNVSLHIFRKPLLPSM 447

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 52/109 (47%), Gaps = 16/109 (14%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    +   V+   ++P+      G N T+  YGMT +GKT+TM G  E     
Sbjct: 122 FKYDHVFKTACNNVEVYAQTSKPMIDRVFEGLNATVFAYGMTGSGKTFTMAGTEET---- 177

Query: 139 DVNGQAGIAPRILVKLF-----ECLQDD--YVVKCSFVELYNEDLRDLL 180
                 G+ P  +  L+     E LQ D  + +  S++E+YNE + DLL
Sbjct: 178 -----LGLIPLSVAYLYSRVMEESLQGDSRFEIAVSYLEIYNEKIYDLL 221

>Kwal_26.8806 s26 (950736..952883) [2148 bp, 715 aa] {ON} YPL155C
           (KIP2) - kinesin-related protein [contig 68] FULL
          Length = 715

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 128/252 (50%), Gaps = 23/252 (9%)

Query: 302 TKLNDVSSRSHTIFTITLY-KKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           T  N  SSRSH I T+ L            S ++L DLAGSE   +A   + R KE   I
Sbjct: 310 TDYNTRSSRSHAIVTLNLACTDLVSGAETTSTLSLCDLAGSE---RAAGQHERRKEGAFI 366

Query: 361 NQSLLTLGRVINSLADKS---------AHIPFRESKLTRLLQDSLGGNTKTVLIATISPA 411
           N+SLL LG VI+ L+  S         +HIP+R+SKLTR+LQ +L G +    I TI   
Sbjct: 367 NKSLLALGTVISKLSASSMHTTPSFGNSHIPYRDSKLTRILQPALSGESIVTTICTIDTR 426

Query: 412 KIAAEETCSTLEYASKAKNI-----KNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKS 466
             A  ET +T+ +AS+AKN+     +N+ +L     KD L+ ++ ++L + +  +W  K 
Sbjct: 427 LDAMSETVNTIRFASRAKNVSMTVKRNEAELAHE--KDALIHNLRRQLDEQQELIWELKR 484

Query: 467 KEGIYVSQKNYKEMVDDLDNFKTELTELKRTND---SLVQENELLGKEKKSGAERADSLK 523
            +       +   +  + D  K +L   +R  D   + VQ+++L+   +         L+
Sbjct: 485 NQEKCEQTPDLYLLRKESDALKRKLQLCERLLDKDEAAVQDDQLVEIVEMLPPAVGALLE 544

Query: 524 SELDNLRSQLKS 535
           S++  L+SQL+S
Sbjct: 545 SKIQGLQSQLRS 556

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 57/110 (51%), Gaps = 15/110 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+ P S+   V++   +P+     +GYN  +  YGMT +GKT+TM+G  E     
Sbjct: 139 FKFDNVFRPQSNNYEVYQQIGKPMIDRLFQGYNAIIFAYGMTGSGKTFTMSGTPE----- 193

Query: 139 DVNGQAGIAPRILVKLFECLQDD------YVVKCSFVELYNEDLRDLLSE 182
               +AG+    +  +F  +  +      + V  S++E+YNE + DLL++
Sbjct: 194 ----EAGLISLSVEHIFAQIMSESLANKSFQVTVSYLEIYNEKIYDLLNQ 239

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 68/191 (35%), Positives = 101/191 (52%), Gaps = 8/191 (4%)

Query: 249 DDMSLNANAG--GKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLND 306
           DD   N++ G   K H         ++NL+   +++ +               A+T  N+
Sbjct: 481 DDNKSNSSNGPRHKIHHDDASKTTVVENLETITLTSKESVDAVLKNAMKLRATASTSSNE 540

Query: 307 VSSRSHTIFTITLYKKFKDDL--YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSL 364
            SSRSH+IF I ++    + L   R   +NL+DLAGSE ++ +   + R KE+  IN+SL
Sbjct: 541 RSSRSHSIFIIKIHG-INEGLGEERNGLLNLIDLAGSERLSVSKVQSERIKETQHINKSL 599

Query: 365 LTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCST 421
             LG V+NSL    A   HI FR+SKLT LLQ SL GN+KT+++  IS +     ET  +
Sbjct: 600 SFLGNVMNSLGSPDATTRHISFRDSKLTYLLQYSLTGNSKTLMVVNISSSSDHINETIKS 659

Query: 422 LEYASKAKNIK 432
           L +A K  + K
Sbjct: 660 LNFAKKVNSTK 670

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 67/137 (48%), Gaps = 24/137 (17%)

Query: 66  GGSGIEAQ----LQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTS 121
           G   IE +    L    Y+ DKV+    + + +F++ +E L    + G+N  +  YG T 
Sbjct: 366 GSQSIEVEKNCNLTPIKYSFDKVFSQTDTNQEIFKEVSE-LIQSSLDGFNVCIFAYGQTG 424

Query: 122 TGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDD------YVVKCSFVELYNED 175
           +GKT+TM           +N + GI P     +F+ + +       Y V C F+E+YN++
Sbjct: 425 SGKTFTM-----------LNPKDGIIPSTAKHIFDWIDNSAKNGWKYNVTCEFLEIYNDE 473

Query: 176 LRDLLS--EGQDDFSNG 190
           + DLL   + + + SNG
Sbjct: 474 IYDLLRSDDNKSNSSNG 490

>KLTH0F14498g Chr6 complement(1188459..1190567) [2109 bp, 702 aa]
           {ON} similar to uniprot|P17119 Saccharomyces cerevisiae
           YPR141C KAR3 Minus-end-directed microtubule motor that
           functions in mitosis and meiosis localizes to the
           spindle pole body and localization is dependent on
           functional Cik1p required for nuclear fusion during
           mating potential Cdc28p substrate
          Length = 702

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 81/139 (58%), Gaps = 6/139 (4%)

Query: 299 VATTKLNDVSSRSHTIFTITL--YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKE 356
            A T  N  SSRSH++F I L  Y     +      +NLVDLAGSE ++       R +E
Sbjct: 560 TAATVANSRSSRSHSVFIIKLDGYNTISGE-KSTGTLNLVDLAGSERIHSLQPQAERLRE 618

Query: 357 SGSINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           + +IN+SL  LG VI++L    A   HIPFR SKLT LLQ SL G++KT++   +SP   
Sbjct: 619 TQNINKSLSCLGDVIHALGSADASKRHIPFRNSKLTYLLQYSLMGDSKTLMFVNVSPCAN 678

Query: 414 AAEETCSTLEYASKAKNIK 432
           +  ET ++L +A+K  + K
Sbjct: 679 SMLETLNSLRFAAKVNSTK 697

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 18/114 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +T D+ +    +   VF +  + L    + GYN  +  YG T +GKT+TM          
Sbjct: 409 FTFDRCFSAQETNGDVFSEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTFTM---------- 457

Query: 139 DVNGQAGIAPRILVKLF---ECLQD---DYVVKCSFVELYNEDLRDLLSEGQDD 186
            +N   GI P  L  +F   E L++    Y +   FVE+YNE+++DL  E   D
Sbjct: 458 -LNPNDGIIPSTLNHIFLWVEKLKELGWVYEITSQFVEIYNENIKDLFKENDAD 510

>Ecym_4407 Chr4 (846516..848651) [2136 bp, 711 aa] {ON} similar to
           Ashbya gossypii AGR253W
          Length = 711

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 83/138 (60%), Gaps = 6/138 (4%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDLYRLS--KINLVDLAGSENVNKAGALNLRAKES 357
           A T+ N+ SSRSH++F + +     D    +S  K+NL+DLAGSE +N +     R +E+
Sbjct: 571 ACTRSNERSSRSHSVFMVHI-NGHNDQTGEVSHGKLNLIDLAGSERINSSLVTGDRLRET 629

Query: 358 GSINQSLLTLGRVINSLADKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIA 414
            +IN+SL  LG VI +L    A   HIPFR SKLT LLQ SL G++KT++   I   +  
Sbjct: 630 QNINKSLSCLGDVIYALNSPDAAKRHIPFRNSKLTYLLQYSLIGDSKTLMFVNIPSDQKH 689

Query: 415 AEETCSTLEYASKAKNIK 432
             ET ++L +ASK  + K
Sbjct: 690 TNETLNSLRFASKVNSTK 707

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 18/110 (16%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DK++ P ++   VF++  + L    + GYN  +  YG T +GKTYTM          
Sbjct: 417 FHFDKIFEPHNTNADVFQEICQ-LVQCSLDGYNVCIFAYGQTGSGKTYTM---------- 465

Query: 139 DVNGQAGIAPRILVKLFECLQD------DYVVKCSFVELYNEDLRDLLSE 182
            +N   G+ P  L  +F+  +D       Y + C ++E+YNE + DLL E
Sbjct: 466 -LNPGDGMIPMTLSHIFQWTEDLMEHGWRYEMDCEYIEIYNETILDLLRE 514

>SAKL0H06490g Chr8 complement(571300..573273) [1974 bp, 657 aa] {ON}
           similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155C KIP2 Kinesin-related motor protein involved in
           mitotic spindle positioning
          Length = 657

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 63/173 (36%), Positives = 89/173 (51%), Gaps = 13/173 (7%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITL-YKKFKDDL 327
           G+ +  L +  + T+++                T  N  SSRSH I  I L     K  L
Sbjct: 272 GVKVIGLTEQEVDTSEDVMKWIALGNSNRKTGETDFNSRSSRSHAIVLIRLTCTDLKSGL 331

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA-------- 379
              S ++L DLAGSE   +A A   R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 332 ETTSTLSLCDLAGSE---RATAQRERRKEGAFINKSLLALGTVISKLSAESTQNMGVGGG 388

Query: 380 -HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
            HIP+R+SKLTR+LQ +L G+     I T+     ++ ET +T+ +AS+AKNI
Sbjct: 389 HHIPYRDSKLTRILQPALSGDGIVTTICTVDAHAESSAETINTIRFASRAKNI 441

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 63/122 (51%), Gaps = 15/122 (12%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           ++ D V+ P +    V+E+ A P+     +G+N T+  YGMT +GKT+TM+G        
Sbjct: 147 FSFDHVFHPTNDNFAVYEETARPMIEKLFQGFNSTIFAYGMTGSGKTFTMSG-------- 198

Query: 139 DVNGQAGIAPRILVKLFECLQDD------YVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192
             + + G+ P  +  +F  +         + VK S++E+YNE + DLL+      S GT+
Sbjct: 199 -TSNEPGLIPLSVNDIFSNIMSKSLNNQRFDVKVSYLEIYNEKIYDLLNYQVSKGSFGTK 257

Query: 193 NS 194
            +
Sbjct: 258 TT 259

>NCAS0C01350 Chr3 complement(246839..248806) [1968 bp, 655 aa] {ON}
           Anc_8.678
          Length = 655

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 65/178 (36%), Positives = 91/178 (51%), Gaps = 18/178 (10%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328
           G+ +  L++    +++E              A T  N  SSRSH I  I L      D  
Sbjct: 278 GVRVMGLREQRCESSEELMKWIRRGDSHRKTAETDYNARSSRSHAIVLIRLTNTNVIDGT 337

Query: 329 RLSK-INLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSL------------- 374
            +S  ++L DLAGSE   +A     R KE   IN+SLL LG VI+ L             
Sbjct: 338 SISSTLSLCDLAGSE---RATGQQERRKEGAFINKSLLALGTVISKLSAESTAASHGNSP 394

Query: 375 -ADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
            A+ + HIP+R+SKLTR+LQ +L G++    I TI   K +A ET +TL +AS+AKN+
Sbjct: 395 NANGNGHIPYRDSKLTRILQPALSGDSIVTTICTIDTQKESAAETLNTLRFASRAKNV 452

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 37/109 (33%), Positives = 56/109 (51%), Gaps = 12/109 (11%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D VY P  S   ++E   +P+     +G+N T+  YGMT +GKTYTM     MG+ G
Sbjct: 135 FKFDHVYSPHVSNLEIYESINKPMIDKLFQGFNATVFAYGMTGSGKTYTM-----MGSGG 189

