Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L022005.712ON1161116155230.0
NCAS0G001705.712ON103083019840.0
NDAI0F002005.712ON110584819830.0
CAGL0H06721g5.712ON108182419210.0
Smik_9.135.712ON106083018710.0
TBLA0E017605.712ON121286318100.0
YIL156W (UBP7)5.712ON107184317380.0
TDEL0B020805.712ON102550314640.0
Skud_9.125.712ON106460414191e-177
Suva_9.305.712ON106249613681e-170
KLLA0A00396g5.712ON101250913311e-165
Kpol_2001.785.712ON40346512741e-164
KLTH0E00814g5.712ON97458812431e-152
ZYRO0B16544g5.712ON104459012321e-150
Ecym_40095.712ON151748912471e-148
SAKL0E15136g5.712ON10372719341e-107
TPHA0D046605.712ON10452489341e-107
Kwal_55.196455.712ON9702528668e-99
Suva_11.3355.712ON7242847912e-90
Skud_11.3385.712ON7122607752e-88
YKR098C (UBP11)5.712ON7172737743e-88
AFR296C5.712ON11692667941e-87
Smik_11.3625.712ON7212677655e-87
KAFR0D021605.712ON8462517641e-85
KAFR0H001505.712ON6562756603e-73
CAGL0G02563gsingletonON6312496195e-68
Kpol_304.65.712ON5622054831e-50
TBLA0F036108.188ON11442463018e-27
YER144C (UBP5)8.188ON8052452981e-26
TDEL0B042208.188ON8252412945e-26
Smik_4.3078.188ON9292372929e-26
TPHA0C027708.188ON9702432911e-25
Kpol_1032.288.188ON8822432892e-25
YDR069C (DOA4)8.188ON9262672882e-25
Skud_4.3238.188ON9262392874e-25
KAFR0C025908.188ON9782492831e-24
Suva_2.2288.188ON9272392821e-24
KNAG0D019308.188ON9862432784e-24
Smik_5.3098.188ON8052452757e-24
KLLA0E10275g8.188ON7962552703e-23
NDAI0A036808.188ON11162492713e-23
KLTH0H07678g8.188ON8612832695e-23
CAGL0I06765g8.188ON8872442686e-23
Kwal_14.20088.188ON4242452608e-23
AFR007W8.188ON8482822678e-23
NDAI0C059008.188ON8262692669e-23
ZYRO0G06798g8.188ON8772422642e-22
CAGL0G05247g8.188ON9472412632e-22
Suva_5.2728.188ON7882612622e-22
NCAS0B042808.188ON9222502623e-22
SAKL0H18986g8.188ON8932512614e-22
Skud_5.2818.188ON8232452605e-22
Ecym_61848.188ON8512482571e-21
NCAS0A039108.188ON7952792249e-18
Kpol_2001.541.137ON12232022025e-15
KNAG0G015908.188ON6712481853e-13
Skud_10.221.137ON12552031847e-13
YJL197W (UBP12)1.137ON12542041821e-12
ZYRO0C17908g1.137ON12042171792e-12
KNAG0C021801.137ON12312091793e-12
TDEL0C056401.137ON11782131783e-12
Smik_10.371.137ON12472041783e-12
NDAI0B004801.137ON12532151758e-12
Suva_6.2761.137ON12562041731e-11
AFR627C1.137ON12872031731e-11
TPHA0A025401.137ON12862051731e-11
KLTH0F03674g1.137ON11982001731e-11
NCAS0I031401.137ON12012011722e-11
CAGL0L01639g1.137ON11472031722e-11
Kwal_33.136281.137ON11601971613e-10
Ecym_81401.137ON12641981613e-10
KLLA0C03476g1.137ON12522011604e-10
KAFR0F015601.137ON11712141552e-09
NCAS0E026107.390ON7171231471e-08
TBLA0J006001.137ON14622201462e-08
Kpol_513.255.18ON11902451434e-08
Smik_2.497.390ON7451241416e-08
KNAG0C035807.390ON7761381416e-08
KNAG0B023707.390ON7531651391e-07
Skud_2.387.390ON7481221381e-07
ZYRO0B03300g7.390ON8131301363e-07
CAGL0A04477g7.390ON7701281353e-07
Suva_2.507.390ON7501241344e-07
TPHA0E008707.390ON7151221344e-07
NCAS0A143707.390ON7291241335e-07
YBL067C (UBP13)7.390ON7471241336e-07
KLTH0B07150g2.69ON7561121327e-07
CAGL0I05522g7.390ON7241241301e-06
KLLA0D08459g2.69ON7501391301e-06
TDEL0A011002.69ON6611561282e-06
ABL145W2.69ON7491321273e-06
YNL186W (UBP10)2.69ON7921231273e-06
CAGL0H10186g3.270ON7782411273e-06
Ecym_46857.390ON7781301273e-06
KNAG0F012202.69ON7841321263e-06
CAGL0J11352g2.69ON7711311263e-06
Smik_14.1442.69ON7631521263e-06
NDAI0E041807.390ON8271291264e-06
Suva_14.1562.69ON7881521264e-06
NCAS0I016203.270ON7952521254e-06
Skud_14.1482.69ON7761521255e-06
SAKL0E13002g2.69ON7391361246e-06
SAKL0C04246g1.137ON12971311247e-06
TPHA0L022905.18ON11932431247e-06
Kpol_534.231.369ON4961181221e-05
NDAI0A016707.390ON8461241221e-05
Kpol_1045.417.390ON7121291202e-05
YMR304W (UBP15)5.18ON12302271202e-05
NDAI0F034102.69ON8701371202e-05
KLLA0C06974g8.742ON4461321182e-05
NCAS0D023905.18ON12111101193e-05
Kpol_1044.242.69ON7241341193e-05
TPHA0P006807.390ON7271381183e-05
TBLA0D010708.742ON4832541174e-05
Ecym_27171.369ON4831141174e-05
TPHA0O016402.69ON7461231174e-05
NDAI0A074103.270ON8102461174e-05
Suva_13.4955.18ON12302271175e-05
KNAG0J008003.270ON7651271165e-05
TBLA0B097602.69ON8981271165e-05
TBLA0C070205.18ON12471101175e-05
ZYRO0C09812g2.69ON7021021165e-05
ZYRO0F01276g3.270ON7761931157e-05
TDEL0G004105.18ON11861101167e-05
KNAG0G029308.742ON4591021148e-05
Smik_13.5215.18ON12312271158e-05
Kwal_33.144302.69ON511991149e-05
KAFR0C004103.270ON7692441149e-05
KAFR0A075802.69ON8021291141e-04
TBLA0H036008.540ON4822361131e-04
YER098W (UBP9)7.390ON7541641131e-04
CAGL0M13783g5.18ON11962271141e-04
Suva_5.2177.390ON7541521131e-04
NCAS0G018002.69ON8751321122e-04
TPHA0G005608.742ON4632421112e-04
KAFR0K018107.390ON7141241112e-04
ZYRO0A05962g8.742ON4651281102e-04
ZYRO0G01188g1.369ON5001301102e-04
Smik_5.2447.390ON7491621103e-04
Skud_13.4785.18ON12312271113e-04
TDEL0C015707.390ON7651241103e-04
SAKL0H00418g5.18ON11902271103e-04
KAFR0A042108.742ON4402591083e-04
CAGL0M11198g8.742ON4611311084e-04
KAFR0A069102.307ON6782661094e-04
KLTH0B09944g5.18ON11891101094e-04
Kwal_26.95985.18ON11912251076e-04
ZYRO0D07062g5.18ON11931101077e-04
TDEL0D035503.270ON7802481077e-04
Kpol_1064.488.742ON4662391067e-04
AGR023C3.270ON7802451068e-04
Kwal_34.162681.369ON4491221059e-04
TBLA0D006207.390ON11711221069e-04
Ecym_62488.742ON4661151050.001
TBLA0C012001.369ON503321050.001
KLTH0H13354g1.369ON4951161050.001
AGL357W5.18ON11661351060.001
Skud_5.2237.390ON7481491050.001
KNAG0E012905.18ON11962271050.001
Suva_6.831.369ON500991040.001
NDAI0I025305.18ON1197561040.001
Ecym_56715.18ON11761101040.002
Smik_13.4318.742ON4711371030.002
CAGL0K10494g1.369ON4951251020.002
KAFR0L017307.390ON7011231020.003
SAKL0H04994g8.742ON4541311010.003
Kpol_1018.937.390ON7551231020.003
TBLA0E025703.270ON7851311010.004
Skud_13.3928.742ON4731801000.004
Suva_13.4078.742ON4711781000.004
KAFR0I026005.18ON1213221990.006
KLLA0E20351g7.390ON69793990.006
KLLA0E01013g8.202ON774145990.006
Kwal_26.91518.742ON454104980.006
KLTH0D12760g8.742ON453130980.007
AEL242W8.540ON61374980.007
NCAS0D006001.369ON49330970.009
KNAG0A054502.307ON764273970.009
AGR139C8.202ON789145970.009
KLLA0A10791g1.369ON484111970.009
SAKL0D10120g1.369ON49294970.009
Klac_YGOB_Anc_5.18b5.18ON1166230970.011
ZYRO0B11044g8.202ON826164970.011
YMR223W (UBP8)8.742ON471137960.012
KLTH0H07370g8.202ON781137960.012
TBLA0A064705.443ON132044960.013
YFR010W (UBP6)1.369ON499109950.014
SAKL0H18656g8.202ON772159960.014
Kwal_55.213935.443ON123351960.016
NCAS0B005808.742ON466104950.017
Ecym_11668.540ON69679940.019
TDEL0B036708.742ON463132940.020
TDEL0B030608.540ON73477940.021
KAFR0E009308.540ON49877940.021
Kpol_1024.448.540ON496200940.022
TBLA0B019308.202ON1019150940.022
Smik_7.3141.369ON499122930.024
CAGL0K10252g5.443ON126747940.024
TPHA0D043508.202ON854148940.026
AEL029W1.369ON44694920.033
KNAG0C019401.369ON49936910.040
ZYRO0G01606g5.443ON130526920.044
AGR370W7.390ON74027910.044
Skud_6.941.369ON49997910.045
KNAG0B041905.443ON126230920.046
TPHA0E017105.443ON128331920.046
TDEL0A016208.202ON795148910.049
AFR551W8.742ON469106910.049
NDAI0H035501.369ON502110900.056
KNAG0A019708.540ON471149890.067
KAFR0C045201.369ON499107890.074
Ecym_55448.202ON834144900.074
KLTH0C06732g7.390ON714163900.075
TPHA0J026205.443ON122526900.077
TPHA0A025101.369ON505115890.077
SAKL0F12430g7.390ON754124890.082
KLTH0F15862g5.443ON1241126890.084
NDAI0E008108.742ON493181880.097
Skud_16.2098.540ON50372880.10
KLLA0E02377g5.443ON122031890.10
Kpol_251.73.270ON480116880.10
Smik_2.1893.270ON782184880.11
YPL072W (UBP16)8.540ON49978870.13
Kpol_1016.15.443ON125132880.13
SAKL0G02728g5.443ON123727880.13
Skud_2.1773.270ON782191870.17
TDEL0D025805.443ON127246870.17
Kpol_219.1singletonON24981840.19
Kpol_1062.235.443ON126627860.20
Smik_16.1638.540ON501143850.20
NDAI0C015505.443ON129539860.21
Ecym_45145.443ON124627860.21
NDAI0E028208.540ON495205850.23
TDEL0D024001.369ON494110850.23
Suva_8.1765.443ON127033850.29
CAGL0I06600g8.202ON816149850.30
ACL164C5.443ON138931850.30
KAFR0D050705.443ON122732850.30
NCAS0H021005.443ON126927840.32
Kwal_14.19578.202ON444134840.33
Skud_15.2865.443ON127826840.35
YOR124C (UBP2)5.443ON127226840.39
Smik_15.3015.443ON127226830.43
Kwal_56.230843.270ON762120830.45
KLLA0E08801g2.307ON771310830.48
CAGL0H05335g8.540ON483164820.49
NCAS0B061302.307ON770269820.58
Kwal_27.114442.307ON757301810.81
KLLA0F18700g3.270ON770112800.94
ZYRO0D03982g8.540ON82181801.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02200
         (1161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...  2132   0.0  
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     768   0.0  
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     768   0.0  
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   744   0.0  
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   725   0.0  
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   701   0.0  
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   674   0.0  
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   568   0.0  
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   551   e-177
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   531   e-170
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   517   e-165
Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] ...   495   e-164
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   483   e-152
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   479   e-150
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   484   e-148
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   364   e-107
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   364   e-107
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   338   8e-99
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...   309   2e-90
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   303   2e-88
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   302   3e-88
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   310   1e-87
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   299   5e-87
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   298   1e-85
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...   258   3e-73
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...   243   5e-68
Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...   190   1e-50
TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8....   120   8e-27
YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}  ...   119   1e-26
TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.1...   117   5e-26
Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON...   117   9e-26
TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.1...   116   1e-25
Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {O...   115   2e-25
YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}  ...   115   2e-25
Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON...   115   4e-25
KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {O...   113   1e-24
Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON...   113   1e-24
KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.1...   111   4e-24
Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON...   110   7e-24
KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} simila...   108   3e-23
NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON}             108   3e-23
KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} simila...   108   5e-23
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...   107   6e-23
Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C...   104   8e-23
AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic ho...   107   8e-23
NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa] ...   107   9e-23
ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some s...   106   2e-22
CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {...   105   2e-22
Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON...   105   2e-22
NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188    105   3e-22
SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} simi...   105   4e-22
Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON...   104   5e-22
Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar t...   103   1e-21
NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188     91   9e-18
Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]...    82   5e-15
KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {O...    76   3e-13
Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W ...    75   7e-13
YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}  UBP12Ubiqu...    75   1e-12
ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa...    74   2e-12
KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1....    74   3e-12
TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]...    73   3e-12
Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W ...    73   3e-12
NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON...    72   8e-12
Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {O...    71   1e-11
AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON...    71   1e-11
TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1....    71   1e-11
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    71   1e-11
NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {...    71   2e-11
CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} simi...    71   2e-11
Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL19...    67   3e-10
Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON...    67   3e-10
KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} simil...    66   4e-10
KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1....    64   2e-09
NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {O...    61   1e-08
TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON} Anc_1...    61   2e-08
Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON} (71125.....    60   4e-08
Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON} Y...    59   6e-08
KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {O...    59   6e-08
KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {O...    58   1e-07
Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON} Y...    58   1e-07
ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} simila...    57   3e-07
CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} simila...    57   3e-07
Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON} Y...    56   4e-07
TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {O...    56   4e-07
NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7...    56   5e-07
YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}  UB...    56   6e-07
KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {...    55   7e-07
CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {...    55   1e-06
KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {...    55   1e-06
TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.6...    54   2e-06
ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic ho...    54   3e-06
YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}  UBP10Ubiq...    54   3e-06
CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {...    54   3e-06
Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {O...    54   3e-06
KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.6...    53   3e-06
CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa...    53   3e-06
Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186...    53   3e-06
NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {O...    53   4e-06
Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186...    53   4e-06
NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {O...    53   4e-06
Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186...    53   5e-06
SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa]...    52   6e-06
SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} simil...    52   7e-06
TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5...    52   7e-06
Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {...    52   1e-05
NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {O...    52   1e-05
Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {O...    51   2e-05
YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}  UBP15Ubi...    51   2e-05
NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {O...    51   2e-05
KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {...    50   2e-05
NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {...    50   3e-05
Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON} (56564....    50   3e-05
TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7....    50   3e-05
TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {O...    50   4e-05
Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar...    50   4e-05
TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {...    50   4e-05
NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa] ...    50   4e-05
Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR30...    50   5e-05
KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {...    49   5e-05
TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] ...    49   5e-05
TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_...    50   5e-05
ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {...    49   5e-05
ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} simila...    49   7e-05
TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON...    49   7e-05
KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.7...    49   8e-05
Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR30...    49   8e-05
Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186...    49   9e-05
KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}...    49   9e-05
KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] ...    49   1e-04
TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {O...    48   1e-04
YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiqui...    48   1e-04
CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON} si...    49   1e-04
Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W ...    48   1e-04
NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69      48   2e-04
TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {O...    47   2e-04
KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7....    47   2e-04
ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {...    47   2e-04
ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa] ...    47   2e-04
Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W ...    47   3e-04
Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR30...    47   3e-04
TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {O...    47   3e-04
SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar...    47   3e-04
KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.7...    46   3e-04
CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} sim...    46   4e-04
KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa] ...    47   4e-04
KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] ...    47   4e-04
Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]...    46   6e-04
ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] ...    46   7e-04
TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.2...    46   7e-04
Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON} (88495....    45   7e-04
AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON} S...    45   8e-04
Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010...    45   9e-04
TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {...    45   9e-04
Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar t...    45   0.001
TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512...    45   0.001
KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035) ...    45   0.001
AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic hom...    45   0.001
Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W ...    45   0.001
KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {...    45   0.001
Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}...    45   0.001
NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5....    45   0.001
Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {...    45   0.002
Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223...    44   0.002
CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} hig...    44   0.002
KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7....    44   0.003
SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {...    44   0.003
Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON} (2480...    44   0.003
TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {O...    44   0.004
Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223...    43   0.004
Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223...    43   0.004
KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5....    43   0.006
KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} simi...    43   0.006
KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some s...    43   0.006
Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] ...    42   0.006
KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} simi...    42   0.007
AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic ho...    42   0.007
NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.3...    42   0.009
KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.3...    42   0.009
AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}...    42   0.009
KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [145...    42   0.009
SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [147...    42   0.009
Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [35...    42   0.011
ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {...    42   0.011
YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}  UBP8Ubiqu...    42   0.012
KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some s...    42   0.012
TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON} Anc_...    42   0.013
YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}  UBP6Ubiqui...    41   0.014
SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some...    42   0.014
Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR12...    42   0.016
NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742       41   0.017
Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar t...    41   0.019
TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {O...    41   0.020
TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.5...    41   0.021
KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.5...    41   0.021
Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON} (1180...    41   0.022
TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8....    41   0.022
Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W ...    40   0.024
CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa...    41   0.024
TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {O...    41   0.026
AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic ho...    40   0.033
KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {O...    40   0.040
ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa] ...    40   0.044
AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic ...    40   0.044
Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}...    40   0.045
KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5....    40   0.046
TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5....    40   0.046
TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.2...    40   0.049
AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic ...    40   0.049
NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {O...    39   0.056
KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.5...    39   0.067
KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500...    39   0.074
Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar...    39   0.074
KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {...    39   0.075
TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa] ...    39   0.077
TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 a...    39   0.077
SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} simila...    39   0.082
KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON} sim...    39   0.084
NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {O...    39   0.097
Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072...    39   0.10 
KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa] ...    39   0.10 
Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON} (12280..13...    39   0.10 
Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON...    39   0.11 
YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}  UBP16Deub...    38   0.13 
Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340...    39   0.13 
SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa] ...    39   0.13 
Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON...    38   0.17 
TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5....    38   0.17 
Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt,...    37   0.19 
Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON} (51365...    38   0.20 
Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072...    37   0.20 
NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5....    38   0.21 
Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {...    38   0.21 
NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.5...    37   0.23 
TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 a...    37   0.23 
Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {O...    37   0.29 
CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} simila...    37   0.30 
ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON} Sy...    37   0.30 
KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {...    37   0.30 
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    37   0.32 
Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C...    37   0.33 
Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa] ...    37   0.35 
YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}...    37   0.39 
Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa] ...    37   0.43 
Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {...    37   0.45 
KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} simila...    37   0.48 
CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {...    36   0.49 
NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa] ...    36   0.58 
Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {...    36   0.81 
KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} simi...    35   0.94 
ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly...    35   1.0  
KAFR0B02370 Chr2 complement(460558..463047) [2490 bp, 829 aa] {O...    35   1.1  
NCAS0A03840 Chr1 (780031..782784) [2754 bp, 917 aa] {ON} Anc_8.2...    35   1.2  
NCAS0C02110 Chr3 (398702..400186) [1485 bp, 494 aa] {ON} Anc_8.5...    35   1.2  
TPHA0L01670 Chr12 complement(351116..352690) [1575 bp, 524 aa] {...    35   1.2  
KLTH0E12540g Chr5 complement(1111576..1113834) [2259 bp, 752 aa]...    35   1.3  
SAKL0D03322g Chr4 (270137..272434) [2298 bp, 765 aa] {ON} simila...    35   1.5  
KLLA0E23387g Chr5 complement(2079405..2081753) [2349 bp, 782 aa]...    35   1.6  
KLLA0E14125g Chr5 (1250334..1251767) [1434 bp, 477 aa] {ON} simi...    35   1.7  
Kwal_27.10842 s27 complement(522190..524325) [2136 bp, 711 aa] {...    35   1.8  
YER151C Chr5 complement(469686..472424) [2739 bp, 912 aa] {ON}  ...    35   1.9  
SAKL0H10076g Chr8 (863358..865661) [2304 bp, 767 aa] {ON} simila...    34   2.6  
NDAI0B03430 Chr2 complement(868578..871148) [2571 bp, 856 aa] {ON}     34   3.3  
ADR414C Chr4 complement(1450330..1452684) [2355 bp, 784 aa] {ON}...    34   3.4  
Smik_5.318 Chr5 complement(474889..477618) [2730 bp, 909 aa] {ON...    34   3.5  
KLTH0C07326g Chr3 (633748..636036) [2289 bp, 762 aa] {ON} weakly...    33   4.8  
Skud_5.289 Chr5 complement(460660..463392) [2733 bp, 910 aa] {ON...    33   4.9  
Kpol_1056.45 s1056 complement(114032..115387) [1356 bp, 451 aa] ...    32   7.1  
Suva_4.125 Chr4 (231011..233392) [2382 bp, 793 aa] {ON} YDL122W ...    33   7.5  

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1161

 Score = 2132 bits (5523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1041/1161 (89%), Positives = 1041/1161 (89%)

Query: 1    MRSMYGDDSTALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELY 60
            MRSMYGDDSTALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELY
Sbjct: 1    MRSMYGDDSTALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELY 60

Query: 61   LSCLGKDQNMDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVL 120
            LSCLGKDQNMDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVL
Sbjct: 61   LSCLGKDQNMDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVL 120

Query: 121  LMVKEEVQVVLESQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRS 180
            LMVKEEVQVVLESQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRS
Sbjct: 121  LMVKEEVQVVLESQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRS 180

Query: 181  QKKQLLQLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLK 240
            QKKQLLQLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLK
Sbjct: 181  QKKQLLQLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLK 240

Query: 241  LAAEVHDLPPGAISRGSXXXXXXXXXXXXIGYEEMGIYGLXXXXXXXXXXXXXXXXXXXQ 300
            LAAEVHDLPPGAISRGS            IGYEEMGIYGL                   Q
Sbjct: 241  LAAEVHDLPPGAISRGSDADEEEDVDDLEIGYEEMGIYGLAHHSVAPPQHAPPPVPLSSQ 300

Query: 301  SPITSGGTPAAIDDLXXXXXXXXXXXXXXPAAQTVPPGGAHDRSFKDFTPDRSLTHRKNS 360
            SPITSGGTPAAIDDL              PAAQTVPPGGAHDRSFKDFTPDRSLTHRKNS
Sbjct: 301  SPITSGGTPAAIDDLMMRRRRTHTMTQMTPAAQTVPPGGAHDRSFKDFTPDRSLTHRKNS 360

Query: 361  YHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQXXXXX 420
            YHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQ     
Sbjct: 361  YHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQLLLID 420

Query: 421  XXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVY 480
                   NTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVY
Sbjct: 421  LRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVY 480

Query: 481  FSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVT 540
            FSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVT
Sbjct: 481  FSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVT 540

Query: 541  DYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAVEPWKPHEVPATIRKRXXXXXXX 600
            DYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAVEPWKPHEVPATIRKR       
Sbjct: 541  DYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAVEPWKPHEVPATIRKRPPPPPPA 600

Query: 601  XXXXXXXXXXXXXXRIMLDSKVSQHRAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQE 660
                          RIMLDSKVSQHRAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQE
Sbjct: 601  SVPQSPDVVPVIPPRIMLDSKVSQHRAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQE 660

