Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0M010206.65ON27927913090.0
NCAS0F003306.65ON2812346819e-89
ZYRO0D14190g6.65ON2952546646e-86
Kpol_1042.116.65ON2922436602e-85
Smik_15.3526.65ON2881976576e-85
YOR174W (MED4)6.65ON2841976567e-85
KAFR0G025006.65ON2892866462e-83
Skud_15.3366.65ON2862006376e-82
Suva_8.2276.65ON2872336332e-81
NDAI0J013206.65ON3342226233e-79
CAGL0L04620g6.65ON2642656009e-77
TBLA0G005506.65ON3182466022e-76
SAKL0A08426g6.65ON2991735924e-75
TPHA0F025906.65ON3062335587e-70
AGR270W6.65ON2942485448e-68
Kwal_56.232426.65ON2562115242e-65
KLTH0G15444g6.65ON2632435165e-64
KLLA0F20185g6.65ON2851715091e-62
Ecym_31246.65ON2742554611e-55
TDEL0G040606.65ON2201644525e-55
TBLA0C056701.162ON62787780.27
KNAG0E024802.467ON49365740.86
KNAG0C065905.702ON165178693.2
ZYRO0E06226g2.563ON37342684.1
KNAG0F033905.296ON875194684.6
Kwal_23.30072.202ON117084675.5
TDEL0B065202.563ON31442666.3
KLTH0G05500g5.603ON57939668.5
SAKL0B01408gsingletonON258112658.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0M01020
         (279 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   508   0.0  
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   266   9e-89
ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   260   6e-86
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   258   2e-85
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   257   6e-85
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   257   7e-85
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   253   2e-83
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   249   6e-82
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   248   2e-81
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   244   3e-79
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   235   9e-77
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   236   2e-76
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   232   4e-75
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   219   7e-70
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   214   8e-68
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   206   2e-65
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   203   5e-64
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   200   1e-62
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   182   1e-55
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   178   5e-55
TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa] ...    35   0.27 
KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.4...    33   0.86 
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    31   3.2  
ZYRO0E06226g Chr5 complement(470767..471888) [1122 bp, 373 aa] {...    31   4.1  
KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {O...    31   4.6  
Kwal_23.3007 s23 (112418..115930) [3513 bp, 1170 aa] {ON} YOR086...    30   5.5  
TDEL0B06520 Chr2 complement(1155556..1156500) [945 bp, 314 aa] {...    30   6.3  
KLTH0G05500g Chr7 (440283..442022) [1740 bp, 579 aa] {ON} weakly...    30   8.5  
SAKL0B01408g Chr2 (134109..134885) [777 bp, 258 aa] {ON} some si...    30   8.9  

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/279 (91%), Positives = 254/279 (91%)

Query: 1   MAPAVERHEGNLAVSAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALV 60
           MAPAVERHEGNLAVSAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALV
Sbjct: 1   MAPAVERHEGNLAVSAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALV 60

Query: 61  ESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEK 120
           ESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEK
Sbjct: 61  ESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEK 120

Query: 121 LNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGP 180
           LNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGP
Sbjct: 121 LNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGP 180

Query: 181 NNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSS 240
           NNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSS
Sbjct: 181 NNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSS 240

Query: 241 FVFGDTSTXXXXXXXXXXXXXXXXXXXXXXXXXFNPDEF 279
           FVFGDTST                         FNPDEF
Sbjct: 241 FVFGDTSTADDQKSSSAHSDHDDDDAMDLDLDLFNPDEF 279

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  266 bits (681), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 171/234 (73%), Gaps = 5/234 (2%)

Query: 14  VSAGHKRASSVSLLQEGTDAAALA---EDLKKVRIYSGIVEYEDTLAALVESVDSYKPDM 70
            S GH R+SSVSLL E  +  +++   +D+ KV+IYS +  YE  LA LV SVD +KPDM
Sbjct: 13  TSMGHIRSSSVSLLAE-VNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDM 71

Query: 71  AVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNK 130
             A+ L++ D+ LF +LD F+EYD+I   L +L  +S  LD +T++IL  LNECHDELN 
Sbjct: 72  NAARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNA 131