Query: 139 DVNGQAGIAPRILVKLFECL-------QDDYVVKCSFVELYNEDLRDLL 180
           D     G+ P  +  LF  +       +  + V  S++E+YNE + DLL
Sbjct: 190 DGGDDDGLIPLSVSYLFSKVIEVGLVGERKFDVLLSYLEIYNERIYDLL 238

>KLLA0D05951g Chr4 (509713..511719) [2007 bp, 668 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 668

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 134/271 (49%), Gaps = 39/271 (14%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFKDDLY 328
           G+ +  L + ++S+ KE                T  N  SSRSH +  I ++    D++ 
Sbjct: 235 GVKVVGLVERNVSSNKELMKCISIGDHNRKTGETDFNTRSSRSHAVVLIRVF--CTDEIT 292

Query: 329 R---LSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSA------ 379
               +S ++L DLAGSE   +A     R KE   IN+SLL LG VI+ L+ +S+      
Sbjct: 293 GEQVMSTLSLCDLAGSE---RATGQQERRKEGAYINKSLLALGTVISKLSMESSGLSTNV 349

Query: 380 -HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKPQLG 438
            HIP+R+SKLTR+LQ +L G++    I T+      + E+ +T+ +AS+AKNI       
Sbjct: 350 GHIPYRDSKLTRILQPALSGDSLVATICTVDTRPETSTESINTIRFASRAKNI------- 402

Query: 439 SFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEM---VDDLDNFKTELTELK 495
           S  +K            +  AD   +KS + I   +K  +E    +D+L   K  +    
Sbjct: 403 SLAVK------------RNEADSNVSKS-QLIQTLRKQVREQQITIDNLTRGKGFIGSGI 449

Query: 496 RTNDSLVQENELLGKEKKSGAERADSLKSEL 526
            ++ SL++ENELL K K    ER ++L+  +
Sbjct: 450 SSDTSLLRENELL-KMKVEHYERLETLEPSI 479

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 14/111 (12%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+ P+ +   V+E  A P+      G+NCT+  YGMT +GKTYTM+G        
Sbjct: 106 FNFDHVFSPEMNNDRVYETMALPMIDKLFEGFNCTIFAYGMTGSGKTYTMSGS------- 158

Query: 139 DVNGQAGIAPRILVKLFECL-----QDDYVVKCSFVELYNEDLRDLLSEGQ 184
                 GI P  +  +F+ +     +  + V+ S++E+YNE + DLL+  Q
Sbjct: 159 --KSGPGIIPMCVDTIFDRINVGLPRKKFTVRVSYLEIYNERIFDLLNLPQ 207

>KNAG0J01720 Chr10 (314395..316272) [1878 bp, 625 aa] {ON} Anc_8.678
           YPL155C
          Length = 625

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/179 (35%), Positives = 88/179 (49%), Gaps = 19/179 (10%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYK-KFKDDL 327
           G+ +  + +    TA+E                T  N  SSRSH I  + L      +  
Sbjct: 242 GVKVHGVLEQKCDTAEELMKWVSVGEAVRKTGKTDYNMRSSRSHAIIQVKLITTNLLNGT 301

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKS--------- 378
              + ++L DLAGSE   KA     R KE   IN+SLL LG VI+ L+ +S         
Sbjct: 302 THFNTLSLCDLAGSE---KASEQLERRKEGSFINKSLLALGTVISKLSAESNAHDSSRPS 358

Query: 379 ------AHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
                 +HIP+R+SKLTRLLQ +L  ++    I TI P K A  ET +TL +AS+AKN+
Sbjct: 359 SGSLNNSHIPYRDSKLTRLLQPALCNDSVVTAICTIDPTKEAMTETVNTLRFASRAKNV 417

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 51/107 (47%), Gaps = 14/107 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTG--DVEMGA 136
           +  D V+GP ++ + +F +    L      G N T+L YG T +GKTYTM G  D  +  
Sbjct: 127 FQFDHVFGPTATNEDLFAELGGGLVEKLFDGCNATLLAYGTTGSGKTYTMVGHNDGIVKM 186

Query: 137 EGDVNGQAGIAPRILVKLFECLQDDYV---VKCSFVELYNEDLRDLL 180
            GD          +  ++     +  V   V  S++E+YNE + DLL
Sbjct: 187 CGDC---------VFTRMLNAADERQVKRSVTVSYLEIYNEKICDLL 224

>YPL155C Chr16 complement(257216..259336) [2121 bp, 706 aa] {ON}
           KIP2Kinesin-related motor protein involved in mitotic
           spindle positioning, stabilizes microtubules by
           targeting Bik1p to the plus end; Kip2p levels are
           controlled during the cell cycle
          Length = 706

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/198 (34%), Positives = 93/198 (46%), Gaps = 35/198 (17%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYK-KFK 324
           +Q G+ +  L +    +++E             +  T  N  SSRSH I  I L     K
Sbjct: 299 SQYGVKVIGLTERRCESSEELLRWIAVGDKSRKIGETDYNARSSRSHAIVLIRLTSTNVK 358

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSL-ADK------ 377
           +   R S ++L DLAGSE   +A     R KE   IN+SLL LG VI+ L ADK      
Sbjct: 359 NGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKMNSVGS 415

Query: 378 ------------------------SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
                                   S HIP+R+SKLTRLLQ +L G++    I T+     
Sbjct: 416 NIPSPSASGSSSSSGNATNNGTSPSNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 475

Query: 414 AAEETCSTLEYASKAKNI 431
           AA ET +TL +AS+AKN+
Sbjct: 476 AAAETMNTLRFASRAKNV 493

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    +   V+E  ++P+    + G+N T+  YGMT +GKT+TM+G+ +     
Sbjct: 163 FKFDHVFASHCTNLEVYERTSKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLLSEGQDD 186
               + G+ P  +  LF  + +        + V  S++E+YNE + DLL  G ++
Sbjct: 218 ----ELGLIPLSVSYLFTNIMEQSMNGDKKFDVIISYLEIYNERIYDLLESGLEE 268

>Kpol_1013.7 s1013 (11880..13742) [1863 bp, 620 aa] {ON}
           (11880..13742) [1863 nt, 621 aa]
          Length = 620

 Score = 87.4 bits (215), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 83/145 (57%), Gaps = 19/145 (13%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKKFKDDL----YRLSKINLVDLAGSENVNKAGALNLRAK 355
           ++T  N  SSRSH I  I L      DL       S ++L DLAGSE V    A + R +
Sbjct: 261 SSTDFNTRSSRSHAIILIRL---ISSDLSSGEVVTSTLSLCDLAGSERVT---AQHERRQ 314

Query: 356 ESGSINQSLLTLGRVINSLADK---------SAHIPFRESKLTRLLQDSLGGNTKTVLIA 406
           E   IN+SLL LG VI+ L+ +         ++HIP+R+SKLTR+LQ +L GN+    I 
Sbjct: 315 EGSFINKSLLALGTVISKLSAEVNNSTESVNNSHIPYRDSKLTRILQPALSGNSIVTTIC 374

Query: 407 TISPAKIAAEETCSTLEYASKAKNI 431
           TI  +  A  E+ +TL +AS+AKN+
Sbjct: 375 TIDTSVDATNESVNTLRFASRAKNV 399

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 39/109 (35%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           YT D V+ PD+S   V+    +PL      G+N T+  YGMT +GKTYTM+G        
Sbjct: 104 YTYDNVFHPDASNFDVYAATCKPLIDKLFDGFNSTVFAYGMTGSGKTYTMSG-------- 155

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLL 180
            V+G AG+ P  +  ++  + D        Y    S++E+YNE + DLL
Sbjct: 156 -VDGNAGLIPLSVAYMYSKIFDSTIHENKKYDTLVSYLEIYNEKIYDLL 203

>NDAI0E02090 Chr5 complement(423630..425687) [2058 bp, 685 aa] {ON} 
          Length = 685

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 80/160 (50%), Gaps = 31/160 (19%)

Query: 300 ATTKLNDVSSRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESG 358
           A T  N  SSRSH I  I L     KD     S ++L DLAGSE   +A     R KE  
Sbjct: 311 AETDFNARSSRSHAIVLIRLTTSDMKDGTSISSTLSLCDLAGSE---RATGQQERRKEGA 367

Query: 359 SINQSLLTLGRVINSLADKS---------------------------AHIPFRESKLTRL 391
            IN+SLL LG VI+ L+ +S                            HIP+R+SKLTRL
Sbjct: 368 FINKSLLALGTVISKLSTESNKNRSPTLPSPPLSSSSSSTSINSSVPGHIPYRDSKLTRL 427

Query: 392 LQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
           LQ +L G++    I TI     ++ ET +TL +AS+AKNI
Sbjct: 428 LQPALSGDSIVTTICTIDTKNESSAETLNTLRFASRAKNI 467

 Score = 58.2 bits (139), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 13/111 (11%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    S   +++    P+     +G+N T+  YGMT +GKTYTM G  E     
Sbjct: 137 FKFDHVFNSFVSNLEIYQVINRPMIDKLFQGFNSTIFAYGMTGSGKTYTMMGCPER---- 192

Query: 139 DVNGQAGIAPRILVKLF-----ECLQDD--YVVKCSFVELYNEDLRDLLSE 182
               + G+ P  +  LF     E L  D  + +  S++E+YNE + DLL +
Sbjct: 193 --EQKDGLIPLSVSYLFTKIMEETLDGDKKFEIVLSYLEIYNEKIYDLLGD 241

>TPHA0D04190 Chr4 complement(899419..901437) [2019 bp, 672 aa] {ON} 
          Length = 672

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%), Gaps = 5/132 (3%)

Query: 301 TTKLNDVSSRSHTIFT--ITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRA--KE 356
           +T +N+ SSRSH++F   IT + +   + +   ++NLVDLAGSE + +   +  +   KE
Sbjct: 539 STHMNNASSRSHSVFMMKITGHNRITQE-HSTGRLNLVDLAGSERLQQQEQITSQETLKE 597

Query: 357 SGSINQSLLTLGRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAE 416
           + SIN+SL  L  VI+S+  +  +IPFR SKLT LL++SL   +KT++   ISP   +  
Sbjct: 598 TTSINKSLTCLADVIHSMKHRQPYIPFRNSKLTYLLKNSLINKSKTLMYVNISPNINSIR 657

Query: 417 ETCSTLEYASKA 428
           ET ++L  A K 
Sbjct: 658 ETINSLRLARKV 669

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 55/113 (48%), Gaps = 18/113 (15%)

Query: 75  QAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEM 134
           Q   +T DK++G       VF+D  + L    + GYN  +  YG T +GKTYTM      
Sbjct: 380 QLHAFTFDKIFGMQDDNYEVFDDI-KNLVQSSLDGYNVCIFTYGQTGSGKTYTM------ 432

Query: 135 GAEGDVNGQAGIAPRILVKLFEC------LQDDYVVKCSFVELYNEDLRDLLS 181
                +N + GI  + +  +         L  +Y ++  F+E+YNE +RDLL+
Sbjct: 433 -----LNEKDGIIMQTIEYIVHFAGNLHKLGWEYELEVEFIEIYNETIRDLLN 480

>ACR145W Chr3 (605114..607171) [2058 bp, 685 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL155C (KIP2)
          Length = 685

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/169 (36%), Positives = 92/169 (54%), Gaps = 19/169 (11%)

Query: 302 TKLNDVSSRSHTIFTITLYK-KFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           T  N  SSRSH I  + L +   K      S ++L DLAGSE   +A    +R KE   I
Sbjct: 307 TDFNTRSSRSHAIVLLRLTRYDLKTGSEATSTLSLCDLAGSE---RAVTQIVRRKEGAFI 363

Query: 361 NQSLLTLGRVINSLA------------DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATI 408
           N+SLL LG VI  L+              + HIP+R+SKLTR+LQ +L G++    I TI
Sbjct: 364 NKSLLALGTVIAKLSMLGSQANGLQPSPAAGHIPYRDSKLTRILQPALTGDSIITTICTI 423