Query: 661  PFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFI 720
            PFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFI
Sbjct: 661  PFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFI 720

Query: 721  SMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFK 780
            SMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFK
Sbjct: 721  SMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFK 780

Query: 781  IPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVI 840
            IPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVI
Sbjct: 781  IPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVI 840

Query: 841  GNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEEC 900
            GNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEEC
Sbjct: 841  GNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEEC 900

Query: 901  LNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXX 960
            LNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDT                
Sbjct: 901  LNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTLSPGSSSSSSKKGKLF 960

Query: 961  XXXXXXXXXXXXELGELNVSKINRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDE 1020
                        ELGELNVSKINRSLSPFRVLGG              RADVDAQRDIDE
Sbjct: 961  SFSLHHRHHHRSELGELNVSKINRSLSPFRVLGGSSSKSVRKSEDSHSRADVDAQRDIDE 1020

Query: 1021 LREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVL 1080
            LREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVL
Sbjct: 1021 LREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVL 1080

Query: 1081 KSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGD 1140
            KSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGD
Sbjct: 1081 KSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGD 1140

Query: 1141 VKHGVMKISSSDVYVLFYERI 1161
            VKHGVMKISSSDVYVLFYERI
Sbjct: 1141 VKHGVMKISSSDVYVLFYERI 1161

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/830 (51%), Positives = 530/830 (63%), Gaps = 92/830 (11%)

Query: 340  AHDRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIIT 399
            +++RSF++   DRS THRK+SYHSVYM++E  + + N +YD S  YIQ L+RLQKQSIIT
Sbjct: 283  SNNRSFRETNADRSQTHRKDSYHSVYMIDEESTDKLNQFYD-STDYIQDLQRLQKQSIIT 341

Query: 400  APELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITE 459
            A EL SILS   +  +              + I+APN V IDP +LW+S +  P+Y +  
Sbjct: 342  AQELLSILSCPPERIKLLLIDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMET 401

Query: 460  LESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLG 519
            LE  L+N LFNRR EF+YVVY++DMKT+M  +FDY+FT FYLL T     L+  PT LLG
Sbjct: 402  LEKLLDNELFNRRHEFEYVVYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLG 461

Query: 520  GYEKWKKVILEYGKQYNICVTDYLVRITEG--EDDTPARHDCQELPYRQQNFAGINGPGA 577
            GY+KWK  +  Y K+Y+I + DYL R  +   + +TP            + F        
Sbjct: 462  GYDKWKVFLHHYAKEYDINIPDYLYRPYDKALKSETP------------EEFEETKNKHV 509

Query: 578  VEP--WKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQHRAPFQSNLNF 635
            +EP  W+P E+P  IRKR                            V     P ++ +N 
Sbjct: 510  LEPPSWRPPELPVRIRKRPPPPPPALLPVPPSPPVKPRI-------VDDVNRPKKTLMNL 562

Query: 636  VTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRN 695
             + + L  + +   Q+ P   +QQ      T  L    SIPTIE++PN+YVSLSITGLRN
Sbjct: 563  HSARPLLHERN--YQIPP--HLQQ------TTTLTRRPSIPTIERSPNLYVSLSITGLRN 612

Query: 696  LGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQ----PVISRTFYIL 751
            LGNTCYINSM+QCLFAT+ FR+LF++ KY  FL         NGS+    P+IS +F +L
Sbjct: 613  LGNTCYINSMLQCLFATRRFRDLFLTSKYSSFL---------NGSKFPNSPMISNSFNLL 663

Query: 752  FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVN 811
            FKKMYLNGGCSVVP SFLK+C++LRPD KIPDDQQDT EFLM+ILDRLHDELSNQ  VVN
Sbjct: 664  FKKMYLNGGCSVVPTSFLKNCNVLRPDLKIPDDQQDTQEFLMIILDRLHDELSNQQEVVN 723

Query: 812  EYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNY 871
            EYP L+LYD   L VQ++EYK WF+KSVIGNGLSPID+IFQGQ+EN L CQRCGHSSFNY
Sbjct: 724  EYPSLMLYDTNHLRVQHEEYKHWFEKSVIGNGLSPIDEIFQGQIENGLQCQRCGHSSFNY 783

Query: 872  STFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGM 931
            STFYVLSLAIPK + + FSRSKRV LE+C+NM+T+DE+LSGENAWDCPNC    +D +  
Sbjct: 784  STFYVLSLAIPKPSPTGFSRSKRVKLEDCINMFTNDEMLSGENAWDCPNCGSNAQD-RVR 842

Query: 932  VEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELNVSKINRSLSPFRV 991
            V   +  K  R                                     ++ +RSLSPFR 
Sbjct: 843  VNTDQSVKKKRQGEEHRHKSRFFGLP----------------------TRPHRSLSPFRK 880

Query: 992  LGGXXXXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTL 1051
                                       +   ++K E +QWK+KKL TIKTLNFI +P  L
Sbjct: 881  S---------------------GSSSTNSTSKIKHE-QQWKTKKLITIKTLNFIMLPPVL 918

Query: 1052 IIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDK 1111
            +IHLSRF+YDLTKKN T++TYPLILNIVLK+NEV KYKLYG+VNHTGNLISGHYTS+V+K
Sbjct: 919  VIHLSRFFYDLTKKNKTVITYPLILNIVLKNNEVAKYKLYGIVNHTGNLISGHYTSLVNK 978

Query: 1112 QLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            +  H+LN N   WYYFDDEVVK E  HGD+ +G+ K+SS DVYVLFYER+
Sbjct: 979  EPGHNLNHNQQRWYYFDDEVVKAEGNHGDIDNGISKVSSKDVYVLFYERL 1028

 Score =  177 bits (449), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 110/243 (45%), Positives = 155/243 (63%), Gaps = 27/243 (11%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S+EL +R+  VY +DI    PQL+L++L+DLLEHTE+L+EL+L    +  N DAL
Sbjct: 10  FTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKDAL 69

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLE- 132
            SFI GC+Y++L+MPQSIQF +RN+++ +YSD++ LYE+Q +MTNVLLMVK+E++ +LE 
Sbjct: 70  TSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETILEK 129

Query: 133 -SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRP 191
            ++ +    N RI R RAYSVPD   + + L  L++           +S  +++L     
Sbjct: 130 TAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVS------DRNLKSPPRKILM---- 179

Query: 192 GNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHD-LPP 250
            N   HSDS+ I E+              +D SSPLW AP LEP DQLKLA   ++ LPP
Sbjct: 180 NNSFEHSDSDVINEE--------------NDMSSPLWTAPPLEPTDQLKLAVLGNETLPP 225

Query: 251 GAI 253
             I
Sbjct: 226 PVI 228

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/848 (49%), Positives = 524/848 (61%), Gaps = 96/848 (11%)

Query: 343  RSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPE 402
            ++ +   PDR+  HRK+SYHS+YM+++  +     YYD SN YI SLERLQKQ IITA E
Sbjct: 323  KTIEQTNPDRASNHRKDSYHSIYMVDDGSADGITQYYD-SNPYIHSLERLQKQCIITAQE 381

Query: 403  LFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462
            LFSILSN  +  +            +++ I+APN + IDP +LWNS +  P+Y+IT LE+
Sbjct: 382  LFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLWNSKTNTPIYDITTLEN 441

Query: 463  KLNNP----LFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTAR-GKPLKCVPTVL 517
             L  P    L   R +F+Y+V+++D KT+M  NFDY FTFFYLL T++  K +K  PT L
Sbjct: 442  LLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLLVTSKTNKNIKSAPTHL 501

Query: 518  LGGYEKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGA 577
            LGGY+KWKKV+  Y +QYN  + DYL +      D+   HD             +     
Sbjct: 502  LGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGDSIKHHD------------DLVDSHI 549

Query: 578  VEP--WKPHEVPATIRKRXXXXXXX-------------------XXXXXXXXXXXXXXRI 616
            ++P  WKP E+P  +RKR                                        + 
Sbjct: 550  LQPPSWKPPELPLRMRKRPPPPPPVAIPTPPVPHLLTNSTLPPISSTTEQSPGIVLKTKT 609

Query: 617  MLD---SKVSQHRAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETY 673
            M D   +K  QHR  +   L     Q+  A +D       T+R   +   S        +
Sbjct: 610  MTDLHSTKSQQHRNQY---LTSYQHQVELARDDE------TRRKYHQERESLMLTRSRKF 660

Query: 674  SIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAP 733
            SIPTIE++PN+YVSLSITGLRNLGNTCYINSM+QCLFAT+ FR+LFIS K++ F+ +   
Sbjct: 661  SIPTIEKSPNLYVSLSITGLRNLGNTCYINSMLQCLFATRLFRDLFISSKFQSFIND--- 717

Query: 734  KPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLM 793
                  + P IS +F +LFKKMYLNGGCSVVP SFLK+C++LRPD +IPDDQQDT EFLM
Sbjct: 718  --SKFPNTPKISNSFNLLFKKMYLNGGCSVVPTSFLKTCNILRPDLRIPDDQQDTQEFLM 775

Query: 794  LILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQG 853
            +ILDRLHDELSNQ  VVNEYP+L+LYDE  L VQNKEYK WFDK+VIGNGLSPID IF G
Sbjct: 776  IILDRLHDELSNQQEVVNEYPNLLLYDENNLKVQNKEYKHWFDKNVIGNGLSPIDHIFSG 835

Query: 854  QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGE 913
            QMENSL CQRCG+SS+NYSTFYVLSLAIPK +S+TFSRSKRV LEEC+NM+TSDEVLSGE
Sbjct: 836  QMENSLQCQRCGNSSYNYSTFYVLSLAIPKPSSTTFSRSKRVKLEECINMFTSDEVLSGE 895

Query: 914  NAWDCPNCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXE 973
            NAWDCP C           EK     +++                               
Sbjct: 896  NAWDCPKCGSSASSTISDSEKLLNVTSSKKKNMSSHNEHHRYKSKFFTLH---------- 945

Query: 974  LGELNVSKINRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWKS 1033
                  ++ +RS+SPFR                   A V +            + + WKS
Sbjct: 946  ------TRSHRSISPFR--------------KKTSPAAVPSS----------TKNEPWKS 975

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGV 1093
            KKL TIKTLNFI +P  L+IHLSRFYYDLTKKN+T++TYPLILNIVLK+NEV KY+LYG+
Sbjct: 976  KKLITIKTLNFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIVLKNNEVAKYRLYGI 1035

Query: 1094 VNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDV 1153
            VNH+GNLISGHYTS+V+K+ +H L S    WYYFDDE VK E  HGD+  G++++SS DV
Sbjct: 1036 VNHSGNLISGHYTSLVNKEPNHDLGSKKQRWYYFDDETVKEERNHGDMDKGILQVSSRDV 1095

Query: 1154 YVLFYERI 1161
            YVLFYERI
Sbjct: 1096 YVLFYERI 1103

 Score =  148 bits (374), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/236 (40%), Positives = 149/236 (63%), Gaps = 16/236 (6%)

Query: 13  PFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNM-D 71
           PFTPE S+EL Q+V  +Y DDI    PQL+L++L+DLLEHTE+L EL+ +    + N  D
Sbjct: 8   PFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNKD 67

Query: 72  ALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL 131
            L +FI GC+Y++L++PQSIQF ++N+++ +Y++++ LYE++ +MTNVLLMVK+E++ VL
Sbjct: 68  VLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENVL 127

Query: 132 --ESQWDSASLNER-IPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQL 188
             +   + + LN R I R RAYS+     +   +  L++ +  +      +++     Q 
Sbjct: 128 DMDENNNGSDLNHRIIKRQRAYSI-SINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186

Query: 189 PRPGNVPV--HSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242
           P    +P+  H D EF  E+   ++  D       D++SPLW AP LEP DQLKLA
Sbjct: 187 PNHHLLPIILHCDEEFSNEE---INATDF------DRASPLWTAPSLEPKDQLKLA 233

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] {ON}
            similar to uniprot|P40453 Saccharomyces cerevisiae
            YIL156w UBP7
          Length = 1081

 Score =  744 bits (1921), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/824 (48%), Positives = 508/824 (61%), Gaps = 81/824 (9%)

Query: 343  RSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPE 402
            + F+D   +R +THRK+SYHS+YM+++  ++  N Y+D SNA+IQ LERLQKQSIITAPE
Sbjct: 333  KDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKN-YFDGSNAFIQGLERLQKQSIITAPE 391

Query: 403  LFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462
            LFSILSN ++  +              + I+APN V+IDP  LW++ + +P+Y+ T LE 
Sbjct: 392  LFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPTNLWDNEANSPIYKDTILEQ 451

Query: 463  KLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYE 522
            +LNNPLFN R ++DY+VY+SDMKT+M   +DY F  FYLL T+ GK L  VPT LLGGYE
Sbjct: 452  RLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLTTS-GKHLSSVPTALLGGYE 510

Query: 523  KWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGA---VE 579
            KWKKV+  Y  QY I + DYL R                 PY   N  G         V 
Sbjct: 511  KWKKVMNTYVSQYQIELDDYLYR-----------------PYAPSNNKGEQNNAQIPDVP 553

Query: 580  PWKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQHRAPFQSNLNFVTGQ 639
             WKP  VP  +RKR                     +I L+S   +  AP           
Sbjct: 554  TWKPPPVPVMVRKRPPPPVPVSIPIPPETPPPLPQKIKLES--IEESAP----------- 600

Query: 640  ILEADEDTALQVAPTKRIQQEPFRSATN-GLHETYSIPTIEQNPNIYVSLSITGLRNLGN 698
                  D +  + P  ++      S  N  L   +SIPTIE+N N YV+ S+TGLRNLGN
Sbjct: 601  -----SDNSQYIRPPAKLPIHALHSPRNQTLTRKFSIPTIEKNSNPYVAYSVTGLRNLGN 655

Query: 699  TCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLN 758
            TCYIN M+Q LFAT   +NLFIS KY+E+      KP  N  +  IS TF  LF KMY+N
Sbjct: 656  TCYINCMLQSLFATNELKNLFISGKYREY----QMKPNDN-KESAISNTFANLFNKMYMN 710

Query: 759  GGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLIL 818
            GGC+VVP  FLK C+ LRPD +IPDDQQDT EFL+ IL+RLHDELSNQ  V+N+YP+L+L
Sbjct: 711  GGCTVVPSGFLKICNFLRPDLRIPDDQQDTQEFLLFILNRLHDELSNQVNVINDYPNLLL 770

Query: 819  YDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLS 878
            YD+ K+ V  ++YKKWFDK+V+ NGLSP+D +FQGQMEN+L CQRCG+ S NYSTFYVLS
Sbjct: 771  YDDDKMMVDKEKYKKWFDKTVVANGLSPVDGVFQGQMENALQCQRCGYESVNYSTFYVLS 830

Query: 879  LAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEKTKRN 938
            LA+PK ++  F +S RV LE+C+NM+TSDEVL+GENAWDCP C          VE    +
Sbjct: 831  LALPKPSAPAFYKSGRVKLEDCINMFTSDEVLTGENAWDCPKCG------SKAVEPRFTS 884

Query: 939  KAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELNVSKINRSLSPFRVLGGXXXX 998
            + +  T                              G      I+RS SPFR LG     
Sbjct: 885  RTSTQTILPNSPHHHKKSKF---------------FGLPTGKAISRSKSPFRKLG----- 924

Query: 999  XXXXXXXXXXRADVDAQRDIDEL-REMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSR 1057
                            Q  +D++ R+  EE  + KSKKL TIKT+NFI +P+ LIIHLSR
Sbjct: 925  --------LLEKHEGKQEKLDKMERDEIEEWHKMKSKKLVTIKTINFISLPKVLIIHLSR 976

Query: 1058 FYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSL 1117
            FYYDLTKKN  +V+YPL+LNIVLK+ E+V+YKLY +VNHTGNLISGHYTS+V+K   H+L
Sbjct: 977  FYYDLTKKNDAVVSYPLVLNIVLKNEEIVRYKLYSIVNHTGNLISGHYTSLVNKDPHHNL 1036

Query: 1118 NSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             +    WYYFDDEVVK E  HG+V  G+ K+SS +VYVLFYER+
Sbjct: 1037 GNTEQKWYYFDDEVVKAEKTHGNVDKGITKVSSKNVYVLFYERV 1080

 Score =  124 bits (312), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 102/305 (33%), Positives = 152/305 (49%), Gaps = 73/305 (23%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S +L  ++ ++Y D+I    PQL+LQRL+DLLE  + + E Y+ C+  D +  A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDTS-KAV 62

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
             FI GCFY+YLVMP+S+QF TR++++++Y+++R LYESQ+NMTNV+ MVKEEV  + E 
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQE- 121

Query: 134 QWDSASLNER------------------------IPRNRAYSV--PDEARVVQNLDKL-- 165
           Q D+   NE                         I R  AYS+  P     +   D+L  
Sbjct: 122 QCDNFQDNEGVDDSKPLGNNLKGADNMLNQGKRLITRRSAYSISSPSGMSTLSLHDELPE 181

Query: 166 -----TLQSPT---------------ETRGGRPRSQKKQLLQLPRPG-NVPVHSDSEFIA 204
                  + P+               E +  R +S     +  PR   +V +++++E   
Sbjct: 182 HRSEQQTRFPSVERDQSNGMKADMLLEKKQSRTKSNPITNINQPRKSLDVTLNANNEIPT 241

Query: 205 EQGISLHGDDSGWSDLDDQS-------------------SPLWRAPQLEPNDQLKLAAEV 245
              +SLH DD    D  +++                   SP+W AP L+PNDQLKLA   
Sbjct: 242 ---LSLHSDDKAVFDQHNEAKSLPGTATDSDEEYYVEHGSPIWTAPDLDPNDQLKLALGT 298

Query: 246 HDLPP 250
             L P
Sbjct: 299 ELLSP 303

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (REAL)
          Length = 1060

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/830 (48%), Positives = 514/830 (61%), Gaps = 34/830 (4%)

Query: 345  FKDFTPDRSLTHRKNSYHSVYMLEESESSQGN--LYYDESNAYIQSLERLQKQSIITAPE 402
            F+D T DRS+THRK+SYHSVYM++     + N      E++ +IQSL+ LQKQSIITAPE
Sbjct: 250  FRDITADRSVTHRKDSYHSVYMVDSDNLKEDNDEFLNVENDGFIQSLDILQKQSIITAPE 309

Query: 403  LFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462
            LFSILSN  + ++              + I+APN V +DP +LW+  +  P+Y+   LE 
Sbjct: 310  LFSILSNRVEREKVLLIDLRIPQRSAVNHIVAPNLVKVDPNLLWDKKTNTPVYQDDILEH 369

Query: 463  KLN-NPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGY 521
             L  N  F  RD+FDY+VY+SD+KTFM +NFDY F FFYL+ T++  PL  VPT LLGGY
Sbjct: 370  LLKENENFANRDKFDYIVYYSDVKTFMTINFDYVFIFFYLMLTSQKTPLTTVPTALLGGY 429

Query: 522  EKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAVEP- 580
            EKWKK +  Y ++Y+I V DYL R    +     +   Q+   +  + +        EP 
Sbjct: 430  EKWKKTLHSYAQEYHISVEDYLYRPYSQKARAQQQQQQQQPNSQDSSSSKETPTKVPEPP 489

Query: 581  -WKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQHRAPFQSNLNFVTGQ 639
             WKP ++P  +RKR                     +IM    V  H             Q
Sbjct: 490  SWKPPDLPIRLRKRPPPPPPASMPTTPEIPPPLPPKIM----VYPHEGSVPRKPPIPAKQ 545

Query: 640  ILEADEDTALQVAPTKRIQQEPFRSATNGLH-ETYSIPTIEQNPNIYVSLSITGLRNLGN 698
             ++  +  + ++   KR QQ   +     L  + YSIPTIE+NPN+YVSLSITGLRNLGN
Sbjct: 546  HVKKKQSNSNEIIQRKRQQQHYGQQLLQPLPPKDYSIPTIERNPNVYVSLSITGLRNLGN 605

Query: 699  TCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLN 758
            TCYINSMIQCLFA K+FR LFIS  YK +L+ +A     +   P +S +  +LF KMYLN
Sbjct: 606  TCYINSMIQCLFAAKTFRTLFISSNYKNYLEPLASNRPHHS--PKLSNSLSMLFNKMYLN 663

Query: 759  GGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLIL 818
            GGCSVVP  FLK  + LRPD KIPDDQQDT EFLM++LDRLHDELSNQ  V N+YP+L+L
Sbjct: 664  GGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSNQQHVANDYPNLLL 723

Query: 819  YDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLS 878
            Y+   L V N EYK WFDK+VIGNG+SPIDDIFQGQMENSL C+RCG+++FNYSTFYVLS
Sbjct: 724  YNADVLKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCGYTTFNYSTFYVLS 783

Query: 879  LAIPKATS--STFSRS--KRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGMVEK 934
            LAIP  +   S   RS  KRV LE+C+NM+TSDEVLSGENAWDCP C             
Sbjct: 784  LAIPTRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRCGPTASFTASASAS 843

Query: 935  TKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELNVSKI---NRSLSPFRV 991
               N+++                               E   +N + I    RS SPF++
Sbjct: 844  ALENESSILKSKKKKSRFFTLHTGSKRRHLDIFGDSNGEGNNINNTMIFERERSRSPFKM 903

Query: 992  LGGXXXXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTL 1051
            LGG                D +   D             +K+KK+ T+KT+NF+ +P+ L
Sbjct: 904  LGGSGKRSSSSTPFANGGNDSNNTGD-------------FKNKKMTTVKTINFVTLPKIL 950

Query: 1052 IIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDK 1111
            +IHLSRFYYDLTKKN+T++TYPLILNI+LK+N+ +KY+L+GVVNHTG LISGHYTS+V+K
Sbjct: 951  VIHLSRFYYDLTKKNNTVITYPLILNIILKNNDTMKYRLFGVVNHTGTLISGHYTSLVNK 1010

Query: 1112 QLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             L+HS++     WYYFDDEVVK + +HG  K+  +KISSSDVYVLFYER+
Sbjct: 1011 DLEHSVDIGRSKWYYFDDEVVKADKKHGSDKN--LKISSSDVYVLFYERV 1058

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 100/230 (43%), Positives = 141/230 (61%), Gaps = 37/230 (16%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE SDEL +RV  +Y +DI    PQL+L++L+DLLEHTE+L+ELYL  +   +  DAL
Sbjct: 8   FTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPNDAL 67

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132
            +F+ GC+YV+L++PQS+QF TRN+++++Y+D++ +YE+++NMTNV+LMVK+E+ VVL E
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
           S      +  RI + RA+SVP       +L         +T G             P+  
Sbjct: 128 SVKHVVGIEHRINKKRAFSVP-----ANDLSGQVASLSLDTAG-------------PQQH 169

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242
           N+ V             L  DD       DQSSP+W AP LEPNDQLKLA
Sbjct: 170 NIKV------------PLTEDDM------DQSSPVWTAPNLEPNDQLKLA 201

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
            Anc_5.712 YIL156W
          Length = 1212

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/863 (44%), Positives = 505/863 (58%), Gaps = 104/863 (12%)

Query: 332  AQTVPPGGAHDRSFKDF------TP-----DRSLTHRKNSYHSVYMLEESESSQGNLYYD 380
            A+T P    H  S K+F      TP     DRS+THRK+SYHSVYM  +S     N  YD
Sbjct: 420  AETNP---YHSSSVKEFPRKKSPTPLKSPVDRSVTHRKDSYHSVYMFNDSNEDNNNHGYD 476

Query: 381  ESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHI 440
            E++ YI+SLE +QKQ +IT PELFS+LSN  + ++              + I+APN + +
Sbjct: 477  ETSEYIESLEHIQKQDVITCPELFSLLSNNVEREKVLLIDLRFPERFVKNHIVAPNILQL 536