Query: 131 LPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDA 190
           LP L+QV+FEM+TIL+QR KINSS LLDYATKLSKFT+IPPTFDKGSIGPNNFIWPAEDA
Sbjct: 132 LPMLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDA 191

Query: 191 LRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSSFVFG 244
           LR+GMLA+A+LH+ ELT+ PG  + E++        + +  PVT  RR SF F 
Sbjct: 192 LRRGMLALASLHADELTKAPGAHEGEEELIPKGSEPIAQEEPVT-TRRESFTFS 244

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  260 bits (664), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 131/254 (51%), Positives = 175/254 (68%), Gaps = 21/254 (8%)

Query: 14  VSAGHKRASSVSLLQEGTDAAALAED-LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAV 72
           +S GH R+SS SL+ +   +    +D L KV+IY+ + +YE+ LAALVESVD++KPD+ +
Sbjct: 16  LSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKI 75

Query: 73  AQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLP 132
              L++ DK L+ SLD F EYD I + L  L  +S  LD KT+++LE L+EC++ LN LP
Sbjct: 76  VHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLP 135

Query: 133 YLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 192
            LEQV+FE  +IL+QR K+NSS LL+YATKLSKFT+IPPTFDKG+IGPNNF+WPAEDALR
Sbjct: 136 MLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALR 195

Query: 193 KGMLAIAALHSRELTRIPGQDDAE------------------DKKKQTEKPDVPEPAPVT 234
           +GMLAIA+LHS+E+TRIPG+ + E                  ++ K  E+P    P    
Sbjct: 196 RGMLAIASLHSKEMTRIPGEPEEEEADATEKQGSGDKNGKEGEETKTGERP--ASPGAHG 253

Query: 235 EERRSSFVFGDTST 248
            ERR SFVF +  T
Sbjct: 254 NERRQSFVFTENPT 267

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  258 bits (660), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 174/243 (71%), Gaps = 13/243 (5%)

Query: 17  GH-KRASSVSLLQEGTDAAAL-----------AEDLKKVRIYSGIVEYEDTLAALVESVD 64
           GH K  SSVSL+ + T++ +            + DL KV+IY+ I EYE+TL  LVESVD
Sbjct: 7   GHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESVD 66

Query: 65  SYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNEC 124
            +KPD+ +A +L+D D+ LF SLD F EYD+IST+L E   ++  LDTKT++IL  LNEC
Sbjct: 67  KFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNEC 126

Query: 125 HDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFI 184
           H  LN LP LEQV+FE D IL+QR KINS  LLDYATKLSKFT+IPPTF+KGSIGPNNFI
Sbjct: 127 HGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNFI 186

Query: 185 WPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPAPVTEERRSSFVFG 244
           WPAEDALR+GMLA+A+LHS+ELT++P + +   +  ++ +PD     P+ EE+ +    G
Sbjct: 187 WPAEDALRRGMLAMASLHSKELTKLPNEPEEASEPDKSTEPD-KSTEPIEEEKITVDNEG 245

Query: 245 DTS 247
           D S
Sbjct: 246 DIS 248

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  257 bits (657), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 151/197 (76%)

Query: 15  SAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQ 74
           S GH ++SSVSL+ E T      + L KV++Y  +  YEDTL  LVESVD +KPD+ VA+
Sbjct: 12  SMGHMKSSSVSLVVEATSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRFKPDIDVAR 71

Query: 75  RLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYL 134
            L+  D+ LF ++D   EYD I   L ++   S  LD+KT+ ILE +NECHDEL  LP L
Sbjct: 72  DLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHDELGALPML 131

Query: 135 EQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKG 194
           EQV+FE +TIL+QR KINS+ LLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR+G
Sbjct: 132 EQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRRG 191

Query: 195 MLAIAALHSRELTRIPG 211
           MLA+A+LHS+ELTR+PG
Sbjct: 192 MLAMASLHSKELTRVPG 208

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  257 bits (656), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 122/197 (61%), Positives = 152/197 (77%)