Query: 409 SPAKIAAEETCSTLEYASKAKNIK---NKPQLGSFIIKDILLKDVSQEL 454
                ++ ET +T+ +AS+AKNI     K ++ S   KD +++++ ++L
Sbjct: 424 DSKAESSTETTNTVRFASRAKNIALNVRKNEMDSHAEKDTIIQNLRKQL 472

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (50%), Gaps = 23/140 (16%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+      + V++    P+      GYN T+  YGMT +GKT+TM+G+ +     
Sbjct: 146 FQFDHVFTKGVCNQEVYQALGVPIIDKLFEGYNATIFAYGMTGSGKTFTMSGNKQ----- 200

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLLSEGQDDFSNGT 191
               + G+ P+ +  +F+ +  +       Y VK S++E+YNE + DLL     ++ +  
Sbjct: 201 ----EPGLIPQCVGNIFDRISSEHHGASLAYEVKVSYLEIYNEKIYDLL-----NYVDRQ 251

Query: 192 ENSSKQPESLNASKKLRIFD 211
             S+ QP S NA+  L+I D
Sbjct: 252 AGSTGQP-SRNAT-GLKIRD 269

>CAGL0M02189g Chr13 complement(261290..263308) [2019 bp, 672 aa]
           {ON} similar to uniprot|P28743 Saccharomyces cerevisiae
           YPL155c KIP2 kinesin-related protein
          Length = 672

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 93/192 (48%), Gaps = 29/192 (15%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK-FK 324
           ++ G+ +  L      T++E              + T+ N  SSRSH I  I L  K  +
Sbjct: 265 SECGVRVVGLTQKRCDTSEEVLDWINKGNKNRKTSETEFNTRSSRSHAIVMIRLISKDIR 324

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVIN------------ 372
                +  ++L DLAGSE   +    N R KE   IN+SLL LG VI+            
Sbjct: 325 TGEQNIRTLSLCDLAGSE---RGVGQNERRKEGAFINRSLLALGTVISRLSAENNGSHHT 381

Query: 373 --------SLADKSA-----HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETC 419
                   SLA  +      HIP+R+SKLTRLLQ +L G++  V + TI  A  ++ ET 
Sbjct: 382 GRAANSQQSLASPNGSSSGNHIPYRDSKLTRLLQPALSGDSVVVALCTIDLAHESSSETL 441

Query: 420 STLEYASKAKNI 431
           +TL +AS++KN+
Sbjct: 442 NTLRFASRSKNV 453

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 53/109 (48%), Gaps = 16/109 (14%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +T D V+    S   ++    +PL    + GYN T+  YGMT +GKT+TM+G  E     
Sbjct: 133 FTFDHVFSTGCSNFDIYGKTTQPLIDRLIEGYNATIFAYGMTGSGKTFTMSGTEE----- 187

Query: 139 DVNGQAGIAPRILVKLFECL-------QDDYVVKCSFVELYNEDLRDLL 180
               + G+ P  +  LF  L        +   V  S++E+YNE + DLL
Sbjct: 188 ----EKGLIPLSVSYLFSSLLEKTNTENEKSEVWVSYLEIYNEKINDLL 232

>Skud_16.127 Chr16 complement(228817..230937) [2121 bp, 706 aa] {ON}
           YPL155C (REAL)
          Length = 706

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 81/165 (49%), Gaps = 35/165 (21%)

Query: 299 VATTKLNDVSSRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKES 357
           +  T  N  SSRSH I  I L      +   R S ++L DLAGSE   +A     R KE 
Sbjct: 332 IGETDYNTRSSRSHAIVLIRLTSTDVNNGTSRSSTLSLCDLAGSE---RATGQQERRKEG 388

Query: 358 GSINQSLLTLGRVINSL-ADK------------------------------SAHIPFRES 386
             IN+SLL LG VI+ L ADK                              S HIP+R+S
Sbjct: 389 SFINKSLLALGTVISKLSADKTTSVDSNISTTPTGSSGSSSGSITGNSGIPSNHIPYRDS 448

Query: 387 KLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNI 431
           KLTRLLQ +L G++    I T+     AA ET +TL +AS+AKN+
Sbjct: 449 KLTRLLQPALSGDSIVTTICTVDTRNDAAAETMNTLRFASRAKNV 493

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 58/115 (50%), Gaps = 16/115 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    +   V+E   +P+    + G+N T+  YGMT +GKT+TM+G+ +     
Sbjct: 163 FKFDHVFASHCTNLEVYERTGKPMIDKLLMGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 139 DVNGQAGIAPRILVKLFECLQDD-------YVVKCSFVELYNEDLRDLLSEGQDD 186
               + G+ P  +  LF  + +        + V  S++E+YNE + DLL  G ++
Sbjct: 218 ----ELGLIPLSVSYLFSNIMEQSMDGDKKFDVIISYLEIYNERIYDLLESGLEE 268

>KLTH0D11286g Chr4 (922942..924978) [2037 bp, 678 aa] {ON} similar
           to uniprot|P28743 Saccharomyces cerevisiae YPL155C KIP2
           Kinesin-related motor protein involved in mitotic
           spindle positioning
          Length = 678

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 79/147 (53%), Gaps = 20/147 (13%)

Query: 302 TKLNDVSSRSHTIFTITL-YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           T  N  SSRSH I TI +   +        S ++L DLAGSE   +A   + R KE   I
Sbjct: 307 TDYNTRSSRSHAIVTIKVTCTELLSGTDTTSTLSLCDLAGSE---RAAGQHERRKEGAFI 363

Query: 361 NQSLLTLGRVINSLADKS----------------AHIPFRESKLTRLLQDSLGGNTKTVL 404
           N+SLL LG VI+ L+  S                +H+P+R+SKLTR+LQ +L G++    
Sbjct: 364 NKSLLALGTVISKLSAVSGASGGGAATPPPTFGNSHVPYRDSKLTRILQPALSGDSIVTT 423

Query: 405 IATISPAKIAAEETCSTLEYASKAKNI 431
           I TI     A  ET +T+ +AS+AKN+
Sbjct: 424 ICTIDTKPDAMSETVNTIRFASRAKNV 450

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 69/139 (49%), Gaps = 15/139 (10%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  DKV+ P ++   V+E+  +P+     +GYN T+  YGMT +GKT+TM+G        
Sbjct: 140 FWFDKVFSPQTNNYGVYEEIGKPMIDKLFQGYNATIFAYGMTGSGKTFTMSG-------- 191

Query: 139 DVNGQAGIAPRILVKLFECLQDD------YVVKCSFVELYNEDLRDLLSEGQDDFSNGTE 192
               +AG+    + ++F  +  +      Y V+ S++E+YNE + DLL+        GT 
Sbjct: 192 -TRDEAGLILLSVEQIFSQIMKESVNNKSYEVRVSYLEIYNEKIYDLLNYPSAKSPGGTY 250

Query: 193 NSSKQPESLNASKKLRIFD 211
            S +      A  +L + D
Sbjct: 251 GSFQSKNVPGAGAELPVRD 269

>TBLA0C01880 Chr3 (441985..443391) [1407 bp, 468 aa] {ON} Anc_8.678
           YPL155C
          Length = 468

 Score = 82.4 bits (202), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 82/139 (58%), Gaps = 14/139 (10%)

Query: 299 VATTKLNDVSSRSHTIFTITLYKKFKDDLYRLSKI-NLVDLAGSE--NVNKAGALNLRAK 355
           V +T+ N  SSRSH +  +    +  D +   +++  L DLAGSE  +V+  G   LRA 
Sbjct: 253 VRSTQHNTGSSRSHAVLRL----RITDSMGSKARVLTLCDLAGSERASVHDRG---LRA- 304

Query: 356 ESGSINQSLLTLG---RVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAK 412
           E G+IN+SL+ LG   R++N     S H+P+R+SKLTRLL+ SL GN    ++ T+S + 
Sbjct: 305 EGGAINKSLMALGTVVRLLNETGPSSTHVPYRDSKLTRLLKPSLSGNGLVTMVCTVSLSG 364

Query: 413 IAAEETCSTLEYASKAKNI 431
              E++  TL +A +A  +
Sbjct: 365 TDYEQSLGTLRFARRASGV 383

 Score = 52.4 bits (124), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 36/104 (34%), Positives = 52/104 (50%), Gaps = 17/104 (16%)

Query: 88  DSSQKLVFEDCAEPLFH----DFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ 143
           +S+  +   DC +PL H    D + G   T++ YG T +GKTYTM G     AEG     
Sbjct: 117 NSNHDIFVRDC-KPLVHRVATDCISG---TIIAYGATGSGKTYTMHG---TKAEG----- 164

Query: 144 AGIAPRILVKLFECLQDDYVVKCSFVELYNEDLRDLLSEGQDDF 187
            GI    +  L   L  +  +  S++E+YNE L DLL +G  + 
Sbjct: 165 -GIVQLSIRDLLTQLSKNCQITISYLEIYNERLHDLLCDGTKEL 207

>TDEL0B07270 Chr2 complement(1280163..1282097) [1935 bp, 644 aa]
           {ON} Anc_2.633 YKL079W
          Length = 644

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 90/320 (28%), Positives = 156/320 (48%), Gaps = 57/320 (17%)

Query: 307 VSSRSHTIFTITLYKKFK-DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLL 365
            SSRS  I  IT+ ++    ++++     LVDL  S+ ++K   L +  + +  INQS++
Sbjct: 216 ASSRSSVIIRITVEQRDNVKEVFKTGSFQLVDLGSSDKIDKQNNLGISPENTKKINQSMV 275

Query: 366 TLGRVINSLA------------DKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           TL  V  SLA              + +IP++ES LT+LLQ+++GGN KT L+   S AK 
Sbjct: 276 TLENVARSLAGTEQSVKNGRPRSGNYYIPYKESCLTQLLQETIGGNCKTTLVLMCSTAKQ 335

Query: 414 AAEETCSTLEYASKAKNIK-----NKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKE 468
             EET +TL + +  K +K     NK    S  + D+L+KD                   
Sbjct: 336 DEEETLNTLNFGANMKLVKNLFQQNKAGTNSKAMLDLLMKDFD----------------- 378

Query: 469 GIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDN 528
                +KNY+  +  L+     L +L+  +++  ++NE++ + KK        LK++L++
Sbjct: 379 ---AKEKNYQSHIQLLEKELMNLKKLQYGSETADKQNEIMLENKK--------LKAQLES 427

Query: 529 LRSQLKSVTNKLAQTNTQNTK--------LSEQVTDMNRIQTELKSLIEVYQQKHETSKH 580
           L   L S ++K A  +T+N +        L E+   +  +Q  L +  E+   K  TS+ 
Sbjct: 428 LSQLLHSSSSK-ANVSTKNDEEHSKIMGILMEKCEKVMEVQMRLDN--EISSNKSLTSQL 484

Query: 581 KFQRLLKDELATLTAKILSQ 600
           +F+   ++ LA +  K+L Q
Sbjct: 485 EFKSSKEEALAAMNLKLLEQ 504

 Score = 49.3 bits (116), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 56/111 (50%), Gaps = 15/111 (13%)

Query: 77  KTYTVDKVYGPDSSQK----LVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDV 132
           K + VD+++ P +  K     +  D    LF+    GYN  ++ YG T +GKT TM G  
Sbjct: 69  KLFRVDQIFNPGAQTKDTTSSIIGDSVAQLFN----GYNVAIMAYGQTDSGKTSTMFGYN 124

Query: 133 EMGAEGDVNGQAGIAPRILVKLFECLQD--DYVVKCSFVELYNEDLRDLLS 181
           +   +G +N   G+  +I   +    ++  DY +  S +E+  E +RDLL+
Sbjct: 125 K--GDGVIN---GVCKQIFTTVETGSENNIDYSISLSIIEVNCESIRDLLA 170