Query: 441  DPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFY 500
            +PK+LW+  +  P+Y   +LE  +NNPLF++RD F YVVY+SDMKT+M + FDY FT FY
Sbjct: 537  NPKLLWDDTTNTPVYTAEKLEQIINNPLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFY 596

Query: 501  LLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQ 560
            LL T   KP+K +PT LLGGYEKW KVI  Y  QY+I + DY+ R   G       ++  
Sbjct: 597  LLVTCTSKPVKSLPTSLLGGYEKWYKVINSYVNQYSITMNDYVYRKDAGASAGRPLNN-- 654

Query: 561  ELPYRQQNFAGINGPGAVEPWKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDS 620
                        N    +E W P ++P  IRKR                        L  
Sbjct: 655  ------------NEKPKMEIWTPPQLPIRIRKRAPPPPPSSLPKPNSGKMPPP----LPP 698

Query: 621  KVSQHRAPFQSNLNF-VTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIE 679
            K++ H  P    ++  +  Q+   D                        +H  +SIP +E
Sbjct: 699  KINLHGNPSLPPIHSPLENQVHSLDT-----------------HKQNGAIHRHFSIPILE 741

Query: 680  QNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANG 739
            ++ N YVSLSITGLRNLGNTCYINSM+QCLFAT  FRN+F+S KY++++    P      
Sbjct: 742  KSENDYVSLSITGLRNLGNTCYINSMLQCLFATTEFRNIFLSHKYEKYMDHDIP------ 795

Query: 740  SQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRL 799
            +   +S++F +LFKKMY+NGGCSVVP  FLK+C++LRPD +IPDDQQDT EFLMLILDRL
Sbjct: 796  TNQRLSKSFNMLFKKMYMNGGCSVVPTGFLKTCNILRPDLRIPDDQQDTQEFLMLILDRL 855

Query: 800  HDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSL 859
            HDELSNQ  V  +YPDL+ YD   + VQ  +Y KW+++SV  NGLSPID +FQGQ E+ L
Sbjct: 856  HDELSNQHEVKLDYPDLVDYDVDDMEVQPGQYIKWYNESVKSNGLSPIDHVFQGQTEDGL 915

Query: 860  HCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCP 919
             CQRCG SSF YSTFY+LSLAIPKA+++ F + KRV+LE+C+ M+T+DE+LS ENAWDCP
Sbjct: 916  VCQRCGCSSFTYSTFYILSLAIPKASTNAFGKIKRVNLEDCIKMFTNDEILSDENAWDCP 975

Query: 920  NCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELNV 979
             C       +  + + +  K   D                                 LN 
Sbjct: 976  RCGSAAPK-QEPIHRHREKKHIHDI-------------SPPPRSPSSPEPRSKRFFLLNA 1021

Query: 980  SK-INRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDE--LREMKEEMKQWK---- 1032
             + + RS SP R+L G              R   D  R++ E   R   E +   K    
Sbjct: 1022 PREVVRSYSPLRILPG-------------GRHSFDKPRELKEHYSRSADENLSDDKENQN 1068

Query: 1033 --------------SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
                          S K+ TIK++NF++ PR L+IHLSRFYYDLTKKN+T++TYPL LNI
Sbjct: 1069 HTTPNGRAGRVRHYSGKMVTIKSVNFVKAPRILVIHLSRFYYDLTKKNNTVITYPLHLNI 1128

Query: 1079 VLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRH 1138
             LK+ EV +YKLYG+VNHTG L+SGHYTS+V+K  DH L S    W+YFDDE+VK E  H
Sbjct: 1129 SLKNGEVARYKLYGLVNHTGTLVSGHYTSLVNKDTDHELGSEKQKWFYFDDEIVKEEKNH 1188

Query: 1139 GDVKHGVMKISSSDVYVLFYERI 1161
            GD++ GV  ISSS VYVLFY+RI
Sbjct: 1189 GDIEGGVTSISSSHVYVLFYQRI 1211

 Score =  144 bits (364), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 101/297 (34%), Positives = 145/297 (48%), Gaps = 74/297 (24%)

Query: 9   STALP-FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKD 67
           +  LP +TPE SDEL Q V ++Y ++  T  PQL+L++LIDLL+H+ +L+E Y   L   
Sbjct: 4   TKTLPNYTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDS 63

Query: 68  QNMDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEV 127
              DAL +FI G FY+Y ++PQS QF T+NR + +Y +++ LYE ++NMTNVL MVK E+
Sbjct: 64  HFDDALSAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEI 123

Query: 128 QVVLESQWDSASLNER--------IPRNRAYSVPD-------------EARVVQNLDKLT 166
             +L+S + S + +          I R RA+SVP+             ++++  ++D L 
Sbjct: 124 TKILDSNYKSQNESSNNLFVDSKFIRRERAFSVPNASNPFSLMNDTSLDSQLDNSMDTLN 183

Query: 167 LQSPT-----ETRGGRPRSQKK--------------------------------QLLQLP 189
             S T      T  G   S                                     LQLP
Sbjct: 184 TSSTTVLSNKGTSAGPSFSNNSVTPNPTFRITLAKDANNMSANGNNSNSNSGINSSLQLP 243

Query: 190 RPGNV-PVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEV 245
           R      VHSD E+  E                D+SSPLW APQL+  +QLKLA + 
Sbjct: 244 RYQYTNEVHSDVEYSIEDT--------------DESSPLWTAPQLDSKNQLKLAPDA 286

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
            UBP7Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1071

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/843 (46%), Positives = 517/843 (61%), Gaps = 58/843 (6%)

Query: 345  FKDFTPDRSLTHRKNSYHSVYMLEESESSQGN--LYYDESNAYIQSLERLQKQSIITAPE 402
            F++ T DRS+THRK+SYHSVYM++     + N  L+  E++ +IQSL+ LQKQSIITAPE
Sbjct: 259  FREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDLFNVENDGFIQSLDILQKQSIITAPE 318

Query: 403  LFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELES 462
            LFSILSN  + ++              + I+APN V++DP +LW+  +  P+Y+   LE 
Sbjct: 319  LFSILSNRVEREKVLLIDLRIPQRSAINHIVAPNLVNVDPNLLWDKQTNTPIYKDDILEH 378

Query: 463  KLN-NPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGY 521
             L  N  F  R++FDY+VY++D+KTFM +NFDY F FFYL+ T++  PL  VPT LLGGY
Sbjct: 379  LLKENENFINRNKFDYIVYYTDVKTFMTINFDYAFIFFYLMLTSQKTPLTTVPTTLLGGY 438

Query: 522  EKWKKVILEYGKQYNICVTDYLVR-ITEGEDDTPARHDCQELPYRQQNFAGINGPGAV-E 579
            EKWKK +  Y ++Y+I + DYL R  ++       +   Q+ P  Q +F+       V E
Sbjct: 439  EKWKKTLHSYAQEYHISIEDYLYRPYSQKARLQQEQQQQQQQPDSQDSFSAKESSTKVPE 498

Query: 580  P--WKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQ-HRAPFQSNLNFV 636
            P  WKP ++P  +RKR                     +IM+ S+VS   R P       V
Sbjct: 499  PPSWKPPDLPIRLRKRPPPPPPVSMPTTPEIPPPLPPKIMVHSQVSSISRKPPIPAKQHV 558

Query: 637  TGQILEADEDTALQVAPTKRIQQ---------EPFRSATNGLHETYSIPTIEQNPNIYVS 687
              + L ++E     +   KR  Q         +P R+        Y+IPTIE++PN+YVS
Sbjct: 559  KKEQLNSNE-----IIQRKRQHQHQHYDQQILQPQRA--------YNIPTIERSPNVYVS 605

Query: 688  LSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQ--PVIS 745
            LSITGLRNLGNTCYINSMIQCLFA K+FR LFIS KYK +L+ +     +NGS   P +S
Sbjct: 606  LSITGLRNLGNTCYINSMIQCLFAAKTFRTLFISSKYKSYLQPIR----SNGSHYSPKLS 661

Query: 746  RTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
             +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EFLM++LDRLHDELS+
Sbjct: 662  NSLSMLFNKMYLNGGCSVVPTGFLKVINQLRPDLKIPDDQQDTQEFLMILLDRLHDELSD 721

Query: 806  QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCG 865
            Q  V N+YP+L+LY+   L V N EYK WFDK+VIGNG+SPIDDIFQGQMENSL C+RCG
Sbjct: 722  QQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQCKRCG 781

Query: 866  HSSFNYSTFYVLSLAIPKATS--STFSRS--KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
            +++FNYSTFYVLSLAIP+ +   S   RS  KRV LE+C+NM+TSDEVLSGENAWDCP C
Sbjct: 782  YTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTSDEVLSGENAWDCPRC 841

Query: 922  ---CKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELN 978
                 ++     +  +    K+ +                                    
Sbjct: 842  GPTASVSTSVSALENEPSIVKSKKKKSRFFTLHTGTKRRHLDFFGDGITEGHNSNNNNTT 901

Query: 979  VSKINRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWKSKKLFT 1038
            + +  RS SPFR+LGG                D +   D        +++   K+    T
Sbjct: 902  IFERERSRSPFRMLGGSGKRSSSSTPFSTGGNDSNNSSDYKN-----KKLTTVKTINFVT 956

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTG 1098
            +  +  I + R        FYYDLTKKN+T+VTYPLILNI+LK+N+ +KYKL+GVVNHTG
Sbjct: 957  LPKILVIHLSR--------FYYDLTKKNNTVVTYPLILNIILKNNDTMKYKLFGVVNHTG 1008

Query: 1099 NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
             LISGHYTS+V+K L+H++N     WYYFDDEVVK + +HG  K+  +KISSSDVYVLFY
Sbjct: 1009 TLISGHYTSLVNKDLEHNVNIGRSKWYYFDDEVVKADRKHGSDKN--LKISSSDVYVLFY 1066

Query: 1159 ERI 1161
            ER+
Sbjct: 1067 ERV 1069

 Score =  162 bits (411), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 153/254 (60%), Gaps = 44/254 (17%)

Query: 7   DDSTAL-----PFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYL 61
           D  TA+     PFTPE S+EL +RV  +Y +DI    PQL+L++L+DLLEHTE+L+ELYL
Sbjct: 5   DKGTAMHPHITPFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYL 64

Query: 62  SCLGKDQNMDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLL 121
             +  D+  DAL +FI GC+YV+L++PQS+QF TRN+++++Y+D++ +YE+++NMTNV+L
Sbjct: 65  DSIHHDRPNDALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVL 124

Query: 122 MVKEEVQVVL-ESQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRS 180
           MVK+E+ VVL ES    A +  RI + RA+SVP         D L+ Q  + +       
Sbjct: 125 MVKKEIGVVLDESVKHGAGIEHRITKKRAFSVP--------ADDLSGQVASLS------- 169

Query: 181 QKKQLLQLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLD-DQSSPLWRAPQLEPNDQL 239
                L    P +                 HG    +++ D +QSSP+W AP LEPNDQL
Sbjct: 170 -----LDTAAPQD-----------------HGLKGTFTEDDAEQSSPVWTAPNLEPNDQL 207

Query: 240 KLAAEVHDLPPGAI 253
           KLA     +P  A 
Sbjct: 208 KLALLPEVIPTPAF 221

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
            YIL156W
          Length = 1025

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/503 (57%), Positives = 343/503 (68%), Gaps = 72/503 (14%)

Query: 668  GLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEF 727
             L   YSIPTIE++ N YVSLSITGLRNLGNTCYINSM+QCLFAT  FR+LF+S K++EF
Sbjct: 585  SLQRHYSIPTIEKSSNTYVSLSITGLRNLGNTCYINSMLQCLFATTKFRDLFVSGKFEEF 644

Query: 728  LKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQD 787
              +         ++P +S++F ILF+KMY+NGGCSVVP SFLK    LRPD +IPDDQQD
Sbjct: 645  FNQ------NYSNRPQLSKSFNILFRKMYINGGCSVVPTSFLKVLDHLRPDLRIPDDQQD 698

Query: 788  TTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPI 847
            T EFLM+ LDRLHDELSNQ AV NEYPDL+LYDE +++V  KEYKKWF++SVIGNGL+PI
Sbjct: 699  TQEFLMVTLDRLHDELSNQAAVANEYPDLLLYDEHQMDVNGKEYKKWFEESVIGNGLAPI 758

Query: 848  DDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSD 907
            D IFQGQ+EN L CQRCG+SSF+YSTFYVLSLAIPK ++STFSR+KRV LE+C+NM+T+D
Sbjct: 759  DHIFQGQIENILECQRCGNSSFSYSTFYVLSLAIPKPSTSTFSRAKRVKLEDCINMFTND 818

Query: 908  EVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXX 967
            E+LSGENAWDCP C     D                                        
Sbjct: 819  EILSGENAWDCPKCGSAVTD------------------------------MGPNHLKKSK 848

Query: 968  XXXXXELGELNVSKIN---------RSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDI 1018
                 ELGE   SK           RS SPFR+LG                         
Sbjct: 849  KKKKSELGEERRSKSGFFRIHSKSKRSKSPFRMLGST----------------------- 885

Query: 1019 DELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
                +    M+ WKSK+L T KTLNFI +P  LIIHLSRFYYDLTKKN TIVTYPL+LNI
Sbjct: 886  ----KFPLAMEDWKSKELSTKKTLNFIFLPPVLIIHLSRFYYDLTKKNDTIVTYPLVLNI 941

Query: 1079 VLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRH 1138
            +LK+NE  +Y+LY VVNHTGNLISGHYTS+V+K+  H L+     WYYFDDEVVK ET+H
Sbjct: 942  ILKNNETARYRLYAVVNHTGNLISGHYTSLVNKEPMHKLDKGRQKWYYFDDEVVKEETKH 1001

Query: 1139 GDVKHGVMKISSSDVYVLFYERI 1161
            G++  G++K+SSSDVYVLFYER+
Sbjct: 1002 GNIDQGILKVSSSDVYVLFYERL 1024

 Score =  296 bits (758), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 189/549 (34%), Positives = 287/549 (52%), Gaps = 88/549 (16%)

Query: 10  TALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQN 69
           T + FTPE S+EL + V  +Y DDI     Q +L++L+DLLEHTE+L+E YL  L +  N
Sbjct: 4   TEVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEKNN 63

Query: 70  MDALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQV 129
            DAL +FI GC+Y+YL++PQSI+F TRN+++++++D+  +Y++Q NMTNVLLMVK+EV  
Sbjct: 64  QDALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEVDS 123

Query: 130 VLE-SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQL 188
           +L+ +  +      +  R RAYSVPD     +N +                         
Sbjct: 124 ILDRNAREFKEFEHQKARTRAYSVPD-----RNFES------------------------ 154

Query: 189 PRPGNVPVHSDSEFIAEQGISLHGDDSGWSDL-----DDQSSPLWRAPQLEPNDQLKLAA 243
            R  N+ +H+++        +    + G  D+     D+ SSP+W AP LEPNDQL++A 
Sbjct: 155 -RLTNLNIHNENPLPLGDHQAASKSEQGREDMNNLQNDEDSSPVWTAPPLEPNDQLRIAL 213

Query: 244 EVHDLPPGAISRGSXXXXXXXXXXXXIGYEEMGIYGLXXXXXXXXXXXXXXXXXXXQSPI 303
           +   L P  ++               +  +E+ I                      +   
Sbjct: 214 DATPLSPSIMA-----------LDQPMATKELAI--------------STSRKALSRRAS 248

Query: 304 TSGGTPAAIDDLXXXXXXXXXXXXXXPAAQTVPPGGAH------DRSFKDFTPDRSLTHR 357
             G TP  I++L                      G +H      +++  +   DR  THR
Sbjct: 249 AMGPTPYPIEELDISGQD----------------GNSHYDELGFNKTLWNANVDRQTTHR 292

Query: 358 KNSYHSVYMLEE-SESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNEQQSKQX 416
           K+SYHSVYM E  S+    ++    S  + Q LERLQKQSIITAPELF+ILS+ ++S++ 
Sbjct: 293 KDSYHSVYMFEGGSDDHMPSI----SKDFTQGLERLQKQSIITAPELFTILSSSEESEKL 348

Query: 417 XXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFD 476
                        + IIAP TV IDP+ LW+  +  P+     L+  +  P F  R  +D
Sbjct: 349 LLIDFRLSKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSYD 408

Query: 477 YVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYN 536
           Y+VY++DMKT+M +++DY FT FYLL  +    L+ +PT LLGGYEKWKK++  Y   + 
Sbjct: 409 YIVYYTDMKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHG 468

Query: 537 ICVTDYLVR 545
           + + +Y+ R
Sbjct: 469 VNMDNYIYR 477

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  551 bits (1419), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 297/604 (49%), Positives = 384/604 (63%), Gaps = 29/604 (4%)

Query: 338 GGAH----DRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGN--LYYDESNAYIQSLER 391
           GGA     + SF + T DRS+THRK+SYHS+YM++     + N  L   E++ +IQSL+ 
Sbjct: 239 GGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDNDDLLNVETDEFIQSLDI 298

Query: 392 LQKQSIITAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSG 451
           LQKQSIITAPELFSILSN  + ++              + I+APN V IDP +LW+  + 
Sbjct: 299 LQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEINHIVAPNLVKIDPNLLWDRKTN 358

Query: 452 APMYEITELESKLN-NPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPL 510
            P+Y+   LE  L  N +F  RD+F+YVVY++D+KTFM +NFDY F FFYL+ T++   L
Sbjct: 359 TPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFMYMNFDYVFIFFYLMLTSQKTHL 418

Query: 511 KCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVR-----ITEGEDDTPARHDCQELPYR 565
             VPT LLGGYEKWKK +  Y ++Y++ + DYL R       + +     + + Q+    
Sbjct: 419 TSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYRPYSQKAHQQQQQEQQQSNAQDSSSS 478

Query: 566 QQNFAGINGPGAVEPWKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQH 625
           +++ A +  P +   WKP ++P  +RKR                     +IM    V  H
Sbjct: 479 KESSAKVPEPPS---WKPPDLPIRLRKRPPPPPPVSMPTTPGIPPPLPPKIM----VYSH 531

Query: 626 RAPFQSNLNFVTGQILEADEDTALQVAPTKRIQQEP----FRSATNGLHETYSIPTIEQN 681
              F         Q ++  +  + ++   KR QQ+      +         Y+IPTIEQ+
Sbjct: 532 DNSFSRKPPIPAKQHVKKQQLNSNEIIQRKRQQQKHRHYGQQLLQPQPQRAYNIPTIEQS 591

Query: 682 PNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQ 741
            N+YVSLSITGLRNLGNTCYINSMIQCLFA K FR LFIS  YK +L+   PK   +   
Sbjct: 592 SNVYVSLSITGLRNLGNTCYINSMIQCLFAAKIFRTLFISANYKNYLQ--PPKGSRSAHS 649

Query: 742 PVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
             +S +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EFLM++LDRLHD
Sbjct: 650 SKLSNSLNMLFNKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEFLMILLDRLHD 709

Query: 802 ELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
           ELSNQ  V N+YP+L+LY+   L V N EYK WFDK+VIGNG+SPIDDIFQGQMENSL C
Sbjct: 710 ELSNQQHVANDYPNLLLYNADALKVSNNEYKHWFDKNVIGNGISPIDDIFQGQMENSLQC 769

Query: 862 QRCGHSSFNYSTFYVLSLAIPKATS--STFSRS--KRVSLEECLNMYTSDEVLSGENAWD 917
           +RCG+++FNYSTFYVLSLAIP+ +   S   RS  KRV LE+C+NM+T DEVLSGENAWD
Sbjct: 770 KRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRSTEKRVKLEDCINMFTDDEVLSGENAWD 829

Query: 918 CPNC 921
           CP C
Sbjct: 830 CPRC 833

 Score =  192 bits (489), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 114/131 (87%), Gaps = 2/131 (1%)

Query: 1031 WKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKL 1090
            +K+KKL T+KT+NF+ +P+ L+IHLSRFYYDLTKKNST++TYPLILNI+LK+NE +KY+L
Sbjct: 933  FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNSTVITYPLILNIILKNNETMKYRL 992

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            +GVVNHTG L+SGHYTS+V+K L+HS++     WYYFDDEVVK + +HG  K+  +KISS
Sbjct: 993  FGVVNHTGTLVSGHYTSLVNKDLEHSVDIGRSKWYYFDDEVVKADNKHGSDKN--LKISS 1050

Query: 1151 SDVYVLFYERI 1161
            SDVYVLFYER+
Sbjct: 1051 SDVYVLFYERV 1061

 Score =  160 bits (404), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 145/231 (62%), Gaps = 39/231 (16%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S+EL +RV  +Y +DI    PQL+L++L+DLLEHTE+LYELYL  +  ++  DAL
Sbjct: 8   FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPNDAL 67

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132
            +FI GC+YV+L++PQS+QF TRN+++++Y+D++ +YE+++NMTNV+LMVK+E+ VVL E
Sbjct: 68  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 127

Query: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
           S   +  +  RI + RA+SVP      Q +  L+L++                       
Sbjct: 128 SVKHAVGIEHRITKKRAFSVPANDLSGQ-VASLSLEN----------------------- 163

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLD-DQSSPLWRAPQLEPNDQLKLA 242
                         G   HG  + +++ D +QSSP+W AP LEPNDQLKLA
Sbjct: 164 -------------AGPHGHGFKASFTEEDAEQSSPVWTAPNLEPNDQLKLA 201

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
            YIL156W (REAL)
          Length = 1062

 Score =  531 bits (1368), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 275/496 (55%), Positives = 330/496 (66%), Gaps = 24/496 (4%)

Query: 672  TYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEV 731
             Y IPTIEQ+ N YVSLSITGLRNLGNTCYINSMIQCLFA K FR LFIS KYK +L++ 
Sbjct: 583  VYHIPTIEQSSNAYVSLSITGLRNLGNTCYINSMIQCLFAAKVFRTLFISSKYKSYLQQS 642

Query: 732  APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEF 791
                G     P +S +  +LF KMYLNGGCSVVP  FLK  + LRPD KIPDDQQDT EF
Sbjct: 643  R---GNRLHSPRLSNSLNMLFDKMYLNGGCSVVPTGFLKVVNQLRPDLKIPDDQQDTQEF 699

Query: 792  LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIF 851
            LM++LDRLHDELSNQ  V N+YP+L+LYD   L V NKEYK WFDK+VIGNG+SPIDDIF
Sbjct: 700  LMILLDRLHDELSNQPHVANDYPNLLLYDADGLKVSNKEYKHWFDKNVIGNGISPIDDIF 759

Query: 852  QGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATS--STFSR--SKRVSLEECLNMYTSD 907
            QGQMENSL C+RCG+++FNYSTFYVLSLAIP+ +   S   R   KRV LE+C+NM+TSD
Sbjct: 760  QGQMENSLQCKRCGYTTFNYSTFYVLSLAIPRRSMKLSKLGRPNEKRVKLEDCINMFTSD 819

Query: 908  EVLSGENAWDCPNCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXX 967
            EVLSGENAWDCP C                N +                           
Sbjct: 820  EVLSGENAWDCPRCGPTASTSLSASASALENDSNIVKSRKKKSRFFTLHTRSKRRHLDFF 879

Query: 968  XXXXXELGELNVSKI--NRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDELREMK 1025
                 E    N       RS SPF++LGG                D +   D        
Sbjct: 880  GDSSNESTSNNPVHFERERSRSPFKMLGGGGKRSHSNTPFANSSNDGNNFND-------- 931

Query: 1026 EEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEV 1085
                 +K+KKL T+KT+NF+ +P+ L+IHLSRFYYDLTKKN+T++TYPLILNI+LK+N+ 
Sbjct: 932  -----FKNKKLTTVKTINFVTLPKILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNDT 986

Query: 1086 VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGV 1145
            +KY+L+GVVNHTG LISGHYTS+V+K L+H+++     WYYFDDEVVK + +HG  K   
Sbjct: 987  MKYRLFGVVNHTGTLISGHYTSLVNKDLEHNVDIGRSKWYYFDDEVVKADKKHGSDKS-- 1044