Query: 15  SAGHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQ 74
           S GH R+SSVSL+ E T      + L KV++Y  +  YEDTL+ LVESVD +KP++ +A+
Sbjct: 12  SMGHIRSSSVSLVAEATSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRFKPNLDIAK 71

Query: 75  RLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYL 134
            L+  D+ LF ++    EYD I   L ++   S  LD+KTR ILE LNECHDEL  LP L
Sbjct: 72  DLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHDELKALPML 131

Query: 135 EQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKG 194
           EQV+FE +TIL+QR KINS+ELLDYATKLSKFT+IPPTFDKG++GPNNFIWPAEDALR+G
Sbjct: 132 EQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWPAEDALRRG 191

Query: 195 MLAIAALHSRELTRIPG 211
           MLA+A+LHS+ELTRIPG
Sbjct: 192 MLAMASLHSKELTRIPG 208

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  253 bits (646), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 137/286 (47%), Positives = 183/286 (63%), Gaps = 20/286 (6%)

Query: 14  VSAGHKRASSVSLLQE----------GTDAAALAE-DLKKVRIYSGIVEYEDTLAALVES 62
           ++ GH+++SS+SLL E            D+A+ A   + KV IYS + +YE+TL+ L++S
Sbjct: 4   LTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLIQS 63

Query: 63  VDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLN 122
           +D+YKPD  +AQ L+D D +LF SLD F +YD IS+RL + + +      KT++ILE LN
Sbjct: 64  IDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILETLN 123

Query: 123 ECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNN 182
           ECH+ LN LP ++QV FEM+T+LEQR+KINSS LLDYATKLSKFT+IPPTFDKGSIGPNN
Sbjct: 124 ECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNN 183

Query: 183 FIWPAEDALRKGMLAIAALHSRELTRIPG-----QDD---AEDKKKQTEKPDVPEPAPV- 233
           F+WPAEDALR+GMLA+AA H+ ELT+I G      DD   A D+ K  +  + P P    
Sbjct: 184 FVWPAEDALRRGMLALAASHTDELTKIAGVEMSLSDDNSIALDEIKSVDAGEGPIPEKKD 243

Query: 234 TEERRSSFVFGDTSTXXXXXXXXXXXXXXXXXXXXXXXXXFNPDEF 279
           +  RR S++F   S                          FNPD+F
Sbjct: 244 SSSRRGSYIFAGQSGKNAEHKNNEENKEEADNAVDLDLDLFNPDDF 289

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  249 bits (637), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 153/200 (76%)

Query: 17  GHKRASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRL 76
           GH ++SSVSL+ E        + L KV++Y  +  YE  L+ LVESVD +KPD+ VA+ L
Sbjct: 14  GHIKSSSVSLVAEAASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARDL 73

Query: 77  VDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQ 136
           + AD+ LF ++    +YD I   L ++   S  LD+K+R ILE LNECHDEL+ LP LEQ
Sbjct: 74  ISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLEQ 133

Query: 137 VQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGML 196
           V+FE +TIL+QR KINS+ LLDYATKLSKFT+IPPTFDKG++GPNNFIWPAEDALR+GML
Sbjct: 134 VEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGML 193

Query: 197 AIAALHSRELTRIPGQDDAE 216
           A+A+LHS+ELTR+PG+D+ E
Sbjct: 194 AMASLHSKELTRVPGEDEQE 213

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  248 bits (633), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 125/233 (53%), Positives = 163/233 (69%), Gaps = 8/233 (3%)

Query: 20  RASSVSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDA 79
           R+SSVSL+ E T +        KV++Y  +  YED L  LVESVD +KP++ +A+ L+  
Sbjct: 17  RSSSVSLVAEATSSMNSEHKSSKVQLYEDLCRYEDILGKLVESVDRFKPNLEIAKDLIKT 76

Query: 80  DKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQF 139
           D+ LF ++    +YD+I   L ++   S  LD+KTR ILE LNECHDEL+ LP LEQV+F
Sbjct: 77  DESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHDELSALPMLEQVEF 136

Query: 140 EMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIA 199
           E  TIL+QR KINS+ LLDYATKLSKFTRIPPTFDKG++GPNNFIWPAEDALR+GMLA+A
Sbjct: 137 EKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWPAEDALRRGMLAMA 196

Query: 200 ALHSRELTRIPGQDDAED--------KKKQTEKPDVPEPAPVTEERRSSFVFG 244
           +LHS+ELTRIPG+++ E          + Q EK +  E +P     + SF+F 
Sbjct: 197 SLHSKELTRIPGEEEQETEEVPTDTLSQPQKEKKESSENSPQNSPTKDSFIFN 249

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  244 bits (623), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 159/222 (71%), Gaps = 14/222 (6%)

Query: 13  AVSAGHKRASSVSLLQE----GT----------DAAALAEDLKKVRIYSGIVEYEDTLAA 58
             SA H RASSVSLL E    GT          D  +  + L +VRIY  I+ YE  L+ 
Sbjct: 35  TTSANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSR 94

Query: 59  LVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDIL 118
           L++SVD +KP++ +AQ L+ ADK LF +L+ F +YDEI   L  L+ K++ +D  T+  L
Sbjct: 95  LIDSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTL 154

Query: 119 EKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSI 178
           + LNECHD+LNKLP L Q++FE++TIL QR KINS+ LLDYATKLSKFT+IPPTFDKGSI
Sbjct: 155 QTLNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSI 214

Query: 179 GPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKKK 220
           GPNNFIWPAED+LR+GMLA+A+L + +LT IPGQ  +  K+K
Sbjct: 215 GPNNFIWPAEDSLRRGMLAMASLKADQLTYIPGQAQSMSKEK 256

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  235 bits (600), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 122/265 (46%), Positives = 171/265 (64%), Gaps = 10/265 (3%)

Query: 24  VSLLQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKEL 83
           +SL+ E        ++L KV++YS +  YE+ L  LV+SVD++KP + + ++L++ADK+L
Sbjct: 1   MSLVAESNSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 84  FASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDT 143
           +++LD   +YD + TRL  L  + + +D +T++IL  LNECHD+LN LP LE+V+FE   
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 144 ILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHS 203
           IL+QREKI S+ LL+YATKL+KFT+IPPTFDKG+IGPNNFIWPAEDALRKGMLA+A+LH 
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 204 RELTRIPGQDDA-EDKKKQTEKPDVPEPAPVTE--------ERRSSFVFGDTSTXXXXXX 254
           +ELT++PGQ+D  ED     E  ++ + A   E        +   SFVFG  +       
Sbjct: 181 KELTKLPGQEDGEEDGSTANEDKNIVKDAEGAEGEIRQDDKKEDDSFVFG-ANANDAEGD 239

Query: 255 XXXXXXXXXXXXXXXXXXXFNPDEF 279
                              FNPDEF
Sbjct: 240 EDKNAGEDEDEAMDSDLDLFNPDEF 264

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  236 bits (602), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 168/246 (68%), Gaps = 21/246 (8%)

Query: 17  GHKRASSVSL-----LQEGTDAAALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMA 71
           GH +  S S+     LQ+  D     ++L K++ Y+ +++YE+TL+ L  SVD YKPD+ 
Sbjct: 12  GHHKTLSTSISEGDVLQDNNDKN---DELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQ 68

Query: 72  VAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKL 131
            A  L+D D++L+++LD F +YDEIST+L +L+  + ALD KT+ +L+ LN+CH+ LN L
Sbjct: 69  YAYDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTL 128

Query: 132 PYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDAL 191
           P LEQV+FE +T+L+QREKINS  LLDYATKL+KFT+IPPTF+K ++GPNNFIWPAEDAL
Sbjct: 129 PMLEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDAL 188

Query: 192 RKGMLAIAALHSRELTRIPGQDDAEDKKK---QTEKPDVPEP-----APVTEE-----RR 238
           R+GMLA+A+ H+ ELT +PG    E+  K   Q    DV          +T E     RR
Sbjct: 189 RRGMLAVASAHTEELTALPGSVGDEENSKDISQLNADDVTNKDNHMDMDITVEGQDRFRR 248