>Ecym_2395 Chr2 complement(766148..768211) [2064 bp, 687 aa] {ON}
           similar to Ashbya gossypii ACR145W
          Length = 687

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 77/147 (52%), Gaps = 20/147 (13%)

Query: 302 TKLNDVSSRSHTIFTITLYK-KFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSI 360
           T  N  SSRSH I  + L + + K      S ++L DLAGSE   +A    +R KE   I
Sbjct: 308 TDFNSRSSRSHAIVLLRLTRCELKTGTEVTSTLSLCDLAGSE---RAVTQLVRRKEGAFI 364

Query: 361 NQSLLTLGRVINSL----------------ADKSAHIPFRESKLTRLLQDSLGGNTKTVL 404
           N+SLL LG VI  L                +    HIP+R+SKLTR+LQ +L G++    
Sbjct: 365 NKSLLALGTVIAKLSANSAGSGSGSNGQPPSAMGGHIPYRDSKLTRILQPALTGDSIITT 424

Query: 405 IATISPAKIAAEETCSTLEYASKAKNI 431
           I TI     +  ET +T+ +AS+AKNI
Sbjct: 425 ICTIDSKSESNSETTNTVRFASRAKNI 451

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 17/111 (15%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+  + +   V+    +P+     +GYN T+  YGMT +GKT+TM+G  +     
Sbjct: 145 FQFDHVFTKEVTNSEVYMALGQPIVDKLFQGYNATIFAYGMTGSGKTFTMSGTKQ----- 199

Query: 139 DVNGQAGIAPRILVKLFECLQDD--------YVVKCSFVELYNEDLRDLLS 181
                 G+ P  +  +F+ + ++        Y VK S++E+YNE + DLLS
Sbjct: 200 ----DPGLIPLCVGNMFDRVMEETSKSTEHKYEVKVSYLEIYNEKIYDLLS 246

>Kpol_1019.11 s1019 complement(20458..22401) [1944 bp, 647 aa] {ON}
           complement(20458..22401) [1944 nt, 648 aa]
          Length = 647

 Score = 79.7 bits (195), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/254 (28%), Positives = 119/254 (46%), Gaps = 44/254 (17%)

Query: 305 NDVSSRSHTIFTITLYKKFK-DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQS 363
           N++  RSHTI  +++ K+ K D+   +S + +VDLAGS+ + K  +  +  +++  IN  
Sbjct: 225 NNLIQRSHTIMEVSIEKRNKLDESITMSSLYIVDLAGSDPIGKNSSSGITTEDAKKINHQ 284

Query: 364 LLTLGRVINSLA----------DKSA---HIPFRESKLTRLLQDSLGGNTKTVLIATISP 410
           + ++  VIN L           D S     +P++ S LTRLL D LGGN KT  + T S 
Sbjct: 285 IKSVNDVINGLVVMNREGGIMTDISTLMHKVPYKSSILTRLLLDPLGGNCKTTFLLTSSL 344

Query: 411 AKIAAEETCSTLEYASKAKNIKNKPQLGSFIIK-----DILLKDVSQELIKMRADLWCTK 465
            K    ET STL++    K+    P++  F +      DI L D+              K
Sbjct: 345 KKNDWNETLSTLKFGYNCKSANTNPRINRFGLNSKATMDIFLTDM--------------K 390

Query: 466 SKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSE 525
            KE  ++S  N   + + ++N  T+   L         E+EL   E K   +  + LKS+
Sbjct: 391 LKEDNFISITN--NLTNQVNNLMTQANSL---------EDELKNNETKYNKKETNILKSQ 439

Query: 526 LDNLRSQLKSVTNK 539
           ++ L   L +  N+
Sbjct: 440 VETLTELLNNPNNR 453

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 56/111 (50%), Gaps = 20/111 (18%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           Y  DKV+  + +  +  ++  E      ++GYN +++ YG + TGK++ + G+       
Sbjct: 73  YKFDKVFASNDT-GVEHQEFIESNLESLLQGYNTSIVTYGQSGTGKSFELYGE------- 124

Query: 139 DVNGQAGIAPRILVKLFECLQDD---------YVVKCSFVELYNEDLRDLL 180
               Q G+  ++L KLF  + ++         Y VK SF+E+Y E + DL+
Sbjct: 125 ---QQDGLIFQLLTKLFNRIDEEMGNNNKNIHYTVKFSFLEVYQEKMFDLM 172

>Suva_16.155 Chr16 complement(266334..268448) [2115 bp, 704 aa] {ON}
           YPL155C (REAL)
          Length = 704

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 68/198 (34%), Positives = 92/198 (46%), Gaps = 35/198 (17%)

Query: 266 TQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKK-FK 324
           TQ G+ +  L +    +++E             +  T  N  SSRSH I  I L     +
Sbjct: 299 TQYGVKVIGLTERRCESSEELLKWIAIGDKSRKIGETDYNARSSRSHAIVLIRLTSTDLE 358

Query: 325 DDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSL-ADK------ 377
               R S ++L DLAGSE   +A     R KE   IN+SLL LG VI+ L ADK      
Sbjct: 359 SGTSRSSTLSLCDLAGSE---RATGQQERRKEGSFINKSLLALGTVISKLSADKINPTGS 415

Query: 378 ------------------------SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
                                   + HIP+R+SKLTRLLQ +L G++    I T+     
Sbjct: 416 NIHTTPTNTGSSSSGTVTSNNNIPNNHIPYRDSKLTRLLQPALSGDSIVTTICTVDTRND 475

Query: 414 AAEETCSTLEYASKAKNI 431
           AA ET +TL +AS+AKN+
Sbjct: 476 AAAETINTLRFASRAKNV 493

 Score = 62.0 bits (149), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  D V+    +   V+E  ++P+    + G+N T+  YGMT +GKT+TM+G+ +     
Sbjct: 163 FEFDHVFASHCTNLEVYERTSKPMIDKLLVGFNATIFAYGMTGSGKTFTMSGNEQ----- 217

Query: 139 DVNGQAGIAPRILVKLFECLQD-------DYVVKCSFVELYNEDLRDLLSEGQDD 186
               + G+ P  +  LF  + +        + V  S++E+YNE + DLL  G ++
Sbjct: 218 ----ELGLIPLSVSYLFSNVMELSMNGDKKFDVIISYLEIYNERIYDLLESGLEE 268

>YKL079W Chr11 (286603..288573) [1971 bp, 656 aa] {ON}  SMY1Protein
           that interacts with Myo2p, proposed to be involved in
           exocytosis; N-terminal domain is related to the motor
           domain of kinesins
          Length = 656

 Score = 75.1 bits (183), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 163/357 (45%), Gaps = 65/357 (18%)

Query: 309 SRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           SRSH +F + + ++  KDD+ + S + LVDL G+E  +K     L       +NQS+  L
Sbjct: 233 SRSHLVFQLHVEQRNRKDDILKNSSLYLVDLHGAEKFDKRTESTLSQDALKKLNQSIEAL 292

Query: 368 GRVINSLADK----------SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEE 417
              + SL+ K          S    +RES+LT +L+DSLGGN KT +I T   + +    
Sbjct: 293 KNTVRSLSMKERDSAYSAKGSHSSAYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 350

Query: 418 TCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQEL-IKMRADLWC--TKSKEGIYVSQ 474
           T STLE+    + I NK            + D +  L +K + DL+    K K+  YV+Q
Sbjct: 351 TLSTLEFGDSIRQINNK------------VTDNTTGLNLKKKMDLFIQDMKIKDDNYVAQ 398

Query: 475 KNYKEMVDDLDNFKTELTELKRT-NDSLVQENE--LLGKEKKSGAERADSLKSELDNLRS 531
            N           K E+  LK   N SL +++E  +L   KK   +    LK +LD++  
Sbjct: 399 INI---------LKAEIDSLKSLHNKSLPEDDEKKMLENTKKENIK----LKLQLDSITQ 445

Query: 532 QLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLL----- 586
            L S TN+       N ++ E+V+++   + E  + +E+   +   S  K Q+ L     
Sbjct: 446 LLSSSTNE-----DPNNRIDEEVSEILTKRCEQIAQLELSFDRQMNSNSKLQQELEYKKS 500

Query: 587 -KDELATLTAKILSQWD----------TLKNVNSGNYQIHTHIDSIRGEVMNLLETT 632
            ++ L ++  ++L Q            T   +  G  + HT +   R E +  LE++
Sbjct: 501 KEEALESMNVRLLEQIQLQEREIQELLTTNAILKGELETHTKLTETRSERIKSLESS 557

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 55/110 (50%), Gaps = 16/110 (14%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           T+  DKV+  +++Q+ V +    P+ +D + GYN T++ YG + +GK+Y++ G  E    
Sbjct: 74  TFQFDKVFDANATQEDVQKFLVHPIINDVLNGYNGTVITYGPSFSGKSYSLIGSKE---- 129

Query: 138 GDVNGQAGIAPRILVKLFECLQ-------DDYVVKCSFVELYNEDLRDLL 180
                  GI P I   LF+ L+       D + V     E+Y E   DLL
Sbjct: 130 -----SEGILPNICKTLFDTLEKNEETKGDSFSVSVLAFEIYMEKTYDLL 174

>TPHA0N01650 Chr14 complement(356519..358567) [2049 bp, 682 aa] {ON}
           Anc_2.633 YKL079W
          Length = 682

 Score = 67.8 bits (164), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 124/256 (48%), Gaps = 24/256 (9%)

Query: 269 GIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITLYKKFK-DDL 327
           G+ + NL+  H+++ KE             V  +K ++   R++TIF I + K  K D+ 
Sbjct: 208 GLPVDNLRQVHVASFKETLYYFNQAMS---VLNSKHDNSFPRTNTIFNINIEKLDKLDES 264

Query: 328 YRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAH------- 380
              S I LVDLAGS+ +++  +  + +++   IN S+ ++  +I SL+  S         
Sbjct: 265 TTSSSIYLVDLAGSDLIDRKNSSGVNSEDVKRINSSIKSVQNIITSLSKLSYSDYKNYEF 324

Query: 381 -----IPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASKAKNIKNKP 435
                +P+  SKL +LL++ LGGN KT  + TIS      ++    L+  +  ++ K  P
Sbjct: 325 SLENSVPYDSSKLGKLLKEPLGGNCKTNFLFTISMNPEQYDDIIEALQLGTILQDSKTVP 384

Query: 436 QLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGI--------YVSQKNYKEMVDDLDNF 487
           Q+  F + +     ++ E  K++ + +  +  E +         ++ K    ++++L+  
Sbjct: 385 QINKFGLNENKTLSIALENFKLKENNFKIQQAESVKQIEELKSIITNKEESIVLEELNKL 444

Query: 488 KTELTELKRTNDSLVQ 503
           ++E  +LK   ++L Q
Sbjct: 445 RSENAKLKAQVNTLTQ 460

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 53/113 (46%), Gaps = 16/113 (14%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           ++    ++  DS+  L+       +  + M GYN  ++ YG   +GKTY++ G+      
Sbjct: 83  SFEFTHIFDRDSNIDLIGNTIVTGMIDEAMEGYNTALVTYGPKYSGKTYSLYGN------ 136

Query: 138 GDVNGQAGIAPRILVKLFECLQDD---------YVVKCSFVELYNEDLRDLLS 181
            DV+   G+   I   LF  +            ++VK SF+E++ + + DLL+
Sbjct: 137 -DVDDSFGLGQIIFKDLFSRINKSVTDSNAKYTFIVKISFLEVWLDKVVDLLA 188

>Kwal_55.21164 s55 complement(713274..715037) [1764 bp, 588 aa]
           {OFF} YPR141C (KAR3) - kinesin-like nuclear fusion
           protein [contig 452] PARTIAL
          Length = 588

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 18/129 (13%)

Query: 70  IEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMT 129
           I+ + +   +T D+ +G   S K +F +  + L    + GYN  +  YG T +GKTYTM 
Sbjct: 399 IKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM- 456