Query: 1146 MKISSSDVYVLFYERI 1161
            +KISSSD YVLFYER+
Sbjct: 1045 LKISSSDAYVLFYERV 1060

 Score =  158 bits (399), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 144/241 (59%), Gaps = 37/241 (15%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S+EL +RV  +Y +DI    PQL+L++L+DLLEHTE+L+ELYL  +  ++  DAL
Sbjct: 8   FTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPNDAL 67

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132
            +F+ GC+YV+L++PQS+QF TRN+++++YSD++ +YE+++NMTNV+LMVK+E+ VVL +
Sbjct: 68  TAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVVLDD 127

Query: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
           S      +  RI + RA+SVP    +   L  L+L +        PR             
Sbjct: 128 SVKHVVGIEHRITKKRAFSVPG-IDLSDQLASLSLDA------AGPRGH----------- 169

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDLPPGA 252
                            LH   S   D  DQSSP+W AP LEPNDQLKLA     +P  A
Sbjct: 170 -----------------LHKTSSTEEDA-DQSSPVWTAPNLEPNDQLKLALLPEVIPTPA 211

Query: 253 I 253
            
Sbjct: 212 F 212

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
            uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 1012

 Score =  517 bits (1331), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 267/509 (52%), Positives = 334/509 (65%), Gaps = 59/509 (11%)

Query: 658  QQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRN 717
            Q+  +   T  LH  +SIPTIE++PN +VSLSITGLRN+GNTCYINSM+QCLF    FR+
Sbjct: 555  QRNDWTVQTQHLHVPFSIPTIERSPNEFVSLSITGLRNMGNTCYINSMLQCLFGCSQFRD 614

Query: 718  LFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRP 777
            LF+  KY  +L    PK     S  +IS+ F +LF+KMYLNGGCSVVP  FLK+C +LRP
Sbjct: 615  LFLGGKYHRYLN---PK----RSNTIISKWFSLLFRKMYLNGGCSVVPNGFLKACHMLRP 667

Query: 778  DFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDK 837
            DF IP DQQDT EFL+ +LD LHDELS    V N+YP+L+L+D++KL V NKEY KWFD+
Sbjct: 668  DFHIPTDQQDTQEFLLFLLDTLHDELSEPTKVANDYPNLLLHDDEKLLVDNKEYDKWFDE 727

Query: 838  SVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKA-TSSTFSRSKR-V 895
             +  NGLSPIDDIFQGQMENSL CQRCG +S+NYSTFYVLSLAIP      TFSRSK+ +
Sbjct: 728  GLKNNGLSPIDDIFQGQMENSLKCQRCGFTSYNYSTFYVLSLAIPAMPPPKTFSRSKKII 787

Query: 896  SLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGMV--EKTKRNKAARDTXXXXXXXXX 953
             LE+C+N+YT DE+L+GENAWDCP C   +    G +  ++T   K  ++          
Sbjct: 788  RLEDCINLYTQDELLTGENAWDCPKCGTHSNSSDGSMNSDETVDKKKKKN---------- 837

Query: 954  XXXXXXXXXXXXXXXXXXXELGELNVSKI-NRSLSPFRVLGGXXXXXXXXXXXXXXRADV 1012
                               +  +L+ S+   RSLSPF+                      
Sbjct: 838  -------FLSVNGDHKSRSKFFKLSSSRSGKRSLSPFKS--------------------- 869

Query: 1013 DAQRDIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTY 1072
                       +K E    KSKK+ TIKTLNFI MP  L+IHLSRF+YDLTKKN T++ Y
Sbjct: 870  ---------NSVKPEKLHIKSKKMTTIKTLNFITMPNILVIHLSRFFYDLTKKNETMINY 920

Query: 1073 PLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            PLIL++VLK+NE+ +Y+LYG++NH GNL+SGHYTS+V+K L H +      WYYFDDEVV
Sbjct: 921  PLILDVVLKNNEIARYRLYGIINHFGNLVSGHYTSLVNKHLSHEIRKGQQKWYYFDDEVV 980

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            K+E  HGD   G+  ISS DVYVLFYERI
Sbjct: 981  KKEFNHGDFDRGITSISSGDVYVLFYERI 1009

 Score =  106 bits (265), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 58/178 (32%), Positives = 95/178 (53%), Gaps = 12/178 (6%)

Query: 351 DRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNE 410
           DRS THRK+SYHSVY+ +E E         + N     L R Q+++ I    LFS+L + 
Sbjct: 280 DRSRTHRKDSYHSVYLGDELE---------DLNNISTGLARHQQENTIDCFALFSLLKDA 330

Query: 411 QQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFN 470
           +  +              ++ ++APN ++IDP +L+++  G  +     L+  + NP+ +
Sbjct: 331 ESRENLLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILD 390

Query: 471 RRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVI 528
           +  ++D +VY++D K+FM L F+Y    F LL    G     +P  LLGGYE+WK  +
Sbjct: 391 KISQYDNIVYYTDYKSFMHLTFNYELILFELLFKKTG---TAIPKSLLGGYEQWKAFL 445

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 119/230 (51%), Gaps = 43/230 (18%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           +TPE SDEL   V +VY+ D+     +L+L++LI+LLE  E L+E Y   L  ++  D L
Sbjct: 5   YTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKYEDCL 64

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
             ++ G FYV+L++P S+QF  RN+++++YSD++ LY+ ++NM+NVLLMV  +V  VL  
Sbjct: 65  CEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDSVLNQ 124

Query: 134 QWDSASLNERIP-RNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
             +  +     P R RA+SV +E  +   L  L L +                       
Sbjct: 125 NMEILAKQHLDPSRKRAFSV-EEPIIRYQLHNLQLNN----------------------- 160

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242
                      A+Q        S   D    +S  W+APQL+PND+L LA
Sbjct: 161 -----------ADQK-------SVDDDYKSFASTEWKAPQLDPNDRLHLA 192

>Kpol_2001.78 s2001 complement(213762..214973) [1212 bp, 403 aa] {ON}
            complement(213762..214973) [1212 nt, 404 aa]
          Length = 403

 Score =  495 bits (1274), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 258/465 (55%), Positives = 315/465 (67%), Gaps = 72/465 (15%)

Query: 705  MIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVV 764
            M+QCLF TK  R+LFIS KY+++L +   +         +SR+F ILFKKMYLNGGCSVV
Sbjct: 1    MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSN------LSRSFSILFKKMYLNGGCSVV 54

Query: 765  PISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKL 824
            P SFLK+C+ LRPD +IPDDQQDT EFLML+LDRLHDELSNQ+ V  +YPDL+LYD +KL
Sbjct: 55   PTSFLKTCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKL 114

Query: 825  NVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKA 884
             V NKEY KWFDK++  NGLSPID IFQGQ+EN+L CQRCG  S+NYSTFYVLSLAIPK 
Sbjct: 115  RVNNKEYSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKP 174

Query: 885  TSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKIT-------KD-YKGMVEKTK 936
            +S TFSRSKRV LE+C+NM+T+DEVLSGENAWDC NC   +       KD   G  E+ K
Sbjct: 175  SSGTFSRSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKK 234

Query: 937  RNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXELGELNVSKINRSLSPFRVLGGXX 996
            R++ +R                               L  +N  + +RS+SPFR      
Sbjct: 235  RSRKSR----------------------------LFLLPNIN-GRSSRSISPFRKSASP- 264

Query: 997  XXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLS 1056
                                     R   E++K    KKL TIK++NFI +P TL+IHLS
Sbjct: 265  -------------------------RPPHEKLKH---KKLVTIKSMNFISLPPTLVIHLS 296

Query: 1057 RFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHS 1116
            RFYYDL+KKN TIVTYPLILNIVL +NE  KY+LYG+VNHTGNLISGHYT++V+K+ +H 
Sbjct: 297  RFYYDLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHE 356

Query: 1117 LNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            L  +   WYYFDDEVVK E  HG++  GV+K+SSS VYVLFYER+
Sbjct: 357  LKKDKQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERV 401

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  483 bits (1243), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 266/588 (45%), Positives = 348/588 (59%), Gaps = 65/588 (11%)

Query: 339 GAHDRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSII 398
            ++   F D   +R  THRK+SYHSV+M             D+ +A+  +L RLQKQS++
Sbjct: 252 ASNSSDFNDQKINRYATHRKDSYHSVHMSN-----------DDYDAFTFNLARLQKQSVV 300

Query: 399 TAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEIT 458
           T  +L  IL + Q                 T+ I+APN +++DP +LWN N G+P+    
Sbjct: 301 TCDQLMRILCS-QDRDNLLLIDLRFSKRFQTNHILAPNLLNVDPTLLWNQNKGSPIESDV 359

Query: 459 ELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLL 518
           +LE  L+N L N R +F+Y+VY++DMKTFMKL+FDY   FF L+ T+  K LKC P VLL
Sbjct: 360 QLERTLDNKLLNARSQFEYIVYYTDMKTFMKLDFDYQLVFFQLIYTS-NKNLKCTPKVLL 418

Query: 519 GGYEKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAV 578
           GGYE+WKK + +  + Y  C  D  +                   Y   N    NG  A 
Sbjct: 419 GGYEQWKKFLSKSSQAY--CDKDAFL-------------------YSSTN----NGRNA- 452

Query: 579 EPWKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIMLDSKVSQHRAPFQSNLNFVTG 638
            P   H +P                                +K   +RAPF + L     
Sbjct: 453 -PVTSHSLPEHYPVAPPSIPPPPPPIAKTEEM---------TKTPYNRAPFPTPL----V 498

Query: 639 QILEADEDTALQVAPTK---RIQQE--PFRSATNGLHETYSIPTIEQNPNIYVSLSITGL 693
           Q   AD   A     T+    IQ+   P  S      +  +IPTIEQ+PN YV+LSITGL
Sbjct: 499 QAQRADHFPASSQNHTRDKNEIQKHSVPALSGNGNYSKHTAIPTIEQSPNEYVALSITGL 558

Query: 694 RNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFK 753
           RN+G TCY+NSM+QCLFATK+FR+LF+S KY+ +       P        +S+ F +LFK
Sbjct: 559 RNIGCTCYVNSMLQCLFATKAFRDLFLSTKYEHYFSRKYTNPNQ------LSKYFNVLFK 612

Query: 754 KMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEY 813
           KMY+NGGCSVVP  FLK+C+ LRPDF+IP DQQDT EFL+ +L +LHDELS  + V N+Y
Sbjct: 613 KMYMNGGCSVVPTGFLKACNALRPDFRIPHDQQDTQEFLLFLLSQLHDELSESNRVANDY 672

Query: 814 PDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYST 873
           P L+L+D+KKL+V  KEY  WF+K +  NG+SPID+IFQGQMEN L CQRCGHSSFNYS 
Sbjct: 673 PGLLLHDDKKLDVDQKEYDTWFEKHISENGISPIDNIFQGQMENGLFCQRCGHSSFNYSV 732

Query: 874 FYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           FYVLSLAIP +T STFS+ K+V LE+C+N++TSDE L+ ENAWDCP C
Sbjct: 733 FYVLSLAIPSST-STFSQRKKVRLEDCINLFTSDEQLTNENAWDCPKC 779

 Score =  195 bits (495), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 87/137 (63%), Positives = 111/137 (81%)

Query: 1025 KEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNE 1084
            ++ +++ KSKKL TIKTLNFI +P  L IHLSRF+YDLTKKN+ ++TYPLIL+IVLK+ +
Sbjct: 834  QQNLEKLKSKKLTTIKTLNFISLPTVLTIHLSRFFYDLTKKNNKVITYPLILSIVLKNEQ 893

Query: 1085 VVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHG 1144
            ++KY+LY + NH GNLISGHYTS+V+K LDH LN     WYYFDDE VK++  HGD+  G
Sbjct: 894  IMKYRLYAIANHFGNLISGHYTSLVNKDLDHDLNKGKQKWYYFDDETVKKDINHGDIDAG 953

Query: 1145 VMKISSSDVYVLFYERI 1161
            +  ISSSDVYVLFYE+I
Sbjct: 954  ITSISSSDVYVLFYEKI 970

 Score =  151 bits (382), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 124/228 (54%), Gaps = 43/228 (18%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           ++PE S+EL Q V  VYT DI    P+LRL++LIDLLEH E+L+E Y   L  +Q  D L
Sbjct: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
            +F+ GCFY+YL++P SIQF +R++++ +Y+D++  Y+ + NMTNVLLMV E ++ + + 
Sbjct: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESMSKD 124

Query: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193
           + ++A    RI R RAYSVP                     G  P +   Q L       
Sbjct: 125 EVETA----RIMRKRAYSVP--------------------YGKSPVT--IQALSKANSAT 158

Query: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKL 241
           V   + +E   E G +                 +W AP+LEPND LK+
Sbjct: 159 VEPDAPTETEFENGTT-----------------MWTAPELEPNDHLKV 189

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  479 bits (1232), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 262/590 (44%), Positives = 360/590 (61%), Gaps = 47/590 (7%)

Query: 342 DRSFKDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAP 401
           ++ F D   DR++ HRK+SYHSVYM +       N       + +Q+++RLQKQSIIT+P
Sbjct: 273 EQHFWDAKVDRAVAHRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSP 332

Query: 402 ELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELE 461
           ELFSILSN+++  +              + I+APN V IDP+MLW+ N+  P+ +I+ L+
Sbjct: 333 ELFSILSNKKERNRLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLD 392

Query: 462 SKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGY 521
            +L N +FN+R  FD++VY++DMKT+M+++FDY F F+ L+  ++   L+ +P+ LLGGY
Sbjct: 393 ERLKNSIFNKRGSFDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGY 452

Query: 522 EKWKKVILEYGKQYNICVTDYLVRITEGEDDTPARHDCQELPYRQQNFAGINGPGAVE-- 579
           EKWK V+ +Y  Q+ I V DYL R                 PY            A    
Sbjct: 453 EKWKAVLKKYLTQFGIRVDDYLYR-----------------PYSSNKEGKEKSANAKHIE 495

Query: 580 --PWKPHEVPATIRKRXXXXXXXXXXXXXXXXXXXXXRIML----DSKVSQHRAPFQSNL 633
             PWKP  +P  +R                       +I L    D   ++ R+   S+ 
Sbjct: 496 PVPWKPPALPERMRNLPPPPPPATLPITKEMPPPVPPKIQLEQQEDKNHTRPRSRTVSSP 555

Query: 634 NFVTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGL 693
             V   ++  ++ + L   P ++ Q              +S+PTIE++ N YV+LSITGL
Sbjct: 556 AEVPKNVVAPEQLSQLDSYPMRQRQ--------------FSVPTIERSNNKYVALSITGL 601

Query: 694 RNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFK 753
           RNLG TCYINSM+QCLFAT  FR+LF    Y+ F        G       +S++F +L +
Sbjct: 602 RNLGATCYINSMLQCLFATNMFRDLFEPSNYERFFNPELEDTGK------LSKSFSVLIR 655

Query: 754 KMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEY 813
           KMY+NGGCSVVP SFLK C+ LRPDF IPDDQQD  EFLML +DRLHDELSNQ  V+N +
Sbjct: 656 KMYMNGGCSVVPTSFLKICNFLRPDFNIPDDQQDAQEFLMLTIDRLHDELSNQTEVLNAH 715

Query: 814 PDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYST 873
           P+L+LYD +   VQ +EYK+WF+ S+I    SPID IFQGQ+EN LHC++CG+SS++YST
Sbjct: 716 PELLLYDAETSKVQKEEYKQWFENSLINTKFSPIDKIFQGQLENGLHCKKCGYSSYSYST 775

Query: 874 FYVLSLAIPKATSSTFSRSKR--VSLEECLNMYTSDEVLSGENAWDCPNC 921
           FY+LSLAIPK +SS  S SK   V+LE+C+NM+TSDEV+S ENAWDCP C
Sbjct: 776 FYILSLAIPKPSSSFLSSSKGNWVNLEDCINMFTSDEVMSRENAWDCPKC 825

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 103/125 (82%)

Query: 1037 FTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNH 1096
            F+I+  NF+ +P  L+IHLSRFYYDLTKKN T++TYPLILNIVLK+NE +KY+LY VVNH
Sbjct: 919  FSIRATNFVTLPPVLVIHLSRFYYDLTKKNETVITYPLILNIVLKNNETLKYRLYAVVNH 978

Query: 1097 TGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVL 1156
             GNLISGHYTS+V+K  DH L +N   WYYFDDEVVK ET HG++  GV K+SS DVYVL
Sbjct: 979  NGNLISGHYTSLVNKNRDHDLENNRQQWYYFDDEVVKHETSHGNLSQGVNKVSSKDVYVL 1038

Query: 1157 FYERI 1161
            FYERI
Sbjct: 1039 FYERI 1043

 Score =  150 bits (380), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/231 (39%), Positives = 129/231 (55%), Gaps = 31/231 (13%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S EL + V  +Y DDI      L+L+ L DL++HT +LYE +   +      DAL
Sbjct: 8   FTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQDAL 67

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
            ++I GC+++YL++PQS QF  RN+   V++ ++ LYE+QVNMTNVLLMVK+EV  VL+ 
Sbjct: 68  TAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSVLDR 127

Query: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193
            +      + + R RA+S PD   +   + +LTL     T    P+  KK          
Sbjct: 128 DFRKL---KDVERKRAFSSPDNG-LDSEISRLTLAGNGST---LPKMHKKWDF------- 173

Query: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAE 244
             + SDS F        H  D+G       + PLW+AP LEPNDQLKLA +
Sbjct: 174 --IRSDSNF--------HSHDTG-------NVPLWKAPNLEPNDQLKLALD 207

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
            Ashbya gossypii AFR296C
          Length = 1517

 Score =  484 bits (1247), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 243/489 (49%), Positives = 318/489 (65%), Gaps = 60/489 (12%)

Query: 673  YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732
            +SIPTIE + N YV+LSITGLRN+ NTCYINSM+QCLF+T +FRNLF+S KY  +LK  +
Sbjct: 1087 FSIPTIENSYNEYVALSITGLRNMSNTCYINSMLQCLFSTSAFRNLFLSNKYAHYLK--S 1144

Query: 733  PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
            P+         +SR+FY+LF+KMY+NGGCSVVP  FLK C+ L+PD +IP  QQDT EFL
Sbjct: 1145 PE------MDTMSRSFYMLFRKMYMNGGCSVVPSGFLKMCNTLKPDLRIPYGQQDTQEFL 1198

Query: 793  MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
            + +LD+LHDELS+ ++V N+Y  L+L+D  +L V + +Y KWFD+++  NGLSPIDD+FQ
Sbjct: 1199 LFLLDKLHDELSSIESVSNDYSHLLLHDNVRLYVDDAQYNKWFDQNIDQNGLSPIDDLFQ 1258

Query: 853  GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
            GQMEN L CQRCG+SS+ YSTFYVLSLA+P   +  F ++K++ LE+C+N +T DEVLS 
Sbjct: 1259 GQMENQLSCQRCGYSSYTYSTFYVLSLALPNPVAKAFGKTKKLRLEDCINFFTCDEVLSD 1318

Query: 913  ENAWDCPNCCKITKDYKGMVEKTKRNKAARDTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 972
            +NAWDCP CC  + DY     K KR                                   
Sbjct: 1319 QNAWDCPRCCSPS-DYMSYDHKGKR----------------------------------- 1342

Query: 973  ELGELNVSKINRSLSPFRVLGGXXXXXXXXXXXXXXRADVDAQRDIDELREMKEEMKQWK 1032
                    KI+ S       GG              R+  +A +   +L +     K   
Sbjct: 1343 --------KISTSFESLN--GGNSSRSKLFKFGYKMRSRSEAPKFSSKLSDKVSNGKPAT 1392

Query: 1033 SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYG 1092
             K L      NFI MPR L+IHLSRF YDLTKKN+ +V+YPLILNIVLK++EV K++LY 
Sbjct: 1393 VKSL------NFITMPRILVIHLSRFIYDLTKKNNIVVSYPLILNIVLKNSEVAKFRLYS 1446

Query: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
            +VNH G LISGHYTS+V+K+L+H ++     WYYFDDE+VK +T HGD  +G+  +SSS+
Sbjct: 1447 IVNHFGTLISGHYTSLVNKELNHEISHGKQKWYYFDDEIVKFDTNHGDYDNGIASVSSSN 1506

Query: 1153 VYVLFYERI 1161
            VYVLFYERI
Sbjct: 1507 VYVLFYERI 1515

 Score =  135 bits (341), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/244 (35%), Positives = 126/244 (51%), Gaps = 35/244 (14%)

Query: 13  PFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDA 72
           P+ PE S EL Q V +VY +++     +LRL++LIDLLEH  +L E Y   LG+ Q    
Sbjct: 4   PYMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAG 63

Query: 73  LGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEV----Q 128
           + +++ G FY+YL++PQSI+FHTRN ++++Y D++  YES  NM NV+L+V  +V    Q
Sbjct: 64  ITAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQ 123

Query: 129 VVLESQWDSASLNERIPRNRAYSVP--DEARVVQNLDKLTLQSPTETRGGRPRSQKKQLL 186
           + L  + D         R RAYS+   D +++   L KL+++  + TRG      K    
Sbjct: 124 LYLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIER-SSTRGTTVFEGK---- 178

Query: 187 QLPRPGNVPVHSDSEFIAEQG-ISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEV 245
                             EQG       D  W D       +W AP LEP+DQLKLA   
Sbjct: 179 -----------------TEQGAFGQQQQDDEWEDT------VWSAPNLEPDDQLKLAVSY 215

Query: 246 HDLP 249
              P
Sbjct: 216 SHSP 219

 Score = 90.1 bits (222), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 72/114 (63%), Gaps = 3/114 (2%)

Query: 430 SKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMK 489
           S I+A N ++IDP++LW+   GAP+  + ELE  ++N LF  R +F  +V ++D  T+M+
Sbjct: 352 SHILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQ 411

Query: 490 LNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYL 543
           ++FD+ F  F LL    G+P + V   L GGYE+WK  + E  +  +I ++D+L
Sbjct: 412 IDFDFVFLLFRLL--YLGRP-QLVLKTLSGGYEQWKSFLKELKRTESIILSDFL 462

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  364 bits (934), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 168/271 (61%), Positives = 217/271 (80%), Gaps = 9/271 (3%)

Query: 651 VAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLF 710
           ++ +KR Q + +   +   H+  S+PTIEQ+ N+YVSLSITGLRNLG+TCYINSM+QCLF
Sbjct: 576 LSHSKRSQHQHYSPIS---HQYISVPTIEQSSNVYVSLSITGLRNLGSTCYINSMLQCLF 632

Query: 711 ATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLK 770
           AT+ FR++F+S KY +++     K   + +Q  ISR+F++LFKKMY+NGGCSVVP  FLK
Sbjct: 633 ATRKFRDIFLSPKYHDYIS----KGYIHRAQ--ISRSFHMLFKKMYMNGGCSVVPSGFLK 686

Query: 771 SCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKE 830
           +C+ +RPDFKIP+DQQDT EFL+ +LD+LHDELS+ + V N+YP L+L+D+  L V  KE
Sbjct: 687 ACNSMRPDFKIPNDQQDTQEFLLFLLDQLHDELSDPEQVANDYPQLLLHDDDNLQVDGKE 746

Query: 831 YKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFS 890
           Y KWF+ S+  NGLSPID IFQGQMEN L CQRCGHSS+NYSTFYVLSLAIP   +STF 
Sbjct: 747 YDKWFEDSISKNGLSPIDSIFQGQMENCLQCQRCGHSSYNYSTFYVLSLAIPTPGTSTFG 806

Query: 891 RSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++K+V LE+C+N++TSDEVLSGENAWDCP C
Sbjct: 807 KTKKVLLEDCINLFTSDEVLSGENAWDCPRC 837

 Score =  205 bits (521), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 94/133 (70%), Positives = 110/133 (82%)