Query: 239 SSFVFG 244
            SF FG
Sbjct: 249 GSFTFG 254

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  232 bits (592), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 137/173 (79%)

Query: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99
           L +V +Y+ I EYE+TL  LV SVD +KPD+ VAQ L++ DK+LF +L++F +YD+I  R
Sbjct: 44  LSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKYDKIDGR 103

Query: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159
           L +L+ +S  +D KT  ILE LN CH +LN LP LEQV  E DT+L+QREKI S  LLDY
Sbjct: 104 LNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYSGVLLDY 163

Query: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQ 212
           A KL+KFTR+PPTFDKG +GPNNFIWPAEDA+R+GMLA+A+L S+ELTRIPGQ
Sbjct: 164 AMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPGQ 216

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  219 bits (558), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 158/233 (67%), Gaps = 12/233 (5%)

Query: 22  SSVSLLQEGTDA---AALAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVD 78
           S+ + + +GT +    A  + L  V IY+ I  YEDTL  LV S+D+++PD+ VA+ L++
Sbjct: 36  STANNISQGTASNMNTAAVDSLANVAIYNDIKNYEDTLIKLVSSIDNFRPDVEVAKTLIE 95

Query: 79  ADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQ 138
            DK L+ +L  FKEYDEI T++ ++K  S  LD +T+ IL+ LN+  + LN LP LE++ 
Sbjct: 96  VDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDSRNMLNSLPMLEEIY 155

Query: 139 FEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAI 198
           FE D + E+++KINS  LLDYATK+SKFT+IPPTF+KGSIGPNNFIWPAEDALR+GMLA+
Sbjct: 156 FERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFIWPAEDALRRGMLAV 215

Query: 199 AALHSRELTRIPGQDDAEDKKKQ--------TEKPDVPEPAPVTEERRSSFVF 243
           A++H  ELT++P  D + D  K+            +    A V +E+  SFVF
Sbjct: 216 ASIHRSELTKLPN-DTSYDSDKELEEQQEQEQHGTENTREADVEQEQEESFVF 267

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  214 bits (544), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 155/248 (62%), Gaps = 8/248 (3%)

Query: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99
           L  V IY  + +YE++L  LV SVD ++PD+  AQ L++ D +L+++L +  +YD I ++
Sbjct: 47  LHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLIDSQ 106

Query: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159
           L +L+ +S  +D +T  IL  L EC+++LN LP +EQV+FEM T+ +Q++K+NSS LL+Y
Sbjct: 107 LKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLLEY 166

Query: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAE--- 216
           A KLSKFTR+PPTF+K +IGPNNFIWPAEDA+R+GMLA+A+L S+ELT +PGQ D E   
Sbjct: 167 AMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPGQSDQEAEQ 226

Query: 217 ---DKKKQTEKPDVP--EPAPVTEERRSSFVFGDTSTXXXXXXXXXXXXXXXXXXXXXXX 271
               K+  T  P V   EPA     RR SF F                            
Sbjct: 227 ASAGKEADTAGPGVSTLEPANGGHNRRGSFEFTGIRKPPPASDADSSVVDDGDASMDLDL 286

Query: 272 XXFNPDEF 279
             FNPDEF
Sbjct: 287 NLFNPDEF 294

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  206 bits (524), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 104/211 (49%), Positives = 139/211 (65%), Gaps = 2/211 (0%)

Query: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99
           L K +IYS I E+E+TL  LV SVD + PD+ +A+ L++ DK L  +L+    YDEI  R
Sbjct: 22  LSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRYDEIDLR 81

Query: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159
             EL  K    D +   ILE L EC  +LN LP LEQV+FE  T+L+QREK+ ++ LLDY
Sbjct: 82  AKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFTNVLLDY 141

Query: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIPGQDDAEDKK 219
           A KL+KFT +PPTFDKG++GPNNF+WPAEDA+R+GMLAIA+L + E  + P    A+  +
Sbjct: 142 AMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETGAAQTAE 201

Query: 220 KQTEKPDVPEPAPVTE--ERRSSFVFGDTST 248
           + T++P       V E  +RR SF F  T T
Sbjct: 202 ETTKQPQSSPQLKVEEPMQRRDSFEFNGTGT 232