Query: 130 GDVEMGAEGDVNGQAGIAPRILVKLF---ECLQD---DYVVKCSFVELYNEDLRDLLSEG 183
                     +N + GI P  L  +F   E L++    Y +   F+E+YNE+++DL  + 
Sbjct: 457 ----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

Query: 184 QDDFSNGTE 192
             +  +G+E
Sbjct: 507 DTENDDGSE 515

>Kwal_YGOB_55.21164 s55 complement(713063..713220,713222..715037)
           [1974 bp, 657 aa] {ON} ANNOTATED BY YGOB -
          Length = 657

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 65/129 (50%), Gaps = 18/129 (13%)

Query: 70  IEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMT 129
           I+ + +   +T D+ +G   S K +F +  + L    + GYN  +  YG T +GKTYTM 
Sbjct: 399 IKREAKYHKFTFDRCFGAQESNKDIFHEIGQ-LIQSSLDGYNVCIFAYGQTGSGKTYTM- 456

Query: 130 GDVEMGAEGDVNGQAGIAPRILVKLF---ECLQD---DYVVKCSFVELYNEDLRDLLSEG 183
                     +N + GI P  L  +F   E L++    Y +   F+E+YNE+++DL  + 
Sbjct: 457 ----------LNPEDGIIPSTLNHIFLWVEKLKELGWSYDISSQFIEIYNENIKDLFKDH 506

Query: 184 QDDFSNGTE 192
             +  +G+E
Sbjct: 507 DTENDDGSE 515

>Smik_11.160 Chr11 (272801..274771) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 66.2 bits (160), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 108/222 (48%), Gaps = 31/222 (13%)

Query: 309 SRSHTIFTITLYKKFKD-DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           S+SH +F + + ++ ++ D+ R S + L+DL G+E  +K   + L       +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRNADILRKSSLYLIDLHGAERFDKRTEVTLSQDALKKLNQSIEAL 292

Query: 368 GRVINSLADK----------SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEE 417
             ++  L+ K          S    +RES+LT +L+DSLGGN KT +I T   + ++   
Sbjct: 293 KNIVRLLSVKDRDSAYSVKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVST-- 350

Query: 418 TCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNY 477
           T STLE+    + I NK           ++ + +   +K + DL+     E + +   NY
Sbjct: 351 TLSTLEFGECIRQITNK-----------VIDNTTGLNLKKKMDLFI----EDMKIRDNNY 395

Query: 478 KEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERA 519
              ++ L   K E+  LK  +  LV + ++  K + S  E A
Sbjct: 396 ASRINIL---KAEIDSLKTPSGELVSQGDMKTKFENSEKENA 434

 Score = 55.8 bits (133), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 16/110 (14%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           T+  DKV+  +++Q+ V +    P   D + GYN T++ YG + +GK+Y++ G      E
Sbjct: 74  TFKFDKVFDTNATQEDVQDFLVRPSIDDVLSGYNGTIITYGPSFSGKSYSLLG----SQE 129

Query: 138 GDVNGQAGIAPRILVKLFECLQ-------DDYVVKCSFVELYNEDLRDLL 180
           G+     GI P I   LFE L+       +++ V     E++ E   DLL
Sbjct: 130 GE-----GILPNICKVLFETLEKNKETKGNNFSVSVLAFEIFMEKTYDLL 174

>Suva_11.145 Chr11 (272862..274835) [1974 bp, 657 aa] {ON} YKL079W
           (REAL)
          Length = 657

 Score = 65.5 bits (158), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 90/347 (25%), Positives = 157/347 (45%), Gaps = 49/347 (14%)

Query: 309 SRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           SRSH +F + + ++  + D+ + S + L+DL G+E  +K     L       +NQS+  L
Sbjct: 234 SRSHVVFQLHVEQRNRRHDILKNSSLYLIDLHGAEKFDKRIENTLSQDSLKKLNQSIEAL 293

Query: 368 GRVINSL---------ADKSAHIP-FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEE 417
              + SL         + K++H   +RES+LT +L+DSLGGN KT +I T   + +    
Sbjct: 294 KNTVQSLEIKSMDSVYSAKASHSSTYRESQLTEVLKDSLGGNRKTKVILTCFLSNVPT-- 351

Query: 418 TCSTLEYASKAKNIKNKPQLGS----------FIIKDILLKD---VSQ-ELIKMRADLWC 463
           T STL++    + I N+    +            ++D+ +KD   +SQ  ++K   ++  
Sbjct: 352 TLSTLKFGDSIRQINNRVMDNTSGLNLRKKMDLFVQDMKIKDDNYISQINILKAEVEILK 411

Query: 464 TKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLK 523
            +S E       + ++M    D+ K E T+LK   DS+ Q   LLG  K +  E  +S+ 
Sbjct: 412 GQSSES-----DSKEDMATKFDDSKKENTKLKLQLDSIAQ---LLG--KLTNEEPNNSIN 461

Query: 524 SELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQ 583
            E+  +      + N+  Q          QV   ++++ EL    E  + K E  +    
Sbjct: 462 DEVSVI------LMNRCEQIAQLELSFDRQVNANSKLEKEL----EYKKSKEEALESMNV 511

Query: 584 RLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNLLE 630
           +LL  E   L  K + +  T   +  G  + H+ +   R E +  LE
Sbjct: 512 KLL--EQIQLQEKEIQELLTTNAILKGELETHSKLTETRNERIKSLE 556

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 56/110 (50%), Gaps = 16/110 (14%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           T+  DKV+  +++QK V +   +P  +D + GYN T+L YG + +GK+Y++ G  + G  
Sbjct: 75  TFQFDKVFDANATQKDVQDFLLDPTINDVLSGYNSTILTYGPSFSGKSYSLIGPQDGG-- 132

Query: 138 GDVNGQAGIAPRILVKLFECLQD-------DYVVKCSFVELYNEDLRDLL 180
                  GI P I   LF  L+D       ++ V     E+Y E   DLL
Sbjct: 133 -------GILPNICKALFSTLEDREKNKGNNFSVSVLAFEIYMEKTYDLL 175

>NCAS0H03180 Chr8 (611693..613675) [1983 bp, 660 aa] {ON} Anc_2.633
          Length = 660

 Score = 64.3 bits (155), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 103/413 (24%), Positives = 173/413 (41%), Gaps = 73/413 (17%)

Query: 250 DMSLNANAGGKTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSS 309
           D+ LN     K HV     G +I++L   H+++  E                + L+   S
Sbjct: 181 DLLLNNGKPLKVHV----HGDHIRDLHQIHVTSPIEIKDTLKNGYKN----ISPLHHSKS 232

Query: 310 RSHTIFTITLYKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGR 369
           +    F +    + KDD+ R S I  +DL GS+ + K  A  L + +    NQ +  L  
Sbjct: 233 QIFVRFEVQCIDR-KDDVTRCSSITFIDLCGSDLLTKQNASKLSSDDIKKFNQMIYLLQN 291

Query: 370 VINSLADK----SAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYA 425
           +I +L ++    S+H  F++S L ++L D LGG+TK  L+  I       E+    ++  
Sbjct: 292 LIKTLPEEQSTNSSH--FKDSSLNKILMDYLGGDTKMTLVVAIDGNTGGYED---AVKLG 346

Query: 426 SKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVSQKNYKEMVDDLD 485
           +KAK IKN P +    +             K + DL      + + V ++NY   ++ L 
Sbjct: 347 AKAKLIKNYPTMNKIGLN-----------AKRKMDLLV----QDMNVKEQNYLAKINLL- 390

Query: 486 NFKTELTELKRTNDS-----------LVQEN-----------ELLGKEKKSGAERADSLK 523
             +TE+  LK  NDS            +QEN           ++LG    S A  + S K
Sbjct: 391 --QTEIKTLKTENDSTTNSTSNSLENALQENSKLKLQLESLQQILG--TMSLANPSSSNK 446

Query: 524 SELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQ 583
           +E++     LK    KL  T      L   V +   I  +LK  I+    K +  +    
Sbjct: 447 NEMNEHDELLK----KLMSTCEDVANLQLSVDNGKHINRKLKKQIDANSSKEDVFETMNS 502

Query: 584 RLLK---------DELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMN 627
            LLK         +EL T  A +  +++ L+ V++   +  TH++ I  ++ N
Sbjct: 503 TLLKQIQNQEKELEELLTANASLQIEFENLRKVSNSRKERITHLEKILKDLQN 555

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 55/104 (52%), Gaps = 8/104 (7%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           Y  D ++  DS +   ++   + L  D  +GYN T++ YG TS+GK++ + GD +   +G
Sbjct: 86  YQFDSIFDVDSKETEFYDSITDNLIDDISKGYNTTIMTYGPTSSGKSHALFGDPDSTNDG 145

Query: 139 DVNGQAGIAPRILVKLFECLQDDYVVKC--SFVELYNEDLRDLL 180
            +N    IA R+   LF   +D+    C  S  ELY + + DLL
Sbjct: 146 LIN---HIADRL---LFPQCEDNLKTLCSISMWELYIDKVYDLL 183

>Skud_11.148 Chr11 (271990..273960) [1971 bp, 656 aa] {ON} YKL079W
           (REAL)
          Length = 656

 Score = 62.8 bits (151), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 155/352 (44%), Gaps = 59/352 (16%)

Query: 309 SRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           S+SH +F + + ++  ++D+ + S + L+DL G+E   K     L       +NQS+  L
Sbjct: 233 SKSHLVFQLHVEQRNRREDILKNSSLYLIDLHGAEKFEKRTENTLSQDALKKLNQSIEAL 292

Query: 368 GRVINSLA---------DKSAHIP-FRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEE 417
             ++  LA          K++H   +RES+LT +L+DSLGGN K  +I T   + +    
Sbjct: 293 KNIVQLLAVKNPDSAYSTKASHSSTYRESQLTEVLRDSLGGNRKMKVILTCFLSNVPT-- 350

Query: 418 TCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWC--TKSKEGIYVSQK 475
           T STLE+    + I NK           ++   +   +K + DL+    K K+  YVSQ 
Sbjct: 351 TISTLEFGDNIRQIINK-----------VMSSTTGLNMKKKMDLFVQDMKIKDDNYVSQI 399

Query: 476 NYKEMVDDLDNFKTELTELK-RTNDSLVQEN---ELLGKEKKSGAERADSLKSELDNLRS 531
           N           K+EL  LK  +N+S  +E+   EL   EK++       LK +LD++  
Sbjct: 400 NI---------LKSELDSLKDLSNESSSREDMKTELENYEKENVK-----LKLQLDSITQ 445

Query: 532 QLKSVTNKLAQTNTQN------TKLSEQVTDMN-------RIQTELKSLIEVYQQKHETS 578
            L S TN+    N  +       K  EQ+  +           ++L+   E  + K E  
Sbjct: 446 LLSSSTNENPNNNIDDEVAEILMKRCEQIAQLELSFDRQMNANSKLRKEFEYKKSKEEAL 505

Query: 579 KHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMNLLE 630
           +    RLL  E   L  K + +  T   +  G    HT +   R E +  LE
Sbjct: 506 ESMNVRLL--EQIQLQEKEIQELLTNNAILKGELDTHTKLAETRSEKIKSLE 555

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 16/110 (14%)

Query: 78  TYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAE 137
           T+  DKV+  +++QK V +    P   D + GYN T+L YG + +GK+Y++ G       
Sbjct: 74  TFQFDKVFDANATQKDVQDFLVNPTIKDILSGYNSTILTYGPSFSGKSYSLLGS------ 127

Query: 138 GDVNGQAGIAPRILVKLFECLQD-------DYVVKCSFVELYNEDLRDLL 180
                  G+ P I   LFE L++       ++ V     E+Y E   DLL
Sbjct: 128 ---QYNEGVLPNICQVLFETLEENEETKGTNFCVSVLAFEIYMEKSYDLL 174

>NDAI0C00480 Chr3 complement(84502..86298) [1797 bp, 598 aa] {ON}
           Anc_2.633
          Length = 598