Query: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088
            ++WKSKKL TIKT NFI MP  L+IHLSRF+YDLTKKNST++TYPLILNIVLK+NEV KY
Sbjct: 903  EKWKSKKLTTIKTFNFITMPPILVIHLSRFFYDLTKKNSTVITYPLILNIVLKNNEVAKY 962

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148
            +LYG+VNH GNLISGHYTS+V+K L H +      WYYFDDEVVK++  HGD   G+  +
Sbjct: 963  RLYGIVNHFGNLISGHYTSLVNKDLKHEIRHGQQKWYYFDDEVVKQDNNHGDFDAGIASV 1022

Query: 1149 SSSDVYVLFYERI 1161
            SSSDVYVLFYERI
Sbjct: 1023 SSSDVYVLFYERI 1035

 Score =  159 bits (401), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/229 (42%), Positives = 133/229 (58%), Gaps = 34/229 (14%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           +TPE S+EL Q V  VY  DI    P+L+L++LIDLLEH E+L+E Y   L +    DAL
Sbjct: 5   YTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQEDAL 64

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
            +FI G FYVYL++PQSIQFHTRN+++ +Y D+R  Y+ + +MTNVLLMV ++V  +L  
Sbjct: 65  TAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAILCK 124

Query: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193
             D    + +I R RAYSVP +A +   L  LTL +   T G         L QLP    
Sbjct: 125 SRDFD--DTKITRKRAYSVPSQA-LANQLRSLTLNN---TDG---------LEQLPE--- 166

Query: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLA 242
           V   SD+                 ++  D  + +W AP+LEP+DQLKLA
Sbjct: 167 VSKESDT----------------LTNYADDYTTIWSAPKLEPDDQLKLA 199

 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 114/198 (57%), Gaps = 13/198 (6%)

Query: 351 DRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAY--IQSLERLQKQSIITAPELFSILS 408
           DR  THRK+SYHSVYML E          D++N Y   Q+L RLQKQ +I+  EL  IL 
Sbjct: 289 DRYNTHRKDSYHSVYMLNED---------DDTNEYDFFQNLSRLQKQYVISCEELMDILQ 339

Query: 409 NEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNN-P 467
           +++++              N + I+APN ++IDP+ LW+ +   P+    ELE K+ +  
Sbjct: 340 SDERNNVLLVDLRISKRFHN-NHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQ 398

Query: 468 LFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKV 527
            F  R +F Y+VY++DMKTF+ ++FDY   FF LL  +    L+  P  LLG YE+WK  
Sbjct: 399 TFQSRSKFKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTF 458

Query: 528 ILEYGKQYNICVTDYLVR 545
           I +Y K ++I   DYL R
Sbjct: 459 IGQYAKHHDIVTGDYLFR 476

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score =  364 bits (934), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/248 (66%), Positives = 207/248 (83%), Gaps = 8/248 (3%)

Query: 675 IPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK-EVAP 733
           +PTIEQNPN YVSLSITGLRNLGNTCYI+SM+QCLFAT + R+LFI+ KY+ ++  +V  
Sbjct: 609 VPTIEQNPNTYVSLSITGLRNLGNTCYISSMLQCLFATTTLRDLFITTKYESYINHKVTD 668

Query: 734 KPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLM 793
           K         +SR+F ILF+KMYLNGGCSVVP SFLK+C+ LRPD KIPDDQQDT EFLM
Sbjct: 669 KIN-------LSRSFSILFRKMYLNGGCSVVPASFLKTCNQLRPDLKIPDDQQDTQEFLM 721

Query: 794 LILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQG 853
           L+LDRLHDELS +D V+N+Y +L+LYD ++++V+  +YKKWF+ S +  G+SPIDDIFQG
Sbjct: 722 LVLDRLHDELSKEDTVLNDYSNLLLYDAERMHVKVDQYKKWFENSNLSGGVSPIDDIFQG 781

Query: 854 QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGE 913
           Q+ENS++CQRCG+SSFNYS+FYVLSLAIPK +  +FSR+ RV LE+C+NM+T DEVLSGE
Sbjct: 782 QIENSINCQRCGYSSFNYSSFYVLSLAIPKISVMSFSRTNRVKLEDCINMFTRDEVLSGE 841

Query: 914 NAWDCPNC 921
           NAWDC  C
Sbjct: 842 NAWDCSRC 849

 Score =  201 bits (510), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 141/213 (66%), Gaps = 2/213 (0%)

Query: 340 AHDRSF--KDFTPDRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSI 397
            HD S   +D   DRS+THRK+SYHSVYM  + E S    +Y  SN+YIQS++RLQKQ++
Sbjct: 287 VHDNSMLIEDLPVDRSVTHRKDSYHSVYMNNQDEESDSGAHYGLSNSYIQSMDRLQKQNV 346

Query: 398 ITAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEI 457
           IT  EL+SILS+  + ++             T+ IIAP+ + IDP +LWN  +  P+Y  
Sbjct: 347 ITCSELYSILSSPTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSF 406

Query: 458 TELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVL 517
            EL  ++NNPL +  ++FDY+VY+SD++TFM  ++D+ FTFFYLL + +   LK VPT L
Sbjct: 407 EELVKRINNPLISEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNL 466

Query: 518 LGGYEKWKKVILEYGKQYNICVTDYLVRITEGE 550
           LGG+EKWKKV+  Y K+Y I +T ++ ++   E
Sbjct: 467 LGGFEKWKKVLKTYNKEYGIDITPFIKKLHATE 499

 Score =  177 bits (450), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 81/125 (64%), Positives = 101/125 (80%), Gaps = 1/125 (0%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHT 1097
            TIK+LNFI+MP+ L+IHLSRF+YD++KKN T+V YPLILNIVLK+ EV KY+LY +VNH 
Sbjct: 920  TIKSLNFIKMPKILVIHLSRFFYDMSKKNETVVAYPLILNIVLKNEEVCKYRLYAIVNHM 979

Query: 1098 GNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVL 1156
            GN + SGHYT++V+K  +H L  N   WYYFDDEVVK E  HG++  GV K+SSS VYVL
Sbjct: 980  GNQVASGHYTTLVNKNRNHDLGKNEQQWYYFDDEVVKHELNHGNIDEGVNKVSSSHVYVL 1039

Query: 1157 FYERI 1161
            FYE+I
Sbjct: 1040 FYEKI 1044

 Score =  156 bits (394), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 91/232 (39%), Positives = 136/232 (58%), Gaps = 5/232 (2%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S+EL +RV   Y ++I    PQLRL +LI++LEHT +L E YL  L + +  + L
Sbjct: 7   FTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDECL 66

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVL-E 132
            ++I GCFY+YL++P S QF  RN++  +Y++++ LY++Q NMTNVL +VK EV  +L E
Sbjct: 67  SAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSILDE 126

Query: 133 SQWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
           S  +   + + I R+RAYS P  A  V N+ K +  S  +             LQ   P 
Sbjct: 127 SILELEGIEKVIKRDRAYSSP--APKVNNISKFSKLSINDNHHNGETISTDNKLQSHFP- 183

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAE 244
             P +S+S        ++  + +   + +D ++P+W  P LEPNDQLKLA E
Sbjct: 184 QTPNYSNSNNSTGSFNNVKSNSNSSEEAED-TAPIWHIPSLEPNDQLKLALE 234

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  338 bits (866), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 154/252 (61%), Positives = 197/252 (78%), Gaps = 7/252 (2%)

Query: 670 HETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK 729
           H   +IPTIEQ+ N YV+LSITGLRN+GNTCYINSM+QCLFAT+ FR+LF+S KY+++  
Sbjct: 535 HAEGTIPTIEQSSNEYVALSITGLRNMGNTCYINSMLQCLFATRKFRDLFLSPKYEDYFS 594

Query: 730 EVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTT 789
           +    P        +S+ F ILFKKMY+NGGCSVVP  FLK+C+ LRPD KIP +QQDT 
Sbjct: 595 KRYSNPHQ------LSKYFNILFKKMYMNGGCSVVPTGFLKACNALRPDLKIPHNQQDTQ 648

Query: 790 EFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDD 849
           EFL+ +L +LHDELS  + V N+YP+L+L+D++ L V  KEY KWF+ ++  NG+SPID 
Sbjct: 649 EFLLFLLSQLHDELSESNHVANDYPNLLLHDDESLAVDQKEYDKWFESNISENGISPIDA 708

Query: 850 IFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEV 909
           IFQGQMEN L CQRCGHSS+NYS FYVLSLAIP A+ S+F + K++ LE+C+N++TSDE 
Sbjct: 709 IFQGQMENGLLCQRCGHSSYNYSMFYVLSLAIP-ASMSSFGQKKKMRLEDCINLFTSDEK 767

Query: 910 LSGENAWDCPNC 921
           L+ ENAWDCP C
Sbjct: 768 LTNENAWDCPKC 779

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 85/133 (63%), Positives = 105/133 (78%)

Query: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088
            ++WKSKKL TIKTLNF+ +P  L IHLSRF YDLT KN+ ++TYPL L+IVLK+NEVV Y
Sbjct: 838  EKWKSKKLSTIKTLNFVSLPSVLTIHLSRFLYDLTNKNNKVITYPLTLSIVLKNNEVVNY 897

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148
            +LY + NH GNLISGHYTS+V+K L H L +    WYYFDDEV KR+  HG++  G+  +
Sbjct: 898  RLYAIANHFGNLISGHYTSLVNKDLSHDLGNGRQKWYYFDDEVAKRDLNHGNIDAGITSV 957

Query: 1149 SSSDVYVLFYERI 1161
            SSSDVYVLFYE+I
Sbjct: 958  SSSDVYVLFYEKI 970

 Score =  156 bits (394), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 86/234 (36%), Positives = 129/234 (55%), Gaps = 43/234 (18%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           ++PE S+EL Q V +VYT DI    P+LRL++LIDLLEH E+L+E Y   L   QN + L
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
            +F+ GCFY+YL++P SIQFH+R++++ +Y+D+R  Y+ + NMTNVLLMV   ++ V   
Sbjct: 65  TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESVSRD 124

Query: 134 QWDSASLNERIPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPGN 193
           + +SA    +I R RAYSVP + ++   +  LTL   T +                    
Sbjct: 125 ELESA----KIMRKRAYSVPHK-KLSDKMQALTLSPETAS-------------------- 159

Query: 194 VPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHD 247
                               ++G    ++  S +W AP+LEPND LK+    H+
Sbjct: 160 ------------------STNAGPETDNENDSTMWTAPELEPNDHLKVNLGGHN 195

 Score =  125 bits (315), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 110/205 (53%), Gaps = 13/205 (6%)

Query: 351 DRSLTHRKNSYHSVYMLEESESSQGNLYYDESNAYIQSLERLQKQSIITAPELFSILSNE 410
           DR  THRK SYHSV+M             DE +++  +  RLQKQSIIT  +L  IL +E
Sbjct: 264 DRYNTHRKGSYHSVHMTG-----------DEYDSFTFNTARLQKQSIITCDKLLRILDSE 312

Query: 411 QQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNNPLFN 470
           + +++             T+ I+APN V++DP  LW+   G  +     LE    N    
Sbjct: 313 E-AERLLLVDLRFIKRFETNHIVAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALK 371

Query: 471 RRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKKVILE 530
              +F ++VY++DMKTFM+L+FDY   FF +L T+  + + C P VLLGGYE+WKK + +
Sbjct: 372 DLSQFKHIVYYTDMKTFMRLDFDYQLVFFQMLYTSNWR-ISCTPKVLLGGYEQWKKFLAK 430

Query: 531 YGKQYNICVTDYLVRITEGEDDTPA 555
             +        +L R+  G  +T A
Sbjct: 431 VPQSRVPIKEAFLFRLKPGGKETVA 455

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score =  309 bits (791), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 156/284 (54%), Positives = 204/284 (71%), Gaps = 9/284 (3%)

Query: 640 ILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNT 699
           +L+ +E +    +  K  +QE   + +    +T+ +P IE + N+   LSITGLRN  NT
Sbjct: 245 LLQFEEPSQDSSSILKSKEQEEEETVSASTSKTFKLPVIENSDNLLSELSITGLRNPCNT 304

Query: 700 CYINSMIQCLFATKSFRNLFISMKYKEFLK-EVAPKPGANGSQPVISRTFYILFKKMYLN 758
           CYINSM+QCLF+T  FR+LF++ KYK FL+ E  PK    G Q  +S + Y+LFKKMYLN
Sbjct: 305 CYINSMVQCLFSTTLFRDLFLTKKYKLFLENEKYPK----GLQ--LSHSIYVLFKKMYLN 358

Query: 759 GGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLIL 818
           GG +++P  FLK C  LRPD  IPDDQQDT EFLM+IL R+H+ELSN + V   Y DLIL
Sbjct: 359 GGRAIIPNGFLKVCKKLRPDLNIPDDQQDTQEFLMIILARIHEELSNNN-VTKYYSDLIL 417

Query: 819 YDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLS 878
            D   L V   +Y+KW +++V+ +GLSPID IFQGQMEN L CQRCG+SS++YSTFYVLS
Sbjct: 418 NDATALQVNPSKYQKWCEETVLSDGLSPIDHIFQGQMENILKCQRCGNSSYSYSTFYVLS 477

Query: 879 LAIPKATSSTF-SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           LAIPKA+  +F S+SK++ LE+C+N +TSDE LS +NAWDCP C
Sbjct: 478 LAIPKASLYSFTSKSKKIKLEDCINFFTSDEELSDDNAWDCPKC 521

 Score =  157 bits (398), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 74/124 (59%), Positives = 99/124 (79%), Gaps = 1/124 (0%)

Query: 1036 LFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYGVVN 1095
            L TIK+L+FI +P  L+IHLSRFYYDLTKKN+T++TYPLILNI+LK+N+VV+YKLY  VN
Sbjct: 588  LTTIKSLDFIVLPPILVIHLSRFYYDLTKKNNTVITYPLILNIILKNNKVVRYKLYATVN 647

Query: 1096 HTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR-HGDVKHGVMKISSSDVY 1154
            H+GNLI+GHYTS+V+K+  H +  N   W  FDD+V+K+  +   D + G  +ISS++VY
Sbjct: 648  HSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDVIKQHHKDRDDFETGRTEISSNEVY 707

Query: 1155 VLFY 1158
            VLFY
Sbjct: 708  VLFY 711

 Score = 88.2 bits (217), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 86/135 (63%), Gaps = 1/135 (0%)

Query: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79
           +++   V +VY  DI     QLRL++L  LLEH  +L+++Y+  L  +Q  +AL +FI G
Sbjct: 6   NQILSLVREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVG 65

Query: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQW-DSA 138
            FY+YLV+P S+QF TRN  ++ Y+ ++  Y+ +  M+ VL +VK+E  ++++    DS 
Sbjct: 66  GFYLYLVIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSK 125

Query: 139 SLNERIPRNRAYSVP 153
            ++  + R RAYS+P
Sbjct: 126 RISRSMKRKRAYSLP 140

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  303 bits (775), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 195/260 (75%), Gaps = 9/260 (3%)

Query: 664 SATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723
           +A++ + ET+  PTIE +  +   LSITGL+N  NTCYINS+IQCLF +  FR+LF++ K
Sbjct: 265 AASSFISETFEPPTIEDSKGLLSKLSITGLQNPCNTCYINSIIQCLFGSTPFRDLFLTKK 324

Query: 724 YKEFLK-EVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIP 782
           Y+ FLK E  PK      +  +SR+ Y LFKKMY NGG ++VP  FLK C  LRPD  IP
Sbjct: 325 YRLFLKTEEYPK------EVQLSRSIYSLFKKMYANGGSAIVPNGFLKMCKKLRPDLNIP 378

Query: 783 DDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGN 842
           DDQQDT EFL++IL R+H+ELSN++ V   Y DL+ YD   L V   +Y+KW++++++ +
Sbjct: 379 DDQQDTQEFLLIILARIHEELSNEN-VTKYYCDLVSYDTNALQVNPIKYQKWYEETILAD 437

Query: 843 GLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTF-SRSKRVSLEECL 901
           GLSPID IF+GQMEN L CQRCG+SSF+YSTFYVLSLAIPK +  +F S+SK++ LE+C+
Sbjct: 438 GLSPIDHIFRGQMENILKCQRCGNSSFSYSTFYVLSLAIPKNSVHSFTSKSKKIKLEDCI 497

Query: 902 NMYTSDEVLSGENAWDCPNC 921
           N++TSDE L+G+NAWDCP C
Sbjct: 498 NLFTSDEELTGDNAWDCPEC 517

 Score =  170 bits (431), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 106/133 (79%), Gaps = 1/133 (0%)

Query: 1030 QWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYK 1089
            +WKSK+L TIK+L+FI +P  L+IHLSRFYYDLTKKN+ ++TYPLILNI+LK+N+VV+YK
Sbjct: 570  KWKSKRLTTIKSLDFIFLPPILVIHLSRFYYDLTKKNNAVITYPLILNIILKNNKVVRYK 629

Query: 1090 LYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGD-VKHGVMKI 1148
            LYG VNH+GNLI+GHYTS+V+K+  H +  N   W  FDD+ + +  +  D  + G  K+
Sbjct: 630  LYGTVNHSGNLITGHYTSVVNKERSHEIGLNKQVWVTFDDDFIIQHHKDRDGFEAGKTKM 689

Query: 1149 SSSDVYVLFYERI 1161
            SSS+VYVLFYER+
Sbjct: 690  SSSEVYVLFYERM 702

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79
           D++   V  VY  DI     QLRL+ L  L++HT  L+++YL  L  ++ ++AL +FI G
Sbjct: 6   DQILNLVRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIG 65

Query: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEE-VQVVLESQWDSA 138
            +Y+YL++PQS+QF TR+  ++ Y+ ++  Y+ +  M+ VL +V++E   +V +   DS 
Sbjct: 66  GYYLYLIIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSN 125

Query: 139 SLNERIPRNRAYSVP 153
            +   I R RAYS+P
Sbjct: 126 RITVTITRKRAYSLP 140

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score =  302 bits (774), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 147/273 (53%), Positives = 201/273 (73%), Gaps = 10/273 (3%)

Query: 671 ETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK- 729
           + Y++P IE + ++   LSITGL+N  NTCYINS+IQCLF T  FR+LF++ KY+ FL  
Sbjct: 278 KAYNLPVIEDSNDLLSELSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLNT 337

Query: 730 EVAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTT 789
              PK      +  +SR+ Y+LFKKMYLNGG +++P  FLK C  LRPD  IPDDQQDT 
Sbjct: 338 NKYPK------EVQLSRSIYVLFKKMYLNGGRAIIPNRFLKMCKKLRPDLNIPDDQQDTQ 391

Query: 790 EFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDD 849
           EFL+++L R+H+ELSN++ VV  YPDL+ YD   L V   +Y+KW++++VI +GLSPID 
Sbjct: 392 EFLLIVLARIHEELSNEN-VVKYYPDLVSYDANALQVNPSKYEKWYERNVITDGLSPIDH 450

Query: 850 IFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTF-SRSKRVSLEECLNMYTSDE 908
           I++GQ+EN L CQRCG+SS++YSTFYVLSLAIPK +  +F S+S+++ LE+C+N++T DE
Sbjct: 451 IYRGQLENILKCQRCGNSSYSYSTFYVLSLAIPKLSLYSFTSKSRKIKLEDCINLFTGDE 510

Query: 909 VLSGENAWDCPNCCKITKDYKGMVEKTKRNKAA 941
            LSG+NAWDCPN C+IT       E T + K +
Sbjct: 511 ELSGDNAWDCPN-CRITDSKSKKEEITSQKKKS 542

 Score =  162 bits (410), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/134 (56%), Positives = 105/134 (78%), Gaps = 1/134 (0%)

Query: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088
            K+  SKKL TIK+L+FI +P  L+IHLSRFYYDLTKKNST++TYPLILNI+LK+ +V++Y
Sbjct: 574  KKRNSKKLTTIKSLDFIVLPPILVIHLSRFYYDLTKKNSTVITYPLILNIILKNGKVIRY 633

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR-HGDVKHGVMK 1147
            KLYG VNH+GNLI+GHYTS+V+K+  H +  N   W  FDD+ +++  +   + + G  +
Sbjct: 634  KLYGTVNHSGNLINGHYTSVVNKEKSHEIGLNRQVWVTFDDDYIQQHRKDRNNFEAGKTE 693

Query: 1148 ISSSDVYVLFYERI 1161
            +SS +VYVLFYER+
Sbjct: 694  MSSDEVYVLFYERM 707

 Score =  101 bits (252), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79
           D++   V KVY  DI     QLRL+ L  LL+H   L+ +YL  L  +Q M+AL +FI G
Sbjct: 6   DQILNLVRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIG 65

Query: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQW-DSA 138
           C+Y+YL++PQS+QF TRN  ++ Y+ ++  Y+ +  M  VL +V++E  V+++    +S 
Sbjct: 66  CYYLYLIIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESN 125

Query: 139 SLNERIPRNRAYSVP 153
            +   I R RAYS+P
Sbjct: 126 GICRTIKRKRAYSLP 140

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  310 bits (794), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/266 (57%), Positives = 198/266 (74%), Gaps = 9/266 (3%)

Query: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732
           +S+PTIE+NPN Y++LSITGLRN+ NTCYINSM+QCLF+T  FRNLF+S KY  +LK   
Sbjct: 728 FSVPTIEKNPNEYIALSITGLRNMSNTCYINSMLQCLFSTTEFRNLFLSNKYSRYLK--- 784

Query: 733 PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
                + +   +SR+FY+LFKKMY+NGGCSVVP  FLK CS L+PD +IP  QQDT EFL
Sbjct: 785 -----SSNMDNMSRSFYMLFKKMYMNGGCSVVPSGFLKMCSYLKPDLRIPHGQQDTQEFL 839

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
           + +LDRL DELS   AVVN+YP L+L++   L V +KEY  WFD++   NGLSPID IFQ
Sbjct: 840 LFLLDRLRDELSYLAAVVNDYPQLLLHESSVLKVNDKEYTTWFDQNFEKNGLSPIDSIFQ 899

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
           GQ+E+ L CQRC  SS++YSTFYVLSLA+P   S  F ++K++ LE+C+N +T DEVL+G
Sbjct: 900 GQIEHQLSCQRCDFSSYSYSTFYVLSLALPNPGSKAFGKAKKLRLEDCINFFTCDEVLTG 959

Query: 913 ENAWDCPNC-CKITKDYKGMVEKTKR 937
           +N WDCP C    + D +   EK+KR
Sbjct: 960 QNPWDCPKCGVNSSGDRQMNSEKSKR 985

 Score =  186 bits (472), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 86/129 (66%), Positives = 103/129 (79%)

Query: 1033 SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKYKLYG 1092
            +KKL TIK+LNFI +PR LIIHLSRF YDLTKKN+T+VTYPLILNIVLK+NEV KY+LY 
Sbjct: 1040 NKKLATIKSLNFITLPRILIIHLSRFVYDLTKKNNTVVTYPLILNIVLKNNEVAKYRLYS 1099

Query: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
             +NH G LISGHYTS+V+K L H +      WYYFDDE+VK +  HG+   G+  +SSSD
Sbjct: 1100 TINHFGTLISGHYTSLVNKDLQHEIREGKQKWYYFDDEIVKLDPNHGNYDRGITSVSSSD 1159

Query: 1153 VYVLFYERI 1161
            VY+LFYERI
Sbjct: 1160 VYLLFYERI 1168

 Score =  129 bits (324), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/234 (34%), Positives = 123/234 (52%), Gaps = 39/234 (16%)

Query: 11  ALPFTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNM 70
           ++P+ PE S EL   V + Y   +    P+LR ++L+DLLE    L+E Y   + + Q  
Sbjct: 2   SVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQTR 61

Query: 71  DALGSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVV 130
           + L +++ G FY+YL++PQSI+FHTRN ++++Y+D+R  YE + NMTNV+ MV E+V  V
Sbjct: 62  EGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDAV 121

Query: 131 LESQW--DSASLNERIPRNRAYSVPDE--ARVVQNLDKLTLQSPTETRGGRPRSQKKQLL 186
           L  Q   D    + ++ R RAYSVP++  AR   +L  LT+    + RGG          
Sbjct: 122 LLRQTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDG--KRRGGH--------- 170