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  203 bits (516), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 114/243 (46%), Positives = 155/243 (63%), Gaps = 20/243 (8%)

Query: 12  LAVSAGHKRASSVSLLQEGTDAAALAED-LKKVRIYSGIVEYEDTLAALVESVDSYKPDM 70
           ++ S GH+          G D +   E+ L K+++Y+ I E+EDTL  LV SVD + PD+
Sbjct: 1   MSTSTGHRNP--------GPDRSDSVENPLSKLQVYNDICEFEDTLGKLVASVDRFNPDL 52

Query: 71  AVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNK 130
            +A+ L++ADK+L+ SL+   +YDEI TR   L  +    D KT  ILE L EC  +LN 
Sbjct: 53  ELARALIEADKQLYKSLECLPKYDEIDTRAKTLDEEHRDTDEKTIRILETLTECGSDLNA 112

Query: 131 LPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDA 190
           LP LEQV+FE +T+L+QREK+ +  LLDYA KL+KFT +PPTFDKG++GPNNF+WPAEDA
Sbjct: 113 LPMLEQVEFERETMLKQREKVFTDVLLDYAMKLAKFTHVPPTFDKGTVGPNNFVWPAEDA 172

Query: 191 LRKGMLAIAALHSRELTRIPGQDDAEDKKKQTEKPDVPEPA------PVTEE----RRSS 240
           +R+GMLAIA+L + E      Q  A  ++K +EK    E A      P T+E    RR S
Sbjct: 173 MRRGMLAIASLRASEGANAQEQ-QASSEQKTSEKSSENEEAQTDIRSPDTKEEPVARRPS 231

Query: 241 FVF 243
           F F
Sbjct: 232 FGF 234

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  200 bits (509), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 130/171 (76%)

Query: 36  LAEDLKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDE 95
           ++E+L+ V IY  +  YE+T+  L +SVD++KPD+++  ++++ DK+L+ +L++F EY +
Sbjct: 28  VSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKVIECDKKLYETLEEFDEYYK 87

Query: 96  ISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSE 155
           I   L  L  +   +D KTR+ILE LN C++ LN+LP LEQV+FE   +L+QREKI+S  
Sbjct: 88  IEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQVEFEQKVMLKQREKIHSKV 147

Query: 156 LLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSREL 206
           +LDYA KL+KFTR PPTFDK  IGPNNFIWPAED+LRKGMLA+A+L  +EL
Sbjct: 148 VLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGMLAMASLKKKEL 198

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  182 bits (461), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 105/255 (41%), Positives = 150/255 (58%), Gaps = 17/255 (6%)

Query: 40  LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTR 99
           +++V +Y  + ++E+ L  LV SVD + PD+  AQ L+++D +L+++L++   YD I  +
Sbjct: 22  VQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQLPLYDSIDIQ 81

Query: 100 LGELKGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDY 159
           L +L  +S  +D +T  IL  L++C++ LNKLP +EQV+FEM  + +Q+EKI S  LL+Y
Sbjct: 82  LKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEKIKSGVLLEY 141

Query: 160 ATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELTRIP--------- 210
           A KL+KFTR+PPTF+K +IGPNNFIWPAEDA+R+GMLA+A+L S ELTRIP         
Sbjct: 142 AMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIPVELNSEEPQ 201

Query: 211 -----GQDDAEDKKKQTEKPDVPEPAPVTEERRSSFVF-GDTSTXXXXXXXXXXXXXXXX 264
                GQ   ED+   T   D P   P  + +  SF F G                    
Sbjct: 202 EPPQKGQSQEEDEVTPTHSSDTPSSKP--DSKSESFEFTGKAKNQQSTQYSETGAHEEAD 259

Query: 265 XXXXXXXXXFNPDEF 279
                    FNPDEF
Sbjct: 260 GSIDLDLDLFNPDEF 274

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  178 bits (452), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 116/164 (70%), Gaps = 3/164 (1%)