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 66/123 (53%), Gaps = 8/123 (6%)

Query: 324 KDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHIPF 383
           KD LY+LS ++ +DL G +   K   + L   E   +N  + +   +I +L+D  + +P+
Sbjct: 261 KDQLYKLSTLSFIDLYGIDKFTKKD-IQLTNDEMKKLNTLMSSFQNLITTLSDPKS-LPY 318

Query: 384 -----RESKLTRLLQDSLGGNTKTVLIATI-SPAKIAAEETCSTLEYASKAKNIKNKPQL 437
                ++S L ++LQD +GGN+KT  I    SP+ I  EE    L++A   K+IKN   +
Sbjct: 319 TSSLYKDSALNKILQDYIGGNSKTTFIIPFPSPSIIQHEELIEMLKFAMGLKSIKNPLIM 378

Query: 438 GSF 440
             F
Sbjct: 379 NVF 381

>KAFR0C04020 Chr3 (802379..804382) [2004 bp, 667 aa] {ON} Anc_2.633
           YKL079W
          Length = 667

 Score = 58.5 bits (140), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 91/361 (25%), Positives = 162/361 (44%), Gaps = 70/361 (19%)

Query: 309 SRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAG--ALNLRAKESGSINQSLL 365
           S+SH I  I + ++   +D+ +   I+  DLA  + ++K    +L L + E   +N    
Sbjct: 219 SKSHLITKINVEQRNLNEDVVKRGSISFFDLAAIDFIDKDSMVSLGLTSDEVKKLNLEST 278

Query: 366 TLGRVINSLADKS----AHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCST 421
           TL   I S+++ S    A IP++ S LT+LL     GN KT +I T S  K    ET  T
Sbjct: 279 TLKNSIISMSELSENPNAVIPYKNSNLTKLLNQCFMGNMKTTVILTCSMLKSNEAETLET 338

Query: 422 LEYASKAKNIK-----NKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVS--- 473
           L+   K ++I      NK  L S    D++++D+              KSKE  Y++   
Sbjct: 339 LKMGLKLESISSNVHMNKHALNSKKKLDLIVEDM--------------KSKEANYMNRIR 384

Query: 474 ---------QKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGK--EKKSGAERADSL 522
                    + +Y E + +  +FK E+ + +  N  L +E E+  K  +KK  A+   S 
Sbjct: 385 LLETELNDLRASYGEAISETSSFKEEMNKERAKNVKLKEELEVFKKLLQKKGEAQSTHSK 444

Query: 523 KSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQK----HETS 578
           +  L                  T + ++ +Q+ + +    ELK+ +++ + K    +E  
Sbjct: 445 EMPL------------------TDDEEIMQQLIEKSASVAELKATLDIEKHKSFKLNEVL 486

Query: 579 KHKFQRL--LKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSI------RGEVMNLLE 630
           K+  ++L  LK     L  +I  Q D+++++ S N  + + I +       R E + LLE
Sbjct: 487 KNYVEKLQTLKKMNDNLVTRIEKQEDSIQDLLSSNTVMKSQIKNWNNTADSRTERIKLLE 546

Query: 631 T 631
           +
Sbjct: 547 S 547

>TBLA0A00820 Chr1 (178283..180694) [2412 bp, 803 aa] {ON} Anc_2.633
           YKL079W
          Length = 803

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 67/128 (52%), Gaps = 13/128 (10%)

Query: 307 VSSRSHTIFTITLYKKF-KDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLL 365
           ++SRS+ +  I L + F +D L + S + L+D+A S+ ++K  +L + AKE+  +N  + 
Sbjct: 269 LTSRSNIVIKINLEQVFLEDQLMKCSSLILLDMAASDYIDKNDSLGISAKEAKKLNYPME 328

Query: 366 TLGRVINSLADKSAHIPFRE-----------SKLTRLLQDSLGGNTKTVLIATISPAKIA 414
           +    IN LA+     P+ +           S L  ++   +GGN KT+ I+TISP    
Sbjct: 329 SFTSYINLLAETGTS-PYDQQINGKKSNDYNSNLVDIMSIPIGGNCKTLFISTISPLLAN 387

Query: 415 AEETCSTL 422
             ET  TL
Sbjct: 388 QNETFITL 395

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 66  GGSGIEAQLQAKT-----YTVDKVYGPDSSQK-LVFEDCAEPLFHDFMRGYNCTMLVYGM 119
           G +G      ++T     + VDKV+   + Q  L+  D  +    +   G+N +++ +G 
Sbjct: 33  GATGTRIIFTSETTGNTEFQVDKVFDRFTKQSDLLSSDIVKNKISELFDGFNSSIIAFGQ 92

Query: 120 TSTGKTYTMTGD 131
           + TGK++TM G+
Sbjct: 93  SGTGKSFTMFGN 104

>ZYRO0E01078g Chr5 (73042..75048) [2007 bp, 668 aa] {ON} similar to
           uniprot|Q759X8 Ashbya gossypii ADR145C ADR145Cp and
           weakly similar to YKL079W uniprot|P32364 Saccharomyces
           cerevisiae YKL079W SMY1 not believed to act as a kinesin
           colocalizes with Myo2p kinesin heavy chain homolog
          Length = 668

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 85/173 (49%), Gaps = 19/173 (10%)

Query: 309 SRSHTIFTITLYKK-FKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           SRS     IT+ ++  K++  + S + L+DLA S+ ++K    ++   E  S N S+  L
Sbjct: 224 SRSSAFLNITVEQRNKKEETLKHSVLQLIDLASSDKLDKNLKYDISTDEMKSTNSSMQNL 283

Query: 368 GRVINSLAD--------KSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETC 419
            +V+  L++         S+    R S+L + LQ ++GG++KT  +   S  K   E T 
Sbjct: 284 HQVVYGLSELESPSSKNHSSKHTHRTSRLAKFLQQAIGGDSKTTAVMLSSTDKADRENTV 343

Query: 420 STLEYASKAKNIKNKP-----QLGSFIIKDILLKDVSQELIKMRADLWCTKSK 467
            TL   S+ ++I N P      L S  + D+ LK++S      R D + T+ K
Sbjct: 344 ITLSLGSRLRSIHNFPVQNKMGLNSKALLDLRLKNMS-----TREDSYLTRIK 391

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 16/110 (14%)

Query: 79  YTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEG 138
           +  +KVY     Q+ V ED       + + G+N +++ +G   +GKTYTM G+       
Sbjct: 68  FRFNKVYDVGVRQQEVCEDIIGDNVMELLAGFNVSIMAFGSEGSGKTYTMFGN------- 120

Query: 139 DVNGQAGIAPRILVKLFECLQ-------DDYVVKCSFVELYNEDLRDLLS 181
             + + GI  R+   +F+ L        ++  +  +F EL+ E++ DLLS
Sbjct: 121 --DHEEGIVQRMCQSIFDQLDKLHEDSGNESTISINFFELFAENVYDLLS 168

>KNAG0M02540 Chr13 (471930..473498) [1569 bp, 522 aa] {ON} Anc_2.633
           YKL079W
          Length = 522

 Score = 56.6 bits (135), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 64/122 (52%), Gaps = 15/122 (12%)

Query: 66  GGS-GIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGK 124
           GGS G++     +T+++DKV+ P +SQ  V      P+  +   G N  M   G + TGK
Sbjct: 32  GGSHGVDPH--ERTFSLDKVFPPSASQADVTAVLLGPIVDNLAHGVNVQMASLGDSQTGK 89

Query: 125 TYTMTGDVEMGAEGDVNGQAGIAPRILVKLFECLQDDYVVKCSF----VELYNEDLRDLL 180
           T+TM     +G +G      G+  RIL K+F+ + ++  V   +    VEL N+ + DLL
Sbjct: 90  THTM-----LGQQG---VSQGLLQRILTKVFQLMNENEGVTVQYSLSAVELVNDKVYDLL 141

Query: 181 SE 182
           ++
Sbjct: 142 NK 143

>TBLA0C00800 Chr3 complement(165244..167325) [2082 bp, 693 aa] {ON}
           Anc_2.633 YKL079W
          Length = 693

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 71/133 (53%), Gaps = 5/133 (3%)

Query: 310 RSHTIFTITLYKKFKD-DLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLG 368
           RS TI  I L +  +D DL   S I  VDLAGS+  +K     +  + +   N+ + +L 
Sbjct: 265 RSSTILRIKLLQLDEDEDLETQSTICFVDLAGSDRASKDIEKGITREAASKYNRVMDSLN 324

Query: 369 RVINSLADKSA----HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEY 424
            ++ +LA+  +       +R S LTR+L D L GN KT LI + S  K    ET STL +
Sbjct: 325 SMVYTLANSESISINKSIYRNSHLTRILYDLLAGNHKTNLIFSCSLNKDDEYETFSTLGF 384

Query: 425 ASKAKNIKNKPQL 437
           +S A ++ N+ ++
Sbjct: 385 SSYASSMSNQIKI 397

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 43/194 (22%), Positives = 73/194 (37%), Gaps = 49/194 (25%)

Query: 42  EAKSPIXXXXXXXXXXXEVSINTSGGSGIEAQLQAKTYTVDKVYGPDSSQKLVFEDCAEP 101
           ++ SPI            +++N+S   G  +   +  Y  DK++ P+     +    +  
Sbjct: 23  QSSSPIPYELNTIDNGTIITLNSSVNQG--SLGGSNQYRFDKIFEPEKPDDEINSTLSFA 80

Query: 102 LFHDFMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQ------------------ 143
             +D  +GYN T + YG T TGKTYT+ G        D++ +                  
Sbjct: 81  CINDLFKGYNSTYISYGQTGTGKTYTLYGTAFNDTPTDLDSKNINTNKNVKNDSNISSNS 140

Query: 144 --------------------AGIAPRILVKLFECLQD--------DYVVKCSFVELYNED 175
                                G+  ++   LFE +           ++V  SFVE+Y E+
Sbjct: 141 NIQTSASSNKSANSILQKKNYGLISKVGNDLFEMIDQIRAIRKGITFLVNISFVEVYKEE 200

Query: 176 LRDLLSEGQDDFSN 189
           + DLL +  D  SN
Sbjct: 201 VYDLL-QHDDTLSN 213

>CAGL0L05104g Chr12 complement(577023..579050) [2028 bp, 675 aa]
           {ON} similar to uniprot|P32364 Saccharomyces cerevisiae
           YKL079w SMY1 kinesin-related protein
          Length = 675

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 89/380 (23%), Positives = 162/380 (42%), Gaps = 77/380 (20%)

Query: 260 KTHVPPTQTGIYIQNLKDFHISTAKEXXXXXXXXXXXXXVATTKLNDVSSRSHTIFTITL 319
           K+H    + G+Y Q   + +I++ KE              +  K++   S SH +   ++
Sbjct: 196 KSHHETKKFGLYYQEANNEYINSIKEFDRVMKLIQDNKEASEKKMDSKRSTSHVVIRCSV 255

Query: 320 YKKFKDDLYRL------SKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINS 373
                + L R+      S I   DL GS    K     L  +    +N S+  L  V+NS
Sbjct: 256 -----EQLDRVHGTITSSNIMFADLCGSNRFEKDVDQKLGVENIKKLNLSISNLESVVNS 310

Query: 374 LADKSA--------------------HIPFRESKLTRLLQDSLGGNTKTVLIATISPAKI 413
           +                          +P+++S+LT L+Q++LGGN++T ++      K 
Sbjct: 311 VLQNQQKNHLYIENKLVPSVNSSDLQRVPYKDSQLTGLIQEALGGNSRTRVVLNCFDDKS 370

Query: 414 AAEETCSTLEYASKAKNIKNKPQLGSFIIKDILLKDVSQELIKMRADLWCTKSKEGIYVS 473
             EET +TL +  + +NI N      F+                RAD+    SK+ + + 
Sbjct: 371 HHEETIATLRFGVQLQNILN------FV----------------RADVTGLNSKKTLDLL 408