Query: 187 QLPRPGNVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLK 240
                     H+    I E  +              Q+  LW AP+LE ND L+
Sbjct: 171 ----------HAIGGAIPEVAV--------------QADTLWSAPKLEENDLLR 200

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 93/178 (52%), Gaps = 9/178 (5%)

Query: 389 LERLQKQSIITAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNS 448
           L RL + S I   +L  IL ++ Q +               + I+A + ++IDP +LW++
Sbjct: 441 LTRLYETSSIKCSDLMIILESDIQDR-VLFIDLRPPKRYELNHIVARHLINIDPLLLWDT 499

Query: 449 NSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGK 508
              AP+  + E E +L+NPLF  R +F Y+V ++D  T M ++F +  TFF L+    GK
Sbjct: 500 ERSAPITSVNEFERRLDNPLFTTRGQFSYLVCYTDNHTSMNMDFKFELTFFELV--YMGK 557

Query: 509 PLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLVRIT-EGEDDTPARHDCQELPYR 565
           P + +   L GGY++W+  +    K  +  ++D++ R    G D + + H+    P+R
Sbjct: 558 P-RLLTKCLQGGYDQWRLYLKTNTKSIHAKISDFMWRANFLGRDTSVSDHN----PFR 610

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score =  299 bits (765), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 194/267 (72%), Gaps = 11/267 (4%)

Query: 675 IPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK-EVAP 733
           +PTIE + ++   LSITGL+N  NTCYINS+IQCLF T  FR+LF++ KY+ FL+ +  P
Sbjct: 287 LPTIEDSTSLLSQLSITGLQNPCNTCYINSIIQCLFGTTLFRDLFLTKKYRLFLQTDKYP 346

Query: 734 KPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLM 793
           +      +  +SR+ Y+LFKKMYLNGG ++ P  FLK C  LRPD  IPDDQQDT EFL+
Sbjct: 347 R------EVQLSRSIYVLFKKMYLNGGEAIAPNGFLKMCKKLRPDLNIPDDQQDTQEFLL 400

Query: 794 LILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQG 853
           +IL RLH+ELSN   V   YPDL+ YD     V   +Y+KW++ SV+ +GLSPID IF+G
Sbjct: 401 IILARLHEELSN-GTVTEYYPDLVSYDANAFQVNPSKYQKWYEGSVLTDGLSPIDYIFRG 459

Query: 854 QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTF-SRSKRVSLEECLNMYTSDEVLSG 912
           QMEN L CQRCG+SS +YSTFYVLSLAIPK +  +F S+SK++ LE+C+N++TSDE LSG
Sbjct: 460 QMENILKCQRCGNSSHSYSTFYVLSLAIPKISLYSFTSKSKKIKLEDCINLFTSDEELSG 519

Query: 913 ENAWDCPNCCKITKDYKGMVEKTKRNK 939
           +N+WDCPNC   T D K  + ++   K
Sbjct: 520 DNSWDCPNCG--TTDLKTKINESTSQK 544

 Score =  168 bits (426), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 106/133 (79%), Gaps = 1/133 (0%)

Query: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVKY 1088
            K+W S+KL T+K+ +FI +P  L+IHLSRFYYDLT+KN+T++TYPLILN++LK+N+VV+Y
Sbjct: 580  KKWNSRKLTTVKSSDFIVLPPILVIHLSRFYYDLTRKNNTVITYPLILNVILKNNKVVRY 639

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148
            KLYG VNH GNL++GHYTS V+K+ +H +  N   W  FDD+ +K+   H D + G  ++
Sbjct: 640  KLYGTVNHIGNLVNGHYTSDVNKEKNHEIGLNRQVWITFDDDYIKQH-HHDDFEAGKTEV 698

Query: 1149 SSSDVYVLFYERI 1161
            SSS+VYVLFYER+
Sbjct: 699  SSSEVYVLFYERM 711

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 84/135 (62%), Gaps = 1/135 (0%)

Query: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFING 79
           D++   V  VY  DI     QLRL+ L  LL+H   L+E+YL     +Q M+AL +FI G
Sbjct: 6   DQVINLVRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIG 65

Query: 80  CFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQW-DSA 138
            +Y+YLV+PQS+QF TRN  ++ Y+ ++  Y+ +  M+ VL +VKEE  ++++    DS 
Sbjct: 66  GYYLYLVIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSN 125

Query: 139 SLNERIPRNRAYSVP 153
            ++  I R RAYS+P
Sbjct: 126 RISRTITRKRAYSLP 140

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  298 bits (764), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 141/251 (56%), Positives = 188/251 (74%), Gaps = 13/251 (5%)

Query: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732
           Y +P +  + N+YV LSI+GLRNLGNTCYINSM+QCLFAT +FRNLF+S +YKE++    
Sbjct: 428 YGLPHLPHSSNLYVQLSISGLRNLGNTCYINSMLQCLFATTAFRNLFLSNRYKEYI---- 483

Query: 733 PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
                    P +S +F+ILF+KMYLNGGC+V+P+ FLK+C+ LRPD +IPD QQDT EFL
Sbjct: 484 ----GTKVDPHLSNSFHILFRKMYLNGGCAVIPVLFLKTCNFLRPDLRIPDVQQDTQEFL 539

Query: 793 MLILDRLHDEL-SNQDAVVNEYPDLILYDEKKLNVQN-KEYKKWFDKSVIGNGLSPIDDI 850
           +L+LD+LH+EL SNQD +V+E+PDLI YD   ++V+N  EYKKWF +S+   GLS I +I
Sbjct: 540 ILLLDQLHNELKSNQDRLVSEHPDLIEYDTDSMDVENANEYKKWFAESLENEGLSLIHEI 599

Query: 851 FQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVL 910
           FQGQ+ENSL CQRC ++S NYS F  LSL+IP          K V LE+C++++  +E+L
Sbjct: 600 FQGQLENSLECQRCNYTSTNYSNFCTLSLSIPNKRRKF---RKLVDLEDCISLFIENEML 656

Query: 911 SGENAWDCPNC 921
           +GENAW+CP C
Sbjct: 657 TGENAWNCPKC 667

 Score =  142 bits (358), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 94/133 (70%), Gaps = 1/133 (0%)

Query: 1030 QWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYD-LTKKNSTIVTYPLILNIVLKSNEVVKY 1088
            ++  KKL T K+ +FI++P  LIIHLSRF    L  KN+T + YP IL I LK+ E  ++
Sbjct: 712  KFSKKKLVTRKSTSFIKLPNLLIIHLSRFSMSGLLDKNNTDIAYPAILTITLKNKEKCRF 771

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148
            KLYGVVNH GNL +GHYTS+++K+  H LN     W+YFDDE VK++  + D+   V +I
Sbjct: 772  KLYGVVNHFGNLNNGHYTSLINKEPSHDLNPQRQKWFYFDDETVKQQFNYFDLDKNVNRI 831

Query: 1149 SSSDVYVLFYERI 1161
            SSSDVYVLFYE+I
Sbjct: 832  SSSDVYVLFYEKI 844

 Score = 97.8 bits (242), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 60/165 (36%), Positives = 88/165 (53%), Gaps = 11/165 (6%)

Query: 389 LERLQKQSIITAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNS 448
           L+ L ++  IT  ELFSILSN     +            N   I +PN +  DP  LWN+
Sbjct: 206 LKHLYEECFITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNN 265

Query: 449 NSGAPMYEITELESKLNNPLFNRRDEFDYVVYFSDMKTFMKL-NFDYHFTFFYLLNTARG 507
               P+   T L S   NPLF + D F Y++ +SD +T     +F+Y+F+FF LL ++  
Sbjct: 266 RDQTPVLHRTSLFS---NPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSS-- 320

Query: 508 KPLKCVPTVLLGGYEKWKKVILEYGKQYNICVTDYLV----RITE 548
             +K  P  LLGG+EKW+++I  Y +QY I  ++Y+     R TE
Sbjct: 321 -SMKVTPNFLLGGFEKWEQLISSYSEQYGIETSNYIFTNNKRFTE 364

 Score = 76.6 bits (187), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 7/117 (5%)

Query: 19  SDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDALGSFIN 78
           SDEL + VV +Y   I     QL   R IDLLE+TE L+E +L       N D+L SFI 
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQLFEYFLK-----GNTDSLDSFII 67

Query: 79  GCFYVYLVMPQSIQF--HTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
           G FY+ LV+P S      + N    +Y D++  YESQ N++++L +++ E + +L+S
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENILQS 124

 Score = 37.4 bits (85), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 18/21 (85%)

Query: 222 DQSSPLWRAPQLEPNDQLKLA 242
           D S+ +W+AP LEPNDQLKLA
Sbjct: 143 DSSTTIWQAPFLEPNDQLKLA 163

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score =  258 bits (660), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 137/275 (49%), Positives = 175/275 (63%), Gaps = 23/275 (8%)

Query: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFIS-MKYKEFLKEV 731
           +++P I+   NI   LS+ GLRN GNTCYINSM+QCLF TK  R+LFIS   YK+F+K+ 
Sbjct: 220 HTVPIIDATDNIPKMLSLVGLRNQGNTCYINSMVQCLFGTKVLRDLFISEXXYKDFIKKD 279

Query: 732 APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEF 791
           A        +  IS  F  L   MY NGG SV+P +FL+  SLLRPD  IP DQQDT EF
Sbjct: 280 A--------ETKISEPFARLLLTMYENGGTSVIPKNFLQQFSLLRPDLNIPKDQQDTQEF 331

Query: 792 LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIF 851
           L+++LD LHDEL   D +++       Y    +N+  KEY  W   ++  NG SPID IF
Sbjct: 332 LVILLDILHDELVYTDDLISNN-----YVSDDINL-GKEYMPWLQNNLKANGKSPIDLIF 385

Query: 852 QGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLS 911
           QGQ+EN L CQRCG++S+NYS FY+LSLAIPK      +   RV LE+C+N +TSDE+L+
Sbjct: 386 QGQIENCLQCQRCGNTSYNYSMFYMLSLAIPKIAKE--NSKNRVKLEDCINFFTSDEILT 443

Query: 912 GENAWDCPNCCKIT------KDYKGMVEKTKRNKA 940
           GENAW+CP CC  T       D    VE   +NK+
Sbjct: 444 GENAWNCPKCCPTTIETYDEADSPATVENRVKNKS 478

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 97/133 (72%), Gaps = 7/133 (5%)

Query: 1036 LFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSN-EVVKYKLYGVV 1094
            L T+K LNFI++P  L+IHLSRFYY+ TKKN+ ++TYPLILNI++K+N +VVKYKLYG++
Sbjct: 523  LITLKQLNFIKLPPILVIHLSRFYYNSTKKNNAVITYPLILNIIMKNNIDVVKYKLYGLI 582

Query: 1095 NHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVM------KI 1148
            NH G L  GHYTSIV+K L+HSL+ N   WY FDDEV+K+   +  +           + 
Sbjct: 583  NHQGGLTKGHYTSIVNKDLNHSLDLNEQQWYNFDDEVIKKLNSNNTINKKESFNIEKDEF 642

Query: 1149 SSSDVYVLFYERI 1161
             SS VYVLFYERI
Sbjct: 643  DSSKVYVLFYERI 655

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 83/135 (61%), Gaps = 3/135 (2%)

Query: 20  DELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELY-LSCLGKDQNMDALGSFIN 78
           D+L   V  ++  DI     +LRL+RL DLL+HT +L +L+ +    K +   A  +F+N
Sbjct: 28  DDLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVN 87

Query: 79  GCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLESQWDSA 138
           G FY++L++P  +QF T+N+  T Y D++  YE Q++M N+L  VKE+   +LE   D +
Sbjct: 88  GSFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILEQ--DLS 145

Query: 139 SLNERIPRNRAYSVP 153
            +N RI + RAY+ P
Sbjct: 146 GINRRILKKRAYTEP 160

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score =  243 bits (619), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 112/249 (44%), Positives = 164/249 (65%), Gaps = 6/249 (2%)

Query: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVA 732
           Y++P I         LS+ G+RN+GNTCY+NSM+QCLF +  FR+LF++ K++ F     
Sbjct: 195 YTLPIIINAITEEQKLSVFGIRNMGNTCYMNSMLQCLFGSTQFRDLFLTDKFEMF----- 249

Query: 733 PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
            K   N     I+    +LFKKMY NGGC+++P SF+++C  LRPDFKIP  QQDT EFL
Sbjct: 250 -KAETNSESLSIANDLSLLFKKMYQNGGCAIIPKSFMETCKRLRPDFKIPHCQQDTQEFL 308

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
           M +L+RL  EL+N  A V +   +      +   +NK Y +W+++ +  N LSPID +F+
Sbjct: 309 MFVLERLRVELANTSATVKDRSLIASRSNNRYLKKNKNYLRWYNEMISRNNLSPIDLLFR 368

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
           G +E+ L C+ C  S+  +S+FY+LSL IPK  SS F +SK + LE+C+N++T  E+L+G
Sbjct: 369 GDVESKLICKHCNESASTFSSFYILSLNIPKEKSSLFFKSKTIRLEDCINLFTRKEILTG 428

Query: 913 ENAWDCPNC 921
           EN+W CP+C
Sbjct: 429 ENSWACPSC 437

 Score =  115 bits (288), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 55/138 (39%), Positives = 88/138 (63%)

Query: 1024 MKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSN 1083
            ++ E +  + KK  TI +++F+ +P  L+IHLSRF YD++KKN++ ++YP+ L +    N
Sbjct: 494  LENEQRHRQQKKSETILSVSFVSLPPILVIHLSRFCYDISKKNTSNISYPMSLTVETLDN 553

Query: 1084 EVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKH 1143
              V Y+LYG +NH G+   GHYT++V+K+ +H  +     W  FDD++V   T     K 
Sbjct: 554  SSVTYRLYGTINHIGSPRGGHYTALVNKEKNHFTDLELQKWVEFDDDLVFNRTDFFKSKT 613

Query: 1144 GVMKISSSDVYVLFYERI 1161
             +  I+++D YVLFYERI
Sbjct: 614  EINSITNNDAYVLFYERI 631

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score =  190 bits (483), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/205 (49%), Positives = 136/205 (66%), Gaps = 4/205 (1%)

Query: 341 HDRSFKDFTP-DRSLTHRKNSYHSVYMLEESESSQGNLYY-DESNAYIQSLERLQKQSII 398
           HD+  +   P DRS THRK+SYHSVYM  ++++S G +   DE+N YIQ+LERLQKQ++I
Sbjct: 258 HDKKIQKIYPVDRSETHRKDSYHSVYM--DNDNSAGYVRKNDEANNYIQTLERLQKQNVI 315

Query: 399 TAPELFSILSNEQQSKQXXXXXXXXXXXXNTSKIIAPNTVHIDPKMLWNSNSGAPMYEIT 458
           T PELFSILS+                   ++ I+A NT++IDP +LW+  +  P+ E T
Sbjct: 316 TCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDT 375

Query: 459 ELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLL 518
           +LE  LN+ LFN R  F YVVY++D+KT+MK+NFDY+FT FYLL ++R   LK  PT LL
Sbjct: 376 KLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLL 435

Query: 519 GGYEKWKKVILEYGKQYNICVTDYL 543
           GG EKWKKVI  Y  +  I   +YL
Sbjct: 436 GGLEKWKKVIRTYYHENGINALNYL 460

 Score =  165 bits (417), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 133/236 (56%), Gaps = 30/236 (12%)

Query: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73
           FTPE S EL +RV  +Y +DI   LPQLRL +LIDLLEHT +L E +   L   +  DAL
Sbjct: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70

Query: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133
            ++I GC+Y+YL++PQS QF T+N+++++Y+D + LY+++ NMTNV  MV+ EV  +L+ 
Sbjct: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130

Query: 134 QWDSASLNER-IPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192
            +      +R IPR RA+SV D+     N  +  ++    +   RP S  K    LP   
Sbjct: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPM-- 188

Query: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDL 248
                                     +LDD S+PLW AP L PNDQLKLA E  +L
Sbjct: 189 --------------------------ELDD-STPLWTAPSLNPNDQLKLALEQPEL 217

>TBLA0F03610 Chr6 (890140..893574) [3435 bp, 1144 aa] {ON} Anc_8.188
           YDR069C
          Length = 1144

 Score =  120 bits (301), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 122/246 (49%), Gaps = 30/246 (12%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CY+N +IQCL        +F++  Y++ +  +  K G+ G   +++++F  L
Sbjct: 736 GLENMGNSCYLNCIIQCLLNNHELTKMFLNNSYEKHI-NINSKLGSKG---ILAKSFARL 791

Query: 752 FKKMYLNGGCS-----------VVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLH 800
              MY NG  S           V PI+F  +C  +   FK   +QQD  EF   +LD LH
Sbjct: 792 VHSMYQNGTLSIKNHSNKKNPPVQPITFKTACGSINSLFK-GSNQQDCQEFCQFLLDGLH 850

Query: 801 DELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMEN 857
           ++L NQ        +L    E+   KL+++     +W  +  +    S I D++QGQ  +
Sbjct: 851 EDL-NQCGANPPLKELSTEAERMREKLSLRIASSIEW--ERFLTTDFSVIIDLYQGQYAS 907

Query: 858 SLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWD 917
            L CQ CG +S  Y TF VLS+ +PK        +K + L +C N +T  E L  +  W 
Sbjct: 908 QLKCQVCGTTSTTYQTFSVLSVPVPK--------NKSIHLLDCFNEFTKTEFLGKDELWS 959

Query: 918 CPNCCK 923
           C  C K
Sbjct: 960 CTECKK 965

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 72/145 (49%), Gaps = 36/145 (24%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV-LKSNEV------- 1085
            KK  + KTL   R+P+ LIIHL RF  ++  KN+  V YPLIL++    +N+        
Sbjct: 965  KKQPSTKTLTITRLPKNLIIHLKRF-DNMLHKNNVFVKYPLILDLTNYWANDFDGKLPPG 1023

Query: 1086 -------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
                          KY+L GV  H G+L  GHYT+ V+K L        +GWYYFDD V 
Sbjct: 1024 VTEELPARGQIPPFKYELSGVALHMGSLYGGHYTAYVNKGLK-------NGWYYFDDTVY 1076

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLF 1157
            +       +K+    I + + YVLF
Sbjct: 1077 R------SIKYSSEMI-TQNAYVLF 1094

>YER144C Chr5 complement(457806..460223) [2418 bp, 805 aa] {ON}
           UBP5Putative ubiquitin-specific protease, closest
           paralog of Doa4p but has no functional overlap;
           concentrates at the bud neck
          Length = 805

 Score =  119 bits (298), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 118/245 (48%), Gaps = 27/245 (11%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL N+GN CY+N ++QCL  T     +F+   Y  F+   +    + GS+ ++++ F 
Sbjct: 445 IVGLENIGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDS----SRGSKGLLAKNFA 500

Query: 750 ILFKKMYLNGGCS--------VVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
           IL   M+ +G  +        V  I F K C  + P +     QQD  EF   +LD LH+
Sbjct: 501 ILVNNMHRHGAFTPPNVRTIPVQTIQFKKICGHINPMYS-DSMQQDCQEFCQFLLDGLHE 559

Query: 802 ELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENS 858
           +L NQ+        L   +E+   K++++     +W  +  +    S I D+FQGQ  + 
Sbjct: 560 DL-NQNGSKKHLKQLSDEEERMREKMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASR 616

Query: 859 LHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDC 918
           L CQ C H+S  Y TF VLS+ +P        R K  ++ +C   +T  E L  +  W C
Sbjct: 617 LQCQVCEHTSTTYQTFSVLSVPVP--------RVKTCNILDCFREFTKCERLGVDEQWSC 668

Query: 919 PNCCK 923
           P C K
Sbjct: 669 PKCLK 673

 Score = 69.3 bits (168), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 69/156 (44%), Gaps = 38/156 (24%)

Query: 1029 KQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV----- 1079
            +QW   K      + K L   R+P+ LII+L RF   + K N+  V YP  L++      
Sbjct: 664  EQWSCPKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYSLDLTPYWAR 722

Query: 1080 -LKSNEVV-------------KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWY 1125
                  +V             +Y+LYGV  H+G+L  GHYTS V K           GWY
Sbjct: 723  DFNHEAIVNEDIPTRGQVPPFRYRLYGVACHSGSLYGGHYTSYVYK-------GPKKGWY 775

Query: 1126 YFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            +FDD + +  T   +         +   YVLFYERI
Sbjct: 776  FFDDSLYRPITFSTE-------FITPSAYVLFYERI 804

>TDEL0B04220 Chr2 (747864..750341) [2478 bp, 825 aa] {ON} Anc_8.188
           YDR069C
          Length = 825

 Score =  117 bits (294), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/241 (31%), Positives = 116/241 (48%), Gaps = 24/241 (9%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CYIN ++QCL  T    N+F++  Y+  +   +      GS+ V+++ F  L
Sbjct: 464 GLENMGNSCYINCIVQCLLGTHELTNIFLNKSYERHINMNS----RLGSKGVLAKYFAKL 519

Query: 752 FKKMYLNG-------GCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS 804
              MY N        G  V P+ F  +C  +   F+    QQD  EF   +LD LH++L+
Sbjct: 520 THSMYQNASHKLNEKGKPVQPMEFKMACGTINSLFR-ESGQQDCQEFCQFLLDGLHEDLN 578

Query: 805 --NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
               +  + E  D      +KL+++     +W  +  +    S I D+FQGQ  + L CQ
Sbjct: 579 QCGGNPPLKELSDEAEKMREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLRCQ 636

Query: 863 RCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCC 922
            CG +S  Y  F VLS+ +P A        K  ++ +C   +T  E L  +  W CP C 
Sbjct: 637 VCGLTSTTYQPFSVLSVPVPHA--------KSCNIIDCFKEFTKVEKLETDEQWSCPRCK 688

Query: 923 K 923
           K
Sbjct: 689 K 689

 Score = 75.1 bits (183), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 80/175 (45%), Gaps = 41/175 (23%)

Query: 1012 VDAQRDIDELREMKEEMKQWKS----KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNS 1067
            +D  ++  ++ +++ + +QW      KK  + K L   R+PR LIIHL RF  ++  KN+
Sbjct: 664  IDCFKEFTKVEKLETD-EQWSCPRCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNN 721

Query: 1068 TIVTYPLILNIV---------------------LKSNEVVKYKLYGVVNHTGNLISGHYT 1106
              V YP  L++                         +    YKLYG+ +H G+L  GHYT
Sbjct: 722  VFVKYPFTLDLTPYWANDFDGRLPPGVTEELPTRGQSPPFNYKLYGIASHVGSLYGGHYT 781

Query: 1107 SIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            S VDK           GW YFDD      T    V++    I + + YVLFY R+
Sbjct: 782  SYVDK-------GPKRGWCYFDD------TSFRPVRNATECI-TPNAYVLFYHRV 822

>Smik_4.307 Chr4 complement(551719..554508) [2790 bp, 929 aa] {ON}
           YDR069C (REAL)
          Length = 929

 Score =  117 bits (292), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 117/237 (49%), Gaps = 19/237 (8%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+N +IQC+  T     +F+   Y + +  +  K G+ G   ++++ F  L
Sbjct: 566 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKG---ILAKYFARL 621

Query: 752 FKKMYL-----NGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN- 805
              MY      +   S+ PI F  +C  +   FK    QQD  EF   +LD LH++L+  
Sbjct: 622 VHMMYKEQVDSSKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQC 680

Query: 806 -QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRC 864
             +  + E         +KL+++     +W  +  +    S I D+FQGQ  + L C+ C
Sbjct: 681 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLRCKVC 738

Query: 865 GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
            H+S  Y  F VLS+ IPK  S       ++++E+C   +T  E L  E  W CP+C
Sbjct: 739 NHTSTTYQPFTVLSIPIPKKNSQN-----KITIEDCFKEFTKCENLEVEEQWLCPHC 790