Query: 44  RIYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGEL 103
           ++Y  +  YE+ L  LVESVD ++PD++ A+ LV+AD+ L  SLDKF  YDE+   L  L
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 104 KGKSTALDTKTRDILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKL 163
             +S  L+  T   LE L+EC+  L+ LP LEQV+FE   +LEQR ++NS+ LL+YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 164 SKFTRIPPTFDKGSIGPNNFIWPAEDALRKGMLAIAALHSRELT 207
           SKFT+ P      ++GPNNF+WPAEDALR+G LA+AALHS E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>TBLA0C05670 Chr3 complement(1371536..1373419) [1884 bp, 627 aa]
           {ON} Anc_1.162 YKL179C
          Length = 627

 Score = 34.7 bits (78), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 6/87 (6%)

Query: 45  IYSGIVEYEDTLAALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELK 104
           IYS + E  D L  L  S++S K D +  Q L +    L       K+ + ++ +L E+K
Sbjct: 93  IYSKVSEVPDPLPLLKNSINSLKVDNSKDQELQNEINVLL------KDKESLNNQLNEIK 146

Query: 105 GKSTALDTKTRDILEKLNECHDELNKL 131
            K     TK ++ +E LN+  + LNKL
Sbjct: 147 EKQNEESTKLKNEIETLNKKLEILNKL 173

>KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.467
           YMR094W
          Length = 493

 Score = 33.1 bits (74), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 132 PYLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDAL 191
           PYLE  +++ + I+     +  S  L Y   +    R+  + D G +GP ++I+  ED L
Sbjct: 66  PYLEMFEYDPELIVTW---LQYSSWLRYDAVILDCLRLNHSLDAGIMGPFDWIYMGEDTL 122

Query: 192 RKGML 196
           + G  
Sbjct: 123 KIGYF 127

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 55   TLAALVESVDSYKPDMAVAQRLVDADKELFASLD-KFKEYDEISTRLGELKGKSTALDTK 113
            T+ +L ++V++   D    Q +++  K+    L  K +E+ E S  + ELK +  A+ +K
Sbjct: 1216 TINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSK 1275

Query: 114  TRDILEKLNECHDELNKL 131
             +DI  +LNE     N+L
Sbjct: 1276 NKDIEAELNETSKSSNQL 1293

>ZYRO0E06226g Chr5 complement(470767..471888) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q75DH2 Ashbya gossypii ABR054C
           ABR054Cp and weakly similar to YKL042W uniprot|P36094
           Saccharomyces cerevisiae YKL042W SPC42 Central plaque
           component of spindle pole body (SPB) involved in SPB
           duplication may facilitate attachment of the SPB to the
           nuclear membrane
          Length = 373

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 16/42 (38%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 66  YKPDMAVAQRLVDADKELFASLD-KFKEYDEISTRLGELKGK 106
           YK +  +  RL+  +KEL   LD K +E D ++  +G L+GK
Sbjct: 50  YKLNSRMINRLIRQNKELMNKLDGKQEEIDRLNVLVGSLRGK 91

>KNAG0F03390 Chr6 complement(635419..638046) [2628 bp, 875 aa] {ON}
           Anc_5.296 YDR285W
          Length = 875

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 82/194 (42%), Gaps = 36/194 (18%)

Query: 17  GHKRASSVSLLQEGTDAAALAEDLKK---------VRIYSGIVEYEDTLAALVESVDSYK 67
            H+ +S+  LL+  T+   +  +LK+         V++   +  Y+  +  L +  + Y 
Sbjct: 130 SHEASSNDVLLEAFTNTQRICSNLKQELQAKHNENVKLKGSLQNYQTDIKKLQDKFEQY- 188

Query: 68  PDMAVAQRLVDADKELFASLDKFK------------EYDEISTRLGELKGKSTALDTKTR 115
                  RL+ + +E   SL + K            +YD    ++ E KG+ ++L TK  
Sbjct: 189 ------HRLLSSLQEKATSLQQVKNTENSKLRDLTADYDTFKGKITEYKGEISSLHTKFN 242