Query: 474 QKNYKEMVDDLDNFKTEL-TELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQ 532
             N K + ++ D   T L +EL +  D+ V++ ++  + +    E+ D +K     LR Q
Sbjct: 409 IDNMKVIENNYDQKITLLESELNKLADT-VKKAKVTEELETEIVEKNDEIK----KLREQ 463

Query: 533 LKSVT---NKLAQTNTQNTK-----LSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQR 584
           L+++T   N +    +++TK     L E+   + ++Q EL+       Q HE S  K   
Sbjct: 464 LETMTQLFNNIDPKESEDTKKIIQTLMEKCESVAQLQLELEG------QLHENSILKGDG 517

Query: 585 LLKDE----LATLTAKILSQ 600
            +KD     L T+ ++++ Q
Sbjct: 518 EIKDAKIRTLETMNSRLVEQ 537

>TPHA0H01680 Chr8 (384306..387275) [2970 bp, 989 aa] {ON} Anc_5.414
           YDR356W
          Length = 989

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 127/264 (48%), Gaps = 27/264 (10%)

Query: 483 DLDNFKTELTELKRTNDSLVQ-----ENELLGKEKKSGAERADS------LKSELDNLRS 531
           +++N + EL +LK  N  L +     ENEL     +    + D+      +K   D L++
Sbjct: 349 EIENLELELNDLKDLNTKLKESLNDKENELTNVSSEYEKYKLDAEAHMGIMKDSDDKLKN 408

Query: 532 QLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELA 591
           Q+  +  K  + N++  +++E   ++N    EL SL ++ ++  +  K K Q     EL 
Sbjct: 409 QVIEIRKKNIELNSKLLQMNEVNENLN---DELMSLKDIIEKLEQDKKAKLQ-----ELK 460

Query: 592 TLTAKILSQWDTLKNVN-SGNYQIHTHIDSIRGEVMNLLETTKENAETLYKSCIDDLLKE 650
           +L +  +SQ + LK  N +   ++  ++D    E+ N L     + +    + +D L KE
Sbjct: 461 SLKSSDISQIEDLKQNNLTLERKLKENLDEKNVEI-NKLRRQHVDMQKTNSALVDKLTKE 519

Query: 651 TPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQFFQNNHIEMIQTH 710
           +  + +   D + D+    + + T+++ N   L+ E+N+    L+ +  +N H   ++T 
Sbjct: 520 SQSLRKEYEDKINDLENQLKSNITDLSTNKDLLAVEYNSKMDKLNKELEENKH--ALKTS 577

Query: 711 QDIVASNMQKMSDDLLQSVQNSIQ 734
           ++I+      + + L+++V NS Q
Sbjct: 578 EEIIKD----LKNQLIENVTNSSQ 597

>NCAS0C05200 Chr3 (1059068..1060786) [1719 bp, 572 aa] {ON}
           Anc_2.633 YKL079W
          Length = 572

 Score = 37.4 bits (85), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 29/61 (47%), Gaps = 15/61 (24%)

Query: 99  AEPLFHD----FMRGYNCTMLVYGMTSTGKTYTMTGDVEMGAEGDVNGQAGIAPRILVKL 154
            EPL  D      RG +C+M+ YG ++TGKT+ +   V            GI P  + +L
Sbjct: 65  PEPLVIDNINELTRGVDCSMVTYGQSATGKTHVLFDQVR-----------GIIPLFIEQL 113

Query: 155 F 155
           +
Sbjct: 114 Y 114

 Score = 35.4 bits (80), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 54/126 (42%), Gaps = 19/126 (15%)

Query: 309 SRSHTIFTITL-YKKFKDDLYRLSKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTL 367
           S  HT   I+L      +D +R   I  VDL   E+V                 Q + +L
Sbjct: 192 STFHTFVKISLQLVNCHEDSFRKCCIEFVDLCAQEDVL----------------QLVCSL 235

Query: 368 GRVINSLADKSAHIPFRESKLTRLLQDSLGGNTKTVLIATISPAKIAAEETCSTLEYASK 427
             V+++  DK   I   +S+  +LL +S+GGN KT  I   S  +   + +  TLE+  K
Sbjct: 236 VAVLSNDNDKK--IGKEKSQFCKLLSNSIGGNRKTTFILACSTLEQNEKISLETLEFGLK 293

Query: 428 AKNIKN 433
              + N
Sbjct: 294 VSQVVN 299

>KNAG0H00360 Chr8 (51965..54010) [2046 bp, 681 aa] {ON} Anc_2.633
           YKL079W
          Length = 681

 Score = 36.6 bits (83), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 49/115 (42%), Gaps = 6/115 (5%)

Query: 72  AQLQAKTYTVDKVYGPDSSQKLVFEDCAEPLFHDFMRGYNCTMLVYGMTSTGKTYTMTGD 131
            +L  ++++  KV    +++   F + A  +  D + G NC +  YG      +  M G 
Sbjct: 83  VKLGEQSFSFSKVLNDQATKTEQFTELASKVTDDVLSGINCCVTTYGSGLAADSLVMFGP 142

Query: 132 VEMGA--EGDVNGQAGIAPRILVKLFECLQDD----YVVKCSFVELYNEDLRDLL 180
               +  E D +  +G+  +    +F  +  D    Y V  S  E+Y + + DLL
Sbjct: 143 QSGNSKEEQDSSRCSGLLQQTCKHIFNAIDSDSTSEYQVSLSLCEVYVDKVFDLL 197

>NDAI0J00530 Chr10 complement(102751..106920) [4170 bp, 1389 aa]
           {ON} Anc_7.488 YBL047C
          Length = 1389

 Score = 35.8 bits (81), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 49/87 (56%), Gaps = 7/87 (8%)

Query: 487 FKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSEL-------DNLRSQLKSVTNK 539
            +++L+ L++T+DS V+E E L  +     ++ +SLK +L         + S+L  +T +
Sbjct: 624 IESKLSTLRKTHDSNVKETESLESQLVQSNKQTESLKQQLAVTEANYHAIESKLNELTEQ 683

Query: 540 LAQTNTQNTKLSEQVTDMNRIQTELKS 566
           L+ +   N  L EQ+T++N +   L+S
Sbjct: 684 LSTSQETNNTLKEQITNLNSMMATLQS 710

>KLTH0D08844g Chr4 (738727..739749) [1023 bp, 340 aa] {ON} similar
           to uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 340

 Score = 35.0 bits (79), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 46/195 (23%), Positives = 87/195 (44%), Gaps = 19/195 (9%)

Query: 635 NAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYL 694
           ++E LY + ++ L +E P+    I   VG IR + E  Y+    +FS L        +YL
Sbjct: 68  DSEVLYGAALESLKEELPRENYFICTKVGRIR-LEEFDYSRSHIHFSVLRSCERLKTKYL 126

Query: 695 DGQFFQNNHIEMIQTHQDIVA-SNMQKMSDD---LLQSVQNSIQNYLSTNAQMVTNSIND 750
           D  F  +  +E ++T Q + A   ++K+ D+   L   +     ++L   A         
Sbjct: 127 DVVFLHD--VEFVETEQVLEALQELRKLRDEGVILNFGISGYPVDFLLNIALKCKTHPQI 184

Query: 751 VAMDVI---------NKEMDLFAPKKSKWEESIDLINQSDSLS-NKFRNNMTKSVDDIAS 800
            A+DV+         N+ +  +AP+  + E  + ++     LS +  R+  TK+    ++
Sbjct: 185 GALDVVLSYANLNLQNRTLHEYAPRFRE-EAGVKVVENGSILSMSLLRSQETKAFHPCSA 243

Query: 801 VIRN-SNESMDRSIS 814
            +R  SNE+   + S
Sbjct: 244 ELRKLSNEAAQYAAS 258

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 35.0 bits (79), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 61/252 (24%), Positives = 112/252 (44%), Gaps = 41/252 (16%)

Query: 483 DLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQ 542
           D DN    +  +K  N+ L  E +L+ KE         + K+E D L SQL  V NKL Q
Sbjct: 381 DTDNLNGHIQSIKNDNNKLENEIQLVKKENSKLETEVKTSKNETDKLSSQLNQVKNKLIQ 440

Query: 543 TNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELAT---------- 592
                  L +Q+ +    Q  +K  +++ +++++   ++   LLK+E  +          
Sbjct: 441 KEKTVIYLEKQIKEYAENQEPVKQAMDLLKRENKQLSNRID-LLKNENESLNNDLKKNSS 499

Query: 593 -----------LTAKI---LSQWDTLKNVNSGNYQIHTHIDSIRGEV----MNLLETTK- 633
                      LT +I     ++DTL+N+ + +     H+DSI+ +     + L E  K 
Sbjct: 500 TYEDYLKENGKLTERIDILQEKYDTLQNLKNNS---SDHMDSIKKQCEELNVKLREANKK 556

Query: 634 ----ENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNT 689
               E+  + Y S I D  +E   + +L+S++  D +   +E  T++    + + +E N 
Sbjct: 557 IISLEDELSDYTSIIQDKAREADTMRRLLSESNNDEKNKLDEMETKL----NSMIDENNN 612

Query: 690 FKQYLDGQFFQN 701
            K  L+ Q  +N
Sbjct: 613 LKSELNLQSSRN 624

>TPHA0I02920 Chr9 (639184..642786) [3603 bp, 1200 aa] {ON} Anc_7.488
           YBL047C
          Length = 1200

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 69/130 (53%), Gaps = 5/130 (3%)

Query: 508 LGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQTELKSL 567
           L  + KS  E +++  +EL NL +Q+ S++ + A TN +  K S+++  +N  + ++++ 
Sbjct: 631 LFADSKSSLELSNA-TTELANLSNQVNSLSKQAAITNEKKNKASQELRTLNETKLKVENR 689

Query: 568 IEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIHTHIDSIRGEVMN 627
           I   +  HE +  + Q+ L+  LA + A+      TL+ V S + Q+ T    +     N
Sbjct: 690 INALRAAHEQNSMQTQK-LEASLAQIMAENEQLETTLQEVTSTHTQLQTDAQLLDE---N 745

Query: 628 LLETTKENAE 637
           L +T  +N+E
Sbjct: 746 LTKTQTQNSE 755

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 1/87 (1%)

Query: 511 EKKSGAERADSLKSELDNLRSQLKSVTNKL-AQTNTQNTKLSEQVTDMNRIQTELKSLIE 569
           E +   ++ + +K+E DNL S+L    N L  Q  ++  +L   +   NR+  +LK  + 
Sbjct: 688 ESRELTKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELH 747

Query: 570 VYQQKHETSKHKFQRLLKDELATLTAK 596
             ++KH   KH+ +  L+  L  L +K
Sbjct: 748 ALKKKHLLEKHEHEVELRKMLTILNSK 774

>KNAG0M01260 Chr13 complement(231670..233970) [2301 bp, 766 aa] {ON}
           Anc_5.123 YLR045C
          Length = 766

 Score = 33.9 bits (76), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 7/55 (12%)

Query: 478 KEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQ 532
           ++ V  +     E  EL+R ND L+Q+NE L +       + D+L+SELD  R +
Sbjct: 611 EQYVRQIKTLTEEKAELRRANDVLIQDNESLKR-------KLDALQSELDQWRQK 658

>KNAG0L02080 Chr12 complement(371331..373340) [2010 bp, 669 aa] {ON}
           Anc_5.696 YIL144W
          Length = 669

 Score = 33.5 bits (75), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/161 (22%), Positives = 69/161 (42%), Gaps = 36/161 (22%)

Query: 599 SQWDTLKNVNSGNYQIHTHIDSIRGEV---------MNLLETT------------KENAE 637
           SQW     +     + ++ +DSIR +V          N+L+TT            K+N E
Sbjct: 196 SQWHKFLGLLHWFVKFNSRMDSIREQVDNVAINEPAQNILQTTRAAATVEEQDQIKQNYE 255