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 70/146 (47%), Gaps = 37/146 (25%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV--------------LKSN 1083
            + K L   R+PR LI+HL RF  +   KN+  V YP +L++               +  +
Sbjct: 796  STKQLTVTRLPRNLIVHLKRFD-NFLNKNNDFVRYPFLLDLTPFWANDFDGVFPPGVNDD 854

Query: 1084 EV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRE 1135
            E+         KY+LYGV  H G L  GHYT+ V K L         GW YFDD      
Sbjct: 855  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDD------ 901

Query: 1136 TRHGDVKHGVMKISSSDVYVLFYERI 1161
            T++  VK+    I +S+ YVLFY R+
Sbjct: 902  TKYKPVKNQTDAI-NSNAYVLFYHRV 926

>TPHA0C02770 Chr3 (604690..607602) [2913 bp, 970 aa] {ON} Anc_8.188
           YDR069C
          Length = 970

 Score =  116 bits (291), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 120/243 (49%), Gaps = 27/243 (11%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CY+N +IQCL ++  F  +F++  Y++ +  +  K G+ G   V++R F  L
Sbjct: 609 GLENMGNSCYLNCIIQCLLSSHEFTRIFLNNSYEKHI-NLKSKLGSKG---VLARNFARL 664

Query: 752 FKKMYLNGG--------CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
              MY  G           V P  F  +C  +   F+  D QQD+ EF   +LD LH++L
Sbjct: 665 INTMYTEGSEQSKNDRNGPVKPAQFKLACGSINSIFR-SDLQQDSQEFCQFLLDGLHEDL 723

Query: 804 SNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLH 860
            NQ        +L    EK   KL+++     +W  +  +    S I D FQGQ  + L 
Sbjct: 724 -NQCGANPPLKELSPNAEKMREKLSLRIASSIEW--ERYLTTDFSVIVDQFQGQYASQLR 780

Query: 861 CQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPN 920
           C+ CG +S  Y  F VLS+ +P        R K  ++ +C N +T  E L  +  W CP+
Sbjct: 781 CKVCGGTSTTYQAFSVLSVPVP--------RGKSCNIIDCFNEFTKVENLETDELWACPH 832

Query: 921 CCK 923
           C K
Sbjct: 833 CKK 835

 Score = 67.8 bits (164), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 37/149 (24%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV-LKSNEV------- 1085
            KK  + K L   R+PR LIIHL RF  ++  KN+  V YP +L++    +N+        
Sbjct: 835  KKQPSTKKLTITRLPRNLIIHLKRF-DNMLNKNNIFVKYPFLLDLTPYWANDFDGRLPPG 893

Query: 1086 -------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
                           YKL  V  H G+L  GHYTS VDK           GW YFDD   
Sbjct: 894  VTEELPTRGQIPPFNYKLNAVAAHFGSLYGGHYTSYVDK--------GKFGWRYFDD--- 942

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
               T+   +K+    I +S+ YVLFY R+
Sbjct: 943  ---TKIRPLKNSYECI-TSNAYVLFYHRV 967

>Kpol_1032.28 s1032 complement(57514..60162) [2649 bp, 882 aa] {ON}
           complement(57514..60162) [2649 nt, 883 aa]
          Length = 882

 Score =  115 bits (289), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 120/243 (49%), Gaps = 27/243 (11%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CY+N +IQCL +T     +F++  Y++ +  +  K G+ G   V+++ F  L
Sbjct: 520 GLENMGNSCYMNCIIQCLLSTHELSQIFLNNSYEKHI-NLNSKLGSKG---VLAKYFARL 575

Query: 752 FKKMYLNGGCS--------VVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
              MY  G           + PI F  +C  +   FK  + QQD+ EF   +LD LH++L
Sbjct: 576 VHTMYREGSFKRPLEKNKPIQPIQFKMACGSINSLFK-DNTQQDSQEFCQFLLDGLHEDL 634

Query: 804 SNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLH 860
            NQ        +L    EK   KL+++     +W  +  +    S I D+FQGQ  + L 
Sbjct: 635 -NQCGANPPLKELSEDAEKMREKLSMRIASSIEW--ERFLTTDFSVIVDLFQGQYASQLK 691

Query: 861 CQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPN 920
           C+ CG +S  Y TF VLS+ +P  +S          + +C N +T  E L  +  W CP 
Sbjct: 692 CKVCGCTSTTYQTFSVLSVPVPHVSS--------CHILDCFNEFTKVEKLGTDELWSCPT 743

Query: 921 CCK 923
           C K
Sbjct: 744 CKK 746

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 73/149 (48%), Gaps = 36/149 (24%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV-------------- 1079
            KK  + K L   R+PR LIIHL RF  ++  KN+  V YP +L++               
Sbjct: 746  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNVFVKYPFLLDLTPYWANDFDGRLPPG 804

Query: 1080 ----LKSNEVV---KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
                L +   V   +YKL  V +H G+L  GHYT+ V+K ++        GW+YFDD   
Sbjct: 805  VTDELPTRGQVPPFRYKLNAVASHVGSLYGGHYTAYVNKGINR-------GWHYFDD--- 854

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
               T +  +K+    I + + YVLFY R+
Sbjct: 855  ---TSYRPIKNETECI-TPNAYVLFYHRV 879

>YDR069C Chr4 complement(584939..587719) [2781 bp, 926 aa] {ON}
           DOA4Ubiquitin isopeptidase, required for recycling
           ubiquitin from proteasome-bound ubiquitinated
           intermediates, acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 926

 Score =  115 bits (288), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 130/267 (48%), Gaps = 22/267 (8%)

Query: 664 SATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723
           S  + L  T   PT   N ++  ++   GL NLGN+CY+N +IQC+  T     +F+   
Sbjct: 538 SNNDSLDHTDVTPTSSHNYDLDFAV---GLENLGNSCYMNCIIQCILGTHELTQIFLDDS 594

Query: 724 YKEFLKEVAPKPGANGSQPVISRTFYILFKKMY---LNGG--CSVVPISFLKSCSLLRPD 778
           Y + +  +  K G+ G   ++++ F  L   MY   ++G    S+ PI F  +C  +   
Sbjct: 595 YAKHI-NINSKLGSKG---ILAKYFARLVHMMYKEQVDGSKKISISPIKFKLACGSVNSL 650

Query: 779 FKIPDDQQDTTEFLMLILDRLHDELSN--QDAVVNEYPDLILYDEKKLNVQNKEYKKWFD 836
           FK    QQD  EF   +LD LH++L+    +  + E         +KL+++     +W  
Sbjct: 651 FKTAS-QQDCQEFCQFLLDGLHEDLNQCGSNPPLKELSQEAEARREKLSLRIASSIEW-- 707

Query: 837 KSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVS 896
           +  +    S I D+FQGQ  + L C+ C H+S  Y  F VLS+ IPK  S        ++
Sbjct: 708 ERFLTTDFSVIVDLFQGQYASRLKCKVCSHTSTTYQPFTVLSIPIPKKNSRN-----NIT 762

Query: 897 LEECLNMYTSDEVLSGENAWDCPNCCK 923
           +E+C   +T  E L  +  W CP+C K
Sbjct: 763 IEDCFREFTKCENLEVDEQWLCPHCEK 789

 Score = 75.1 bits (183), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 71/146 (48%), Gaps = 37/146 (25%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV--------------LKSN 1083
            + K L   R+PR LI+HL RF  +L  KN+  V YP +L++               +  +
Sbjct: 793  STKQLTITRLPRNLIVHLKRFD-NLLNKNNDFVIYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 1084 EV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRE 1135
            E+         KY+LYGV  H G L  GHYT+ V K L         GW YFDD      
Sbjct: 852  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------KKGWLYFDD------ 898

Query: 1136 TRHGDVKHGVMKISSSDVYVLFYERI 1161
            T++  VK+    I +S+ YVLFY R+
Sbjct: 899  TKYKPVKNKADAI-NSNAYVLFYHRV 923

>Skud_4.323 Chr4 complement(560596..563376) [2781 bp, 926 aa] {ON}
           YDR069C (REAL)
          Length = 926

 Score =  115 bits (287), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 117/239 (48%), Gaps = 19/239 (7%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+N +IQC+  T     +F+   Y + +  +  K G+ G   ++++ F  L
Sbjct: 563 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKG---ILAKYFARL 618

Query: 752 FKKMY-----LNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN- 805
              MY      +   S+ PI F  +C  +   FK    QQD  EF   +LD LH++L+  
Sbjct: 619 VHMMYKEQVDASKKISISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQC 677

Query: 806 -QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRC 864
             +  + E         +KL+++     +W  +  +    S I D+FQGQ  + L C+ C
Sbjct: 678 GSNPPLKELSQEAEARREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKIC 735

Query: 865 GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCK 923
           GH+S  Y  F VLS+ IP+           +++E+C   +T  E L  +  W CP+C K
Sbjct: 736 GHTSTTYQPFTVLSIPIPRKVPQN-----EITIEDCFKEFTKCENLEVDEQWLCPHCKK 789

 Score = 75.1 bits (183), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/146 (35%), Positives = 68/146 (46%), Gaps = 37/146 (25%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV--------------LKSN 1083
            + K L   R+PR LIIHL RF  +L  KN+  V YP +L++               +  +
Sbjct: 793  STKQLTVTRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 851

Query: 1084 EV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRE 1135
            E+         KY+LYGV  H G L  GHYT+ V K L         GW YFDD   K  
Sbjct: 852  ELPVRGQIPPFKYELYGVACHFGTLYGGHYTAYVKKGL-------RKGWLYFDDTKFKPV 904

Query: 1136 TRHGDVKHGVMKISSSDVYVLFYERI 1161
                DV       ++S+ YVLFY R+
Sbjct: 905  KNKTDV-------TNSNAYVLFYHRV 923

>KAFR0C02590 Chr3 complement(503330..506266) [2937 bp, 978 aa] {ON}
           Anc_8.188 YDR069C
          Length = 978

 Score =  113 bits (283), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 125/249 (50%), Gaps = 26/249 (10%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL N+GN+CY+N +IQC+  T     +F++  Y++ +  ++ + G+ G   V+++ F 
Sbjct: 604 IVGLENMGNSCYMNCIIQCILGTHDLIKIFLNNSYEKHI-NLSSRLGSKG---VLAKNFA 659

Query: 750 ILFKKMYLNGGCSVV------------PISFLKSCSLLRPDFKIPDDQQDTTEFLMLILD 797
            L   MY++   S +            P  F  +C  +   F+    QQD+ EF   +LD
Sbjct: 660 RLIHTMYMHAVPSTINKHTEKKIVPVKPYQFKLACGSINSLFR-DSQQQDSQEFCQFLLD 718

Query: 798 RLHDELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQ 854
            LH++L NQ        +L L  E+    L+++     +W  +  +    S I D+FQGQ
Sbjct: 719 GLHEDL-NQCGGNPPLKELSLEAERLRENLSLRIASSIEW--ERYLTTDFSVIVDLFQGQ 775

Query: 855 MENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGEN 914
             + L C+ C H+S  Y +F VLS+ +PK       +++++ L +C N +T  E L  + 
Sbjct: 776 YASRLECKVCHHTSTTYQSFSVLSVPLPKKFD---PQTRKIDLIDCFNEFTKIENLEVDE 832

Query: 915 AWDCPNCCK 923
            W CP C K
Sbjct: 833 QWSCPTCKK 841

 Score = 82.8 bits (203), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 79/158 (50%), Gaps = 40/158 (25%)

Query: 1029 KQWKS----KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVL---- 1080
            +QW      KK  + K L   R+PR LIIHL RF  ++  KN++ + YP  L++      
Sbjct: 832  EQWSCPTCKKKQPSTKKLTITRLPRNLIIHLKRFD-NMLNKNNSFIDYPFNLDLTEFWAD 890

Query: 1081 ---------KSNEV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDG 1123
                      SNE+          Y+LYGV  H G+L  GHYT+ VDK +       G+G
Sbjct: 891  DFDGNLPPGVSNELPARGQIKPFNYRLYGVACHFGSLYGGHYTAYVDKGI-------GNG 943

Query: 1124 WYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            WYYFDD      T +  +K+    ISSS  YVLFY R+
Sbjct: 944  WYYFDD------TTYRPLKNDKEPISSS-AYVLFYTRV 974

>Suva_2.228 Chr2 complement(385322..388105) [2784 bp, 927 aa] {ON}
           YDR069C (REAL)
          Length = 927

 Score =  113 bits (282), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 118/239 (49%), Gaps = 19/239 (7%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+N +IQC+  T     +F+   Y + +  +  K G+ G   ++++ F  L
Sbjct: 564 GLENLGNSCYMNCIIQCILGTHELTQIFLDDSYAKHI-NINSKLGSKG---ILAKYFARL 619

Query: 752 FKKMYL-----NGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN- 805
              MY      +   S+ PI F  +C  +   FK    QQD  EF   +LD LH++L+  
Sbjct: 620 VHMMYKKQVDSSKKDSISPIKFKLACGSVNSLFKTAS-QQDCQEFCQFLLDGLHEDLNQC 678

Query: 806 -QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRC 864
             +  + E         ++L+++     +W  +  +    S I D+FQGQ  + L C+ C
Sbjct: 679 GSNPPLKELSQEAETRRERLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLKCKTC 736

Query: 865 GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCK 923
            H+S  Y  F VLS+ IPK  S       ++++E+C   +T  E L  +  W CP+C K
Sbjct: 737 NHTSTTYQPFTVLSIPIPKKNSQN-----KITIEDCFKEFTKCENLEIDEQWLCPHCEK 790

 Score = 74.3 bits (181), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 53/146 (36%), Positives = 70/146 (47%), Gaps = 37/146 (25%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV--------------LKSN 1083
            + K L   R+PR LIIHL RF  +L  KN+  V YP +L++               +  +
Sbjct: 794  STKQLTITRLPRNLIIHLKRFD-NLLNKNNDFVKYPFLLDLTPFWANDFDGVFPPGVNDD 852

Query: 1084 EV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRE 1135
            E+         KY+LYGV  H G L  GHYTS V K L         GW YFDD      
Sbjct: 853  ELPIRGQIPPFKYELYGVACHFGTLYGGHYTSYVKKGLSR-------GWLYFDD------ 899

Query: 1136 TRHGDVKHGVMKISSSDVYVLFYERI 1161
            T++   K+    I +S+ YVLFY R+
Sbjct: 900  TKYRPAKNQTDAI-NSNAYVLFYHRV 924

>KNAG0D01930 Chr4 (324705..327665) [2961 bp, 986 aa] {ON} Anc_8.188
           YDR069C
          Length = 986

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 117/243 (48%), Gaps = 25/243 (10%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           + GL N+GN+CY+N +IQCL        +F+   +++++  +  K G+ G   V++R F 
Sbjct: 619 MVGLENMGNSCYLNCIIQCLLGNNELIKIFLDNSFEKYV-NLNSKLGSKG---VLARYFS 674

Query: 750 ILFKKMYLN------GG--CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
            L   MY N      GG    V P  F  +C  +   FK    QQD  EF   +LD LH+
Sbjct: 675 RLIHTMYNNARTIKHGGKHAPVKPAQFKMACGSVNSAFK-GGSQQDCQEFCQFLLDGLHE 733

Query: 802 ELSNQDAVVNEYPDLILYDE---KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENS 858
           +L NQ        +L    E   +KL+++     +W  +  +    S I D+FQGQ  + 
Sbjct: 734 DL-NQCGGNKRLAELTEEAENLREKLSLRIASSIEW--ERFLTTDFSVIGDLFQGQYASR 790

Query: 859 LHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDC 918
           L C+ CG +S  Y  F VLS+ +P    S      + S+ +C + +T  E L  +  W C
Sbjct: 791 LQCKTCGKTSTTYQPFSVLSIPVPSKHIS------KCSIIDCFDEFTKVENLEVDEQWSC 844

Query: 919 PNC 921
           P C
Sbjct: 845 PRC 847

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/158 (38%), Positives = 80/158 (50%), Gaps = 41/158 (25%)

Query: 1029 KQW-----KSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV---- 1079
            +QW     KSK+  T K L   R+PR LIIHL RF   L K N+ +V YP  L++     
Sbjct: 840  EQWSCPRCKSKQPST-KKLTITRLPRNLIIHLKRFDNRLNK-NNILVQYPFTLDLTTFWA 897

Query: 1080 --------LKSNEV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDG 1123
                    L  +E+          YKLYGV  H G+L  GHYT+ VDK +        +G
Sbjct: 898  NDFDGKLPLNVSELPTRGQKPPFNYKLYGVACHFGSLYGGHYTAYVDKGIK-------NG 950

Query: 1124 WYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            WYYFDD   +       +K+ +  I+SS  YVLFY+RI
Sbjct: 951  WYYFDDTSCR------PIKNSMEPITSS-AYVLFYKRI 981

 Score = 32.7 bits (73), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 46/103 (44%), Gaps = 4/103 (3%)

Query: 428 NTSKIIAPNTVHIDPKMLWNSNSGAPMYEITELESKLNN-PLFNRRDEFDYVVYFS---D 483
           N      PN + I+P    +S S   + + + + S  +   LF+RR EF ++V +S   D
Sbjct: 206 NKGHFKVPNIICIEPVSFKSSYSDHDLEKKSMITSTNDEIVLFHRRQEFAFIVLYSNDTD 265

Query: 484 MKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLLGGYEKWKK 526
            K+ +            LLN +  KPL     VL  G++ W K
Sbjct: 266 KKSGIVYKERKTLLANLLLNHSFEKPLSNRLYVLENGFDSWTK 308

>Smik_5.309 Chr5 complement(462971..465388) [2418 bp, 805 aa] {ON}
           YER144C (REAL)
          Length = 805

 Score =  110 bits (275), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 113/245 (46%), Gaps = 27/245 (11%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL N GN CY+N ++QCL  T     +F+   Y  F+   + K    GS+ ++++ F 
Sbjct: 445 IVGLENTGNCCYMNCILQCLVGTHDLVRMFLDNTYLNFINFDSSK----GSKGLLAKNFA 500

Query: 750 ILFKKMYLNGG--------CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
            L + M+ N            V  I F K C  +   +     QQD  EF   +LD LH+
Sbjct: 501 TLVRNMHRNSAFMPVNSRTTPVQTIQFKKICGHINSIYS-DSMQQDCQEFCQFLLDGLHE 559

Query: 802 ELSNQDAVVNEYPDLILYDEKK---LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENS 858
           +L NQ+        L   +E+K   + ++     +W  +  +    S I D+FQGQ  + 
Sbjct: 560 DL-NQNGGKEHLKQLTEEEEQKREKMTIRKASALEW--ERFLLTDFSAIIDLFQGQYASR 616

Query: 859 LHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDC 918
           L CQ C  +S  Y TF VLS+ +P+ T+         ++ +C   +T  E L  +  W C
Sbjct: 617 LQCQACDRTSTTYQTFSVLSVPVPRITT--------CNILDCFREFTKCEKLGIDELWSC 668

Query: 919 PNCCK 923
           P C K
Sbjct: 669 PRCLK 673

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 74/163 (45%), Gaps = 39/163 (23%)

Query: 1018 IDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILN 1077
            IDEL      +K+  S K      L   R+P+ LII+L RF   + K N+  V YP  L+
Sbjct: 662  IDELWSCPRCLKKQPSTK-----QLKITRLPKKLIINLKRFDNQMNK-NNVFVQYPYFLD 715

Query: 1078 IV------LKSNEVV-------------KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLN 1118
            +            +V             +Y+LYGV  H+G+L  GHYTS V K       
Sbjct: 716  LTPYWARDFNHEAIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK------- 768

Query: 1119 SNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
                GWY+FDD +  R  R  D      +  + + YVLFYERI
Sbjct: 769  GPKKGWYFFDDSIY-RPIRFND------EFITPNAYVLFYERI 804

>KLLA0E10275g Chr5 (906675..909065) [2391 bp, 796 aa] {ON} similar
           to uniprot|P39944 Saccharomyces cerevisiae YER144C UBP5
           Putative ubiquitin-specific protease that does not
           associate with the proteasome
          Length = 796

 Score =  108 bits (270), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 121/255 (47%), Gaps = 31/255 (12%)

Query: 681 NPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGS 740
           +P+I +  +I GL NLGN+CY+N +IQCL        +F++  Y++ +  V  + G+ G 
Sbjct: 423 HPSINLDFAI-GLVNLGNSCYLNCIIQCLLGCHELSYIFLTNSYRKHVN-VNSRLGSKG- 479

Query: 741 QPVISRTFYILFKKMYLNG-----------GCSVVPISFLKSCSLLRPDFKIPDDQQDTT 789
             +++  F  L +KMY  G             +V P  F  +C  +   FK    QQD  
Sbjct: 480 --LLANYFSQLVQKMYQQGKLQAYNNTNMESTAVHPTQFKLACGSINSLFK-GKQQQDCQ 536

Query: 790 EFLMLILDRLHDELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSP 846
           EF   +LD LH++L NQ        +L    EK    + ++     +W  +  +    S 
Sbjct: 537 EFCQFLLDGLHEDL-NQCGTNPPLKELSPEAEKMRETMPMRIASAIEW--ERYLTTDFSV 593

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I D+FQGQ  + L C+ C H+S  Y  F VLS+ +P+A S T        + +C   +T 
Sbjct: 594 IVDLFQGQYASQLRCKICAHTSTTYQAFSVLSVPVPRARSCT--------IYDCFKEFTK 645

Query: 907 DEVLSGENAWDCPNC 921
            E L  +  W CP C
Sbjct: 646 LETLEKDELWYCPYC 660

 Score = 62.4 bits (150), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 66/145 (45%), Gaps = 37/145 (25%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI-----------VLKSNEV- 1085
            + K +   R+P  LIIHL RF  ++  KN+  V YP  L++           + K N V 
Sbjct: 666  STKQIIITRLPNNLIIHLKRFD-NMMNKNNVFVNYPNELDLTGFWIDDYNGEMPKDNGVS 724

Query: 1086 ---------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRET 1136
                       Y+L+ V +H+G L  GHYTS VDK           GW  FDD V  R+ 
Sbjct: 725  LPLRGQKPPFNYRLFAVASHSGTLYGGHYTSFVDK--------GRVGWCSFDD-VSWRKI 775

Query: 1137 RHGDVKHGVMKISSSDVYVLFYERI 1161
            R  D      +  + + YVLFY R+
Sbjct: 776  RRKD------EYITPNAYVLFYRRV 794

>NDAI0A03680 Chr1 (837931..841281) [3351 bp, 1116 aa] {ON} 
          Length = 1116

 Score =  108 bits (271), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 77/249 (30%), Positives = 119/249 (47%), Gaps = 33/249 (13%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL+N+GN+CY+N +IQCL  T     +F++  ++ ++  +  K G+ G   V+++   
Sbjct: 746 IIGLQNMGNSCYLNCIIQCLLGTHELTKIFLNYSFERYI-NLNSKLGSKG---VLAKNLS 801

Query: 750 ILFKKMY--------------LNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLI 795
            L   MY               +G   + PI F  +C  +   FK    QQD  EF   +
Sbjct: 802 KLIHLMYNHSTLKNNGDKTKKKSGNNFIKPIQFRMACGSINNLFK-NCSQQDCQEFCQFL 860

Query: 796 LDRLHDELSNQDAVVNEYPDLILYDE---KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
           LD LH++L NQ        +L    E   +KL+++     +W  +  +    S I D+FQ
Sbjct: 861 LDALHEDL-NQCGSNPPLKELSTKAESMREKLSLRIASSIEW--ERYLTTDFSVIVDLFQ 917

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
           GQ  + L C+ C H+S  Y  F VLS+ IPK         K ++L +C   +T  E L  
Sbjct: 918 GQYASRLQCKTCIHTSTTYQPFSVLSVPIPKK--------KNLNLLDCFKDFTKIENLEV 969

Query: 913 ENAWDCPNC 921
           +  W CPNC
Sbjct: 970 DEQWFCPNC 978

 Score = 72.4 bits (176), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 89/176 (50%), Gaps = 43/176 (24%)