Query: 116 DILEKLNECHDE-LNKLPYLEQVQFEMDTILEQ--REKINSSELLDYATKLSKFTRIPPT 172
           ++     +C  E L +   +E +Q E+D    Q   EKI +  + +    L +F     T
Sbjct: 243 ELQTAKRDCDTELLKRTKEIEYLQRELDDYSGQLSEEKIKNGNIFN---SLHQFKSEFKT 299

Query: 173 FDKGSIG--PNNFI 184
           F   +IG  P  F+
Sbjct: 300 FLLDTIGDKPKEFM 313

>Kwal_23.3007 s23 (112418..115930) [3513 bp, 1170 aa] {ON} YOR086C -
           Hypothetical ORF [contig 248] FULL
          Length = 1170

 Score = 30.4 bits (67), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 45/84 (53%), Gaps = 12/84 (14%)

Query: 86  SLDKFKEYDEISTRLGELKGKSTALDTKT--RDILEKLNECHDELNKLPYLEQVQFEMDT 143
           SL++ +E DEI+ +  +L+ + + +D KT  + I +KL E   E+           EM+ 
Sbjct: 790 SLEEIQEVDEINDKKKKLQERESEIDMKTVAKPIEQKLKEEKTEIK----------EMED 839

Query: 144 ILEQREKINSSELLDYATKLSKFT 167
           +  ++ K++  ELL Y + +  F+
Sbjct: 840 LFSKKLKLDLGELLQYKSGIFAFS 863

>TDEL0B06520 Chr2 complement(1155556..1156500) [945 bp, 314 aa] {ON}
           Anc_2.563 YKL042W
          Length = 314

 Score = 30.0 bits (66), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 1/42 (2%)

Query: 66  YKPDMAVAQRLVDADKELFASLD-KFKEYDEISTRLGELKGK 106
           Y+ +  +  RL+  +KEL   LD K +E D ++  +G L+GK
Sbjct: 45  YRLNSQMINRLIKQNKELILKLDGKQEEIDRLNILVGSLRGK 86

>KLTH0G05500g Chr7 (440283..442022) [1740 bp, 579 aa] {ON} weakly
           similar to uniprot|Q12433 Saccharomyces cerevisiae
           YOR023C AHC1 Ada Histone acetyltransferase complex
           component protein of the Ada histone acetyltransferase
           complex
          Length = 579

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 2/39 (5%)

Query: 92  EYDEISTRLGELKGKSTALDT--KTRDILEKLNECHDEL 128
           E++EI T LG ++ +   L+   K +D+LEK+N+  +EL
Sbjct: 152 EHNEIDTELGRVEAQMKVLEHMHKDKDLLEKVNQHQEEL 190

>SAKL0B01408g Chr2 (134109..134885) [777 bp, 258 aa] {ON} some
           similarities with uniprot|P23250 Saccharomyces
           cerevisiae YIL119C RPI1 Putative transcriptional
           regulator overexpression suppresses the heat shock
           sensitivity of wild-type RAS2 overexpression and also
           suppresses the cell lysis defect of an mpk1 mutation
          Length = 258

 Score = 29.6 bits (65), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 11/112 (9%)

Query: 58  ALVESVDSYKPDMAVAQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTAL--DTKTR 115
            ++ES+   KP     + +    KEL A  D FK + +   R   L  K+  L  D K  
Sbjct: 89  GILESLPLNKPRKKFWEHI---SKELLAQCDFFKNFRQCRDRFKSLFSKACNLPKDYKPH 145

Query: 116 DILEKLNECHDELNKLPYLEQVQFEMDTILEQREKINSSELLDYATKLSKFT 167
           +  EK+      + +LP L ++    D I   RE ++++ L     +LS  T
Sbjct: 146 NEREKM------MVQLPKLFKLGTNNDHITLNREAVDTTILRHLQAELSNLT 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,000,398
Number of extensions: 1073883
Number of successful extensions: 3930
Number of sequences better than 10.0: 136
Number of HSP's gapped: 4063
Number of HSP's successfully gapped: 140
Length of query: 279
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 171
Effective length of database: 41,097,471
Effective search space: 7027667541
Effective search space used: 7027667541
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)