Query: 638 TLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEHYTEMARNFSDLSEEFNTFKQYLDGQ 697
            L +S +++   +T K+F L ++N G ++   E +  +  +              +LD  
Sbjct: 256 RLLESLVNEYTMDTYKLFLLRNENYGAMKAKFETNVEKFVQVI------------HLDIN 303

Query: 698 FFQNNHIEMIQTHQDIVASNMQ--KMSDDLLQSVQNSIQNY 736
             QN + E +  H D V    Q  +++ + L ++QN +  Y
Sbjct: 304 NLQNEN-EKLLAHYDTVLGKTQELRIAKEKLNNLQNDVAKY 343

>KNAG0F03650 Chr6 (681394..685188) [3795 bp, 1264 aa] {ON} Anc_7.488
           YBL047C
          Length = 1264

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 49/94 (52%), Gaps = 7/94 (7%)

Query: 488 KTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELD-------NLRSQLKSVTNKL 540
           +T+L  L+ T+D+ V++ E L  +     +  ++L+ EL+        ++ Q+  +  +L
Sbjct: 585 QTKLATLRSTHDANVKQTEQLQSQLVVANKETETLQGELNVVEANFNAMQGQINDLNGQL 644

Query: 541 AQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQK 574
            Q  T+N  L E++ + N     L++ +E  QQ+
Sbjct: 645 TQAQTENQTLKERINNFNAQAAALQTQLEEKQQQ 678

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 73/173 (42%), Gaps = 3/173 (1%)

Query: 496  RTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVT 555
            RT + +  E  +L    KS      +L+ +LD   SQ +S+  ++        K+  + +
Sbjct: 877  RTKEQVESELSVLDSSIKSLRGEKATLQKDLDKANSQQRSLVKRITNFQKNAEKVLLKKS 936

Query: 556  DMNRIQTELKSLIEVYQQKHETSKHKFQRLLKDELATLTAKILSQWDTLKNVNSGNYQIH 615
             +N  + EL+ LI       E S  K++ L  DE+             + NVN    + +
Sbjct: 937  TLNSRKEELQQLIREVGLLAEESLKKYKPLASDEILKKLNTTTGHLSKMTNVNKRASENY 996

Query: 616  THIDSIRGEVMNL---LETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDI 665
            T  +  RGE+ +    L+ +K++ E L     +  +    K F  ++DN   +
Sbjct: 997  TRFEDKRGELTSRAEELDESKQSIENLIDQLKEQKITAIEKTFNKVADNFSRV 1049

>NCAS0C02830 Chr3 (534302..536926) [2625 bp, 874 aa] {ON} Anc_8.401
          Length = 874

 Score = 33.1 bits (74), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 40/72 (55%), Gaps = 6/72 (8%)

Query: 331 SKINLVDLAGSENVNKAGALNLRAKESGSINQSLLTLGRVINSLADKSAHI---PFRESK 387
           S+  +VD+ G++++ K+  +  +  E   +N SLLTLG+ IN+L      I   P  E  
Sbjct: 427 SEFTIVDMNGTQHLGKSQNVMPKTTE---LNSSLLTLGKSINNLNLDEMPIVISPLAEFL 483

Query: 388 LTRLLQDSLGGN 399
           + R L++S  GN
Sbjct: 484 IRRALKNSRLGN 495

>YBL047C Chr2 complement(127895..132040) [4146 bp, 1381 aa] {ON}
           EDE1Endocytic protein; involved in a network of
           interactions with other endocytic proteins, binds
           membranes in a ubiquitin-dependent manner, may also bind
           ubiquitinated membrane-associated proteins; interacts
           with Cmk2 and functions upstream of CMK2 in regulating
           non-apoptotic cell death
          Length = 1381

 Score = 33.1 bits (74), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 25/97 (25%), Positives = 52/97 (53%), Gaps = 7/97 (7%)

Query: 485 DNFKTELTELKRTNDSLVQENELL-------GKEKKSGAERADSLKSELDNLRSQLKSVT 537
           ++ + +L  L+ T+D  V++ E L        KE ++ A++    ++      S+L  +T
Sbjct: 642 NSIQIKLNNLRSTHDQNVKQTEQLEAQVLQVNKENETLAQQLAVSEANYHAAESKLNELT 701

Query: 538 NKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQK 574
             L ++ T+N +L EQ+T++N +   L+S +   QQ+
Sbjct: 702 TDLQESQTKNAELKEQITNLNSMTASLQSQLNEKQQQ 738

>KLTH0F16478g Chr6 (1337447..1337842) [396 bp, 131 aa] {ON} similar
           to uniprot|Q06333 YDR357C Saccharomyces cerevisiae
           Protein of unknown function
          Length = 131

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 37/82 (45%)

Query: 724 DLLQSVQNSIQNYLSTNAQMVTNSINDVAMDVINKEMDLFAPKKSKWEESIDLINQSDSL 783
           D + S+Q S         Q+V   I   A+D+  +EM     K  + E   D+++Q DS+
Sbjct: 46  DHVTSIQLSTTEICRQQNQLVEQGIIGDAIDINIEEMRRILQKCEELETHFDMLDQIDSI 105

Query: 784 SNKFRNNMTKSVDDIASVIRNS 805
              FR  +   V +   + RN+
Sbjct: 106 VQTFRPRLDDIVREHRELTRNT 127

>KLLA0E05787g Chr5 (515081..518767) [3687 bp, 1228 aa] {ON} weakly
           similar to uniprot|P34216 Saccharomyces cerevisiae
           YBL047C EDE1 Key endocytic protein involved in a network
           of interactions with other endocytic proteins binds
           membranes in a ubiquitin-dependent manner may also bind
           ubiquitinated membrane-associated proteins
          Length = 1228

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/104 (20%), Positives = 55/104 (52%)

Query: 476 NYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKS 535
           +Y E V   +  +T+L  L+  N+ L Q+  +      +   + + L+++L   + + + 
Sbjct: 621 SYNEEVRQTEEIQTQLNALRAQNEELSQQASVAEANYHAVQTQNEDLQTQLQQAQEEERQ 680

Query: 536 VTNKLAQTNTQNTKLSEQVTDMNRIQTELKSLIEVYQQKHETSK 579
           +  +LAQ NT +++L +Q+ ++       +S ++++ ++ E S+
Sbjct: 681 LKERLAQFNTLSSQLQQQLAEVQENAKAERSRVDIHAKQLELSE 724

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score = 32.7 bits (73), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 8/63 (12%)

Query: 475 KNYKEMVDDLDNFKTELT----ELKRTNDSLVQENELLGKEKKSGAERADSLKSELDNLR 530
           +NY ++ +D +  K EL+    E+KR  + + +ENEL  K      E AD L  E+++L 
Sbjct: 50  ENYNQLKEDYNTLKRELSDRDDEVKRLREDIAKENELRTK----AEEEADKLNKEVEDLT 105

Query: 531 SQL 533
           + L
Sbjct: 106 ASL 108

>KLLA0D09394g Chr4 (795025..797436) [2412 bp, 803 aa] {ON} similar
           to uniprot|P47061 Saccharomyces cerevisiae YJL029C VPS53
           Required for Vacuolar Protein Sorting Vps53p is a
           hydrophilic protein that is peripherally associated with
           the late Golgi and forms a stable complex with Vps52p
           and Vps54p.
          Length = 803

 Score = 32.7 bits (73), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 9/81 (11%)

Query: 620 SIRGEVMNLLETTKENAETLYKSCIDDLLKETPKIFQLISDNVGDIRGMTEEH--YTEMA 677
           +++  +  L +T K   E + + C+D LL E  +IFQ I D  G +  ++  +  + ++ 
Sbjct: 195 TMKDGICCLADTNKHYKERIVQLCLDSLLYEIKEIFQ-IDDEAGSLENLSRRYIFFKKVL 253

Query: 678 RNFSDLSEEFNTFKQYLDGQF 698
            NF       +TF +Y   ++
Sbjct: 254 NNFQ------STFSEYFPSEW 268

>KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7.153
           YIR002C
          Length = 994

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 36/80 (45%), Gaps = 5/80 (6%)

Query: 845 QEKSNNILHLVTGDLTVTAQESMDGIQNLDRSIRTLIHGDQYIHSTKGVHIPPQNRGPEL 904
           +++  +IL L + + +   +++M    NL + I       +Y+       I P +R PE 
Sbjct: 611 RKREGHILLLFSSNESYKFEQAMTDYSNLQKLI-----SQEYVECKPSDRILPTDRVPEC 665

Query: 905 HSTLIPLKPSSSNLNRLSDS 924
           H T I +      L R+ D+
Sbjct: 666 HKTFIAVNEEDEELTRMDDT 685

>TDEL0E00710 Chr5 (152143..153573) [1431 bp, 476 aa] {ON} Anc_3.62
           YNL295W
          Length = 476

 Score = 32.3 bits (72), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 64/145 (44%), Gaps = 15/145 (10%)

Query: 495 KRTNDSLVQENELLGKEKKSGAERADSLKSELDNLRSQLKSVTNKLAQTNTQNTKLSEQV 554
           K  +DSL+       KE K  A +   +KS+   L+++   +   LA+   + T LS   
Sbjct: 257 KAHHDSLIDSRRNYEKELKGFAYKHKFIKSDQKILKNEADKLNRMLAKEFYKQTNLS--- 313

Query: 555 TDMNRIQTELKSLI---EVYQQKHETSKHKFQRLLKDELAT----LTAKILSQWDTLKNV 607
                I+TE    I    +Y  K   S+  F+  LK +L T    + + IL+ +D  +  
Sbjct: 314 -----IKTEFSGNILPLYIYVDKSIVSRRLFRSFLKKQLTTHMEPVLSAILASYDNQEWA 368

Query: 608 NSGNYQIHTHIDSIRGEVMNLLETT 632
           +  + ++   I+ +  E+ N L + 
Sbjct: 369 DRFHAKVKLKINKLVCEIPNFLPSV 393

>TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {ON}
           Anc_8.435 YLR222C
          Length = 805

 Score = 32.3 bits (72), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 128 MTGDVEMGAEGDVNGQAGIAPRILVKLFECLQD--DYVVKCSFVELYNEDLRDLLSEGQD 185
           + GD  + A GD NG A +   +  +    +Q+    +    F E+  ED   LLS G+D
Sbjct: 155 LNGDKWLLASGDTNGVAKVWDLVKRRCLHTMQEHTSAIRGLDFKEVEGEDCVKLLSGGRD 214

Query: 186 DFSNGTENSSKQPESL 201
           D  N  E + K+   L
Sbjct: 215 DIVNLWEFNMKKHSKL 230

>ZYRO0B12144g Chr2 complement(976039..982056) [6018 bp, 2005 aa]
           {ON} similar to uniprot|P25386 Saccharomyces cerevisiae
           YDL058W USO1 involved intracellular protein transport
           coiled-coil protein necessary for protein transport from
           ER to Golgi Integrin analogue gene
          Length = 2005

 Score = 32.0 bits (71), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 52/100 (52%), Gaps = 3/100 (3%)

Query: 463 CTKSKEGIYVSQKNYKEMVDDLDNFKTELTELKRTNDSLVQENELLGKEKKSGAERADSL 522
           C + KEGI   + +    + DL+    +L  L   ++ L +E+E+L K+    +E+   +
Sbjct: 698 CHELKEGIKKLESDSNTSLLDLEK---KLHSLNEEHEKLNKEHEVLQKDHSEASEQLSKI 754

Query: 523 KSELDNLRSQLKSVTNKLAQTNTQNTKLSEQVTDMNRIQT 562
           + E   LR  L++VTN+    +++NTK  + +   N+  T
Sbjct: 755 RQECKELRDTLQAVTNERDNLSSENTKKQKALETANQTNT 794

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 94,479,747
Number of extensions: 4176046
Number of successful extensions: 24006
Number of sequences better than 10.0: 1409
Number of HSP's gapped: 23761
Number of HSP's successfully gapped: 2180
Length of query: 950
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 831
Effective length of database: 39,836,145
Effective search space: 33103836495
Effective search space used: 33103836495
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)