Query: 1012 VDAQRDIDELREMKEEMKQW-----KSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKN 1066
            +D  +D  ++  ++ + +QW     KSK+  T K L   R+PR LIIHL RF  +L K N
Sbjct: 955  LDCFKDFTKIENLEVD-EQWFCPNCKSKQPST-KKLTITRLPRNLIIHLKRFDNNLNKNN 1012

Query: 1067 STIVTYPLILNI-------------------VLKSNEV--VKYKLYGVVNHTGNLISGHY 1105
            + I  YP IL++                   + K  ++   KY+LYG   H G+L  GHY
Sbjct: 1013 NLI-DYPFILDLTQFWADDFDGELPPGVTDELPKRGQIPPFKYRLYGAALHFGSLYGGHY 1071

Query: 1106 TSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            T+ V+K +        +GWYYFDD      T +  +K+    I SS+ YVLFY RI
Sbjct: 1072 TAFVNKGI-------RNGWYYFDD------TNYRPIKNEREPI-SSNAYVLFYHRI 1113

>KLTH0H07678g Chr8 (677217..679802) [2586 bp, 861 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 861

 Score =  108 bits (269), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 125/283 (44%), Gaps = 34/283 (12%)

Query: 670 HETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK 729
           ++  S P   +N N  V     GL NLGN+CY+N +IQCL  T     +F+   YK  + 
Sbjct: 479 YQNGSKPLTRRNTNFTV-----GLTNLGNSCYMNCIIQCLLGTHELTQIFLDDSYKNHV- 532

Query: 730 EVAPKPGANGSQPVISRTFYILFKKMYLNGG-----------CSVVPISFLKSCSLLRPD 778
            +  K G+ G   V+++ F  L   M                 +V P+ F  +C  +   
Sbjct: 533 NLNSKLGSKG---VLAKYFSQLIHTMQQQAASASTKQNSGDKTAVQPLHFKVACGSINSL 589

Query: 779 FKIPDDQQDTTEFLMLILDRLHDELS--NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFD 836
           F+    QQD  EF   +LD LH++L+    +  + E  +      +KL ++     +W  
Sbjct: 590 FR-SSSQQDCQEFCQFLLDGLHEDLNQCGGNPALKELSEEAEGIREKLCMRIASSIEW-- 646

Query: 837 KSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVS 896
           +  +    S I D+FQGQ  + L C+ CG +S  Y  F VLS+ +P  +        +  
Sbjct: 647 ERYLTTDFSVIVDLFQGQYASQLTCKVCGRTSTTYQPFSVLSVPVPSGS--------KCD 698

Query: 897 LEECLNMYTSDEVLSGENAWDCPNC-CKITKDYKGMVEKTKRN 938
           + +C   +T  E L  +  W CP C CK     K  + +  RN
Sbjct: 699 IIDCFKEFTKVETLEKDEQWSCPRCKCKQPSTKKITITRLPRN 741

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 72/162 (44%), Gaps = 39/162 (24%)

Query: 1023 EMKEEMKQWKSK----KLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
            E  E+ +QW       K  + K +   R+PR L+IHL RF  +L  KN+  V+YP  L++
Sbjct: 710  ETLEKDEQWSCPRCKCKQPSTKKITITRLPRNLVIHLKRFD-NLLHKNNIFVSYPHTLDL 768

Query: 1079 V-LKSNEV-------------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLN 1118
                +N+                      Y LY V  H G L  GHYTS VDK       
Sbjct: 769  TPFWANDFDGRLPPGVAELPTRGQVPPFNYNLYAVACHFGTLYGGHYTSYVDK------- 821

Query: 1119 SNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYER 1160
             +  GW YFDD   ++    G+     + +S+   YVLFY R
Sbjct: 822  GDKAGWCYFDDTSWRKAKSQGE----CITLSA---YVLFYHR 856

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score =  107 bits (268), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 113/244 (46%), Gaps = 27/244 (11%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL N+GN+CYIN +IQC+FAT     +F++  Y + +     K    GS+ V+S  F  
Sbjct: 525 VGLENMGNSCYINCIIQCIFATTELIKIFLNGTYAKHIN----KQSKLGSKGVLSHNFAK 580

Query: 751 LFKKMYLNGGC--------SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDE 802
           L K MY             +V  + F  +C+ +   FK    QQD  EF   +LD LH++
Sbjct: 581 LLKDMYEENSSKKIGKKHGAVKTLQFKMACASVNSLFK-DASQQDCLEFCQFLLDGLHED 639

Query: 803 LSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSL 859
           L NQ        +L    EK    L+++     +W  +  +    S I D+FQGQ  + L
Sbjct: 640 L-NQCGANPPLKELSPEAEKMRENLSLRVASSIEW--ERYLTTDFSIIVDLFQGQYASQL 696

Query: 860 HCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCP 919
            C+ C  +S  Y  F VLS+ +P          K   L +C   +T  E L  +  W CP
Sbjct: 697 RCKVCNRTSTTYQAFSVLSVPVPSG--------KSCGLLDCFIEFTKTENLEVDEQWFCP 748

Query: 920 NCCK 923
           +C K
Sbjct: 749 SCKK 752

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 68/149 (45%), Gaps = 36/149 (24%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVL------------- 1080
            KK  + K L   R+PR LIIHL RF  ++  KN+  V YP IL++               
Sbjct: 752  KKQPSTKKLTITRLPRNLIIHLKRFD-NMMNKNNIFVRYPQILDLTPFWANDSDGKLPPG 810

Query: 1081 KSNEV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
             ++E+          Y+LYG   H G L  GHYTS VDK  +        GW YFDD  V
Sbjct: 811  ITDEIPARGQVPPFNYRLYGAACHFGTLYGGHYTSYVDKGPE-------KGWIYFDD-TV 862

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             R  R  +      +  S   YVLFY RI
Sbjct: 863  YRPVRFQN------EFISPSAYVLFYHRI 885

>Kwal_14.2008 s14 (571638..572912) [1275 bp, 424 aa] {ON} YDR069C
           (DOA4) - ubiquitin isopeptidase [contig 424] PARTIAL
          Length = 424

 Score =  104 bits (260), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 73/245 (29%), Positives = 113/245 (46%), Gaps = 30/245 (12%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+N +IQCL  T+    +F+   YK  +  +  + G+ G   V+++ F  L
Sbjct: 57  GLVNLGNSCYMNCIIQCLLGTRELVQIFLDDSYKNHV-NLNSRLGSKG---VLAKYFSQL 112

Query: 752 FKKMYL-------------NGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDR 798
              M               N   +V P+ F  +C  +   FK    QQD  EF   +LD 
Sbjct: 113 IHNMQQQAISASGRKSTSGNERNAVQPLHFKVACGSINSLFKT-TSQQDCQEFCQFLLDG 171

Query: 799 LHDELS--NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQME 856
           LH++L+    +  + E  +      +KL ++     +W  +  +    S I D+FQGQ  
Sbjct: 172 LHEDLNQCGGNPALKELSEEAEAIREKLCMRIASSIEW--ERYLTTDFSVIVDLFQGQYA 229

Query: 857 NSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
           + L C+ CG +S  Y  F VLS+ +P        R  R +L +C   +T  E L  +  W
Sbjct: 230 SQLMCKVCGRTSTTYQPFSVLSVPVP--------RGARCNLLDCFEEFTKIETLEKDEQW 281

Query: 917 DCPNC 921
            CP C
Sbjct: 282 SCPRC 286

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 73/162 (45%), Gaps = 39/162 (24%)

Query: 1023 EMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
            E  E+ +QW   +      + K +   R+PR LIIHL RF  +L  KN+  V+YP  L++
Sbjct: 273  ETLEKDEQWSCPRCKVKQPSTKKITITRLPRNLIIHLKRFD-NLLHKNNIFVSYPHTLDL 331

Query: 1079 V-LKSNEV-------------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLN 1118
                +N+                      Y LY V  H G L  GHYT+ V+K+      
Sbjct: 332  TPFWANDFDGSLPKGVAELPTRGQTPPFHYNLYAVACHFGTLYGGHYTAYVNKE------ 385

Query: 1119 SNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYER 1160
             + +GW YFDD   ++     +       I++S  YVLFY R
Sbjct: 386  -DKNGWCYFDDTCWRKAKSEDEC------ITTS-AYVLFYHR 419

>AFR007W Chr6 (448632..451178) [2547 bp, 848 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR069C (DOA4) and
           YER144C (UBP5)
          Length = 848

 Score =  107 bits (267), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 84/282 (29%), Positives = 132/282 (46%), Gaps = 38/282 (13%)

Query: 661 PFRSATNGLHETYSIPTIEQNPNIYVSLS----ITGLRNLGNTCYINSMIQCLFATKSFR 716
           P +     L  T SI T+ Q  N+ V++S      GL N GN+CY++ +IQCL  T+   
Sbjct: 455 PMKPPDTPLPFTDSIKTLGQQ-NLTVAVSNLNFSVGLVNCGNSCYMSCIIQCLLGTQELC 513

Query: 717 NLFISMKYKEFLKEVAPKPGANGSQPVISRTFYILFKKMYLNGG----------CSVVPI 766
            +F++  Y+  +  +  + G+ G   +++R F  L  +MY  G            +V+P 
Sbjct: 514 TMFLNNSYQNHIN-LNSRLGSKG---LLARYFSQLIHQMYQYGKDIRKKMGNEKTAVIPT 569

Query: 767 SFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKK--- 823
            F  +C  +   FK  + QQD  EF   +LD LH++L NQ    N  P   L +E +   
Sbjct: 570 QFKIACGSINSSFK-DNTQQDCQEFCQFLLDGLHEDL-NQCG--NNPPLKELSEEAEKMR 625

Query: 824 --LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881
             + ++     +W  +  +    S I D+FQGQ  + L C+ C  +S  Y  F VLS+ +
Sbjct: 626 EMMPMRLASAIEW--ERYLTTDFSVIVDLFQGQYASQLQCKVCQRTSTTYQPFSVLSVPV 683

Query: 882 PKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCK 923
           P   + T        L +C   +T  E L  E  W CP+C K
Sbjct: 684 PSTRTCT--------LTDCFTEFTKIETLEQEEQWSCPSCKK 717

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 74/162 (45%), Gaps = 43/162 (26%)

Query: 1023 EMKEEMKQWKS----KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
            E  E+ +QW      K+  + K +   R+PR LIIHL RF  ++  KN+  V+YP +L++
Sbjct: 702  ETLEQEEQWSCPSCKKRQPSTKKITITRLPRNLIIHLKRFD-NMLNKNNVFVSYPSVLDL 760

Query: 1079 V----------LKSNEV----------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLN 1118
                       + +N V            Y+LYG+  H G L +GHYT+ V+K       
Sbjct: 761  TAFWANDYDKKVTNNNVELPSRGQVPPFNYQLYGIACHDGTLRAGHYTAYVNK------- 813

Query: 1119 SNGDGWYYFDDEVVK--RETRHGDVKHGVMKISSSDVYVLFY 1158
                GW Y+DD   +  R  R   +++G         YVL Y
Sbjct: 814  GAVLGWCYYDDTNWRQIRSAREYIIQNG---------YVLLY 846

>NDAI0C05900 Chr3 complement(1350639..1353119) [2481 bp, 826 aa]
           {ON} Anc_8.188 YDR069C
          Length = 826

 Score =  107 bits (266), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 126/269 (46%), Gaps = 34/269 (12%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL N+ N+CY+N +IQCL +T     L+++     FL ++  +    GS+  +S+ F  
Sbjct: 458 TGLENVKNSCYMNCVIQCLLSTHDLTKLYLT---NAFLTQINVE-NKLGSKGFLSKNFAN 513

Query: 751 LFKKMYLNGGCS---------VVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
           L + MY               V P+ F  +C ++   +     +QD  EF   +LD LH+
Sbjct: 514 LIQTMYKKSAFQPYNPNFLHPVAPLEFKNACGMMNSIYA-ESTEQDCQEFCEFLLDGLHE 572

Query: 802 ELSNQDAVVNEYPDLILYDE----KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMEN 857
           +L+      N  P  +  +E    + L+++     +W  +S +    SPI ++FQGQ  +
Sbjct: 573 DLNQCSG--NPRPKELSANEAELRESLSMRIASEIEW--ESFLTTNFSPIINLFQGQYAS 628

Query: 858 SLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWD 917
            L C  C H+S  Y  F +LS+ +P   S  FS  +  ++ +C   +T  E L  +  W 
Sbjct: 629 RLQCLICQHTSTTYQPFSLLSIPVP---SMVFSNGQTCNILDCFKEFTKCERLDNDEKWF 685

Query: 918 CPNC---------CKITKDYKGMVEKTKR 937
           CP C          KIT+  K ++   KR
Sbjct: 686 CPKCRRKQISTKQLKITRLPKNLIIHFKR 714

 Score = 69.3 bits (168), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 69/149 (46%), Gaps = 36/149 (24%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV-LKSNEV------- 1085
            +K  + K L   R+P+ LIIH  RF  +   KN+  V YP  L++  L  N+        
Sbjct: 691  RKQISTKQLKITRLPKNLIIHFKRFD-NFMNKNNIFVQYPYQLDLTSLWVNDYDGKLPPN 749

Query: 1086 -------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
                          KYKL  V  H+GNL SGHYT+ VDK L         GW+ FDD   
Sbjct: 750  FNEPPPSRGQTPPFKYKLNAVSCHSGNLGSGHYTAYVDKGLYR-------GWFRFDD--- 799

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
                 +  VK G  +  + D Y+LFY+RI
Sbjct: 800  ---ASYRPVKFGT-EFLTPDAYLLFYQRI 824

>ZYRO0G06798g Chr7 (544095..546728) [2634 bp, 877 aa] {ON} some
           similarities with uniprot|P32571 Saccharomyces
           cerevisiae YDR069C DOA4 Ubiquitin hydrolase required for
           recycling ubiquitin from proteasome-bound ubiquitinated
           intermediates acts at the late endosome/prevacuolar
           compartment to recover ubiquitin from ubiquitinated
           membrane proteins en route to the vacuole
          Length = 877

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/242 (30%), Positives = 116/242 (47%), Gaps = 26/242 (10%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CYIN +IQCL  T    N+F++  Y+  +  +  K G+ G   V+++ F  L
Sbjct: 516 GLENMGNSCYINCIIQCLLGTHELTNIFLNNSYERHI-NLNSKLGSKG---VLAKHFARL 571

Query: 752 FKKMYLNGGC-------SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS 804
             +M+ +          +V P  F  +C  +   F+    QQD+ EF   +LD LH++L 
Sbjct: 572 IHQMHQSAAFKKSDKNKAVRPYEFKMACGSINSLFR-ESGQQDSQEFCQFLLDGLHEDL- 629

Query: 805 NQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
           NQ        +L    EK   +L+++     +W  +  +    S I D+FQGQ  + L C
Sbjct: 630 NQCGGNPPLKELSEEAEKMRERLSMRIASSIEW--ERYLTRDFSVIVDLFQGQYASQLRC 687

Query: 862 QRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           + C H+S  Y  F +L+  +P A        K   L +C   +T  E L  +  W CP C
Sbjct: 688 KVCNHTSTTYQPFSILAAPVPHA--------KSCYLLDCFKEFTKLEQLEKDEEWLCPYC 739

Query: 922 CK 923
            K
Sbjct: 740 KK 741

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 84/165 (50%), Gaps = 36/165 (21%)

Query: 1018 IDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILN 1077
            +++L + +E +  +  KK  + K L   R+PR LIIHL RF  +L  KN+ +V YP  L+
Sbjct: 725  LEQLEKDEEWLCPYCKKKQPSTKKLTITRLPRNLIIHLKRFD-NLLNKNNVLVNYPFFLD 783

Query: 1078 IV------------------LKSNEVV---KYKLYGVVNHTGNLISGHYTSIVDKQLDHS 1116
            +                   L S   V   KYKLY V +H+G+L  GHYT+ VDK L+  
Sbjct: 784  LTPFWANDFDGRLPPGVTDELPSRGQVAPFKYKLYAVASHSGSLYGGHYTAYVDKGLN-- 841

Query: 1117 LNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
                  GWYYFDD      T +  ++     I +S+ YVLFY R+
Sbjct: 842  -----KGWYYFDD------TGYRPMRTPTECI-TSNAYVLFYHRV 874

>CAGL0G05247g Chr7 complement(491024..493867) [2844 bp, 947 aa] {ON}
           similar to uniprot|P32571 Saccharomyces cerevisiae
           YDR069c DOA4 ubiquitin-specific protease
          Length = 947

 Score =  105 bits (263), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 118/241 (48%), Gaps = 23/241 (9%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+GN+CY+N ++QC+  T     +F++  Y++ +  +  K G+ G   V++R F  L
Sbjct: 584 GLENMGNSCYMNCILQCIMGTNELSQIFLNNSYEKHI-NINSKLGSKG---VLARYFARL 639

Query: 752 FKKMYLNG------GCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
              M+            V P  F  + + +   F+   +QQD  EF   +LD LH++L N
Sbjct: 640 AHIMHQTSYDQEKKAAIVRPTQFRMAIASINSMFR-NTNQQDCQEFCQFLLDGLHEDL-N 697

Query: 806 QDAVVNEYPDLILYDEKK---LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
           Q        +L    EKK   L+++     +W  +  +    S I D+FQGQ  + L C 
Sbjct: 698 QCGNNPPLKELSEEAEKKRELLSLRIASSIEW--ERFLTTNFSVIIDLFQGQYASRLKCS 755

Query: 863 RCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCC 922
            C ++S  Y  F VLS+ +P  T S+      V+L +C N +T  E L  +  W+CP C 
Sbjct: 756 VCSNTSTTYQPFSVLSVPLPTGTKSS------VNLMDCFNEFTKCEKLEHDEYWNCPTCK 809

Query: 923 K 923
           K
Sbjct: 810 K 810

 Score = 77.0 bits (188), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 75/153 (49%), Gaps = 43/153 (28%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV-------------- 1079
            KK  + K L   R+PR LIIHL RF   +  KN+ ++ YP  L++               
Sbjct: 810  KKQPSTKQLTITRLPRNLIIHLKRFDNRMN-KNTKLIDYPFNLDLTSFWANDKDDRLPPG 868

Query: 1080 LKSNEV--------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDE- 1130
            +  +E+         KY LY V NH G+L  GHYTS V+K L         GWYYFDD+ 
Sbjct: 869  VSIDELPARGQIPPFKYSLYAVANHFGSLYGGHYTSYVNKGLSR-------GWYYFDDQN 921

Query: 1131 --VVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
              +VK+ +          ++ +S+ YVLFY R+
Sbjct: 922  YRLVKKTS----------EVVNSNAYVLFYRRV 944

>Suva_5.272 Chr5 complement(429119..431485) [2367 bp, 788 aa] {ON}
           YER144C (REAL)
          Length = 788

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 118/261 (45%), Gaps = 27/261 (10%)

Query: 674 SIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAP 733
           S P I+ +  ++    I GL N+GN CY+N ++QCL  T     +F+   Y  F+     
Sbjct: 412 SKPPIQNSTQMFDLDFIVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFIN---- 467

Query: 734 KPGANGSQPVISRTFYILFKKMYLNGG--------CSVVPISFLKSCSLLRPDFKIPDDQ 785
                GS+ ++++ F  L   M+ +G           V  I F K+C  +   +     Q
Sbjct: 468 FDNMRGSKGLLAKNFANLVHTMHRHGAFKPLNSRITPVQTIQFKKTCGHINSIYS-DSMQ 526

Query: 786 QDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGN 842
           QD  EF   +LD LH++L NQ+        L   +E+    ++++     +W  +  +  
Sbjct: 527 QDCQEFCQFLLDGLHEDL-NQNGGKKHLKQLSEEEERTRENMSIRKASALEW--ERFLLT 583

Query: 843 GLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLN 902
             S + D+FQGQ  + L CQ C H+S  Y TF VLS+ +P+  +         ++ +C  
Sbjct: 584 DFSAVIDLFQGQYASRLQCQACEHTSTTYQTFSVLSVPVPRIMT--------CNVLDCFR 635

Query: 903 MYTSDEVLSGENAWDCPNCCK 923
            +T  E L     W C  C K
Sbjct: 636 EFTKCEKLGIGEQWSCSRCLK 656

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 72/156 (46%), Gaps = 38/156 (24%)

Query: 1029 KQWKS----KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV----- 1079
            +QW      KK  + K L   R+P+ LII+L RF   +  KN+  V YP  L++      
Sbjct: 647  EQWSCSRCLKKQPSTKQLKITRLPKKLIINLKRFDNQM-HKNNVFVQYPCFLDLTPYWAR 705

Query: 1080 -LKSNEVV-------------KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWY 1125
                  ++             +Y+LYGV  H+G+L  GHYTS V K           GWY
Sbjct: 706  DFNHEAIIDEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYVYK-------GPQKGWY 758

Query: 1126 YFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            +FDD  + R  R  +      +  + + YVLFYERI
Sbjct: 759  FFDD-TIYRLIRFNN------EFITPNAYVLFYERI 787

>NCAS0B04280 Chr2 (777104..779872) [2769 bp, 922 aa] {ON} Anc_8.188
          Length = 922

 Score =  105 bits (262), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 121/250 (48%), Gaps = 19/250 (7%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL+N+GN+CY+N +IQCL  T     +F++  Y+  +  +  K G+ G   V+++ F 
Sbjct: 558 IVGLQNIGNSCYLNCIIQCLLGTHELTKIFLNNFYERHI-NLNSKLGSKG---VLAKYFA 613

Query: 750 ILFKKMYLNGGCS-----VVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS 804
            L   M+ +         V P  F  +   +   FK    QQD  EF   +LD LH++L+
Sbjct: 614 RLIHLMHNHANPKLKNNYVRPAQFKMAVGSVNTLFK-NCSQQDCQEFCQFLLDGLHEDLN 672

Query: 805 --NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
               +  + E       + +KL+++     +W  +  +    S I D+FQGQ  + L C+
Sbjct: 673 QCGSNPPLKELSSAAEKNREKLSLRIASSIEW--ERFLTTDFSVIVDLFQGQYASRLQCE 730

Query: 863 RCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCC 922
            C H+S  Y  F VLS+ IP+       +  +V++ +C   +T  E+L  +  W CP C 
Sbjct: 731 VCKHTSTTYQPFSVLSVPIPRV-----PKGVKVNILDCFKDFTKLELLDTDEQWLCPTCK 785

Query: 923 KITKDYKGMV 932
           K  +  K + 
Sbjct: 786 KKQRSTKKLT 795

 Score = 79.3 bits (194), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 87/175 (49%), Gaps = 41/175 (23%)

Query: 1012 VDAQRDIDELREMKEEMKQWK----SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNS 1067
            +D  +D  +L E+ +  +QW      KK  + K L   R+PR LIIHL RF  +   KN+
Sbjct: 761  LDCFKDFTKL-ELLDTDEQWLCPTCKKKQRSTKKLTITRLPRNLIIHLKRFD-NNLNKNN 818

Query: 1068 TIVTYPLILNI-------------------VLKSNEV--VKYKLYGVVNHTGNLISGHYT 1106
              + YP IL++                   + K  ++   KYKLYGV +H G+L  GHYT
Sbjct: 819  NFIDYPFILDLTQFWVDDFDGKLPPGVRDELPKRGQIPPFKYKLYGVASHFGSLYGGHYT 878

Query: 1107 SIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            + VDK   H       GWYYFDD      T +  +K+    I+SS  Y+LFY RI
Sbjct: 879  AYVDKGPKH-------GWYYFDD------TNYRSIKNKNEPITSS-AYLLFYHRI 919

>SAKL0H18986g Chr8 (1683752..1686433) [2682 bp, 893 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069C DOA4
           Ubiquitin hydrolase required for recycling ubiquitin
           from proteasome-bound ubiquitinated intermediates acts
           at the late endosome/prevacuolar compartment to recover
           ubiquitin from ubiquitinated membrane proteins en route
           to the vacuole
          Length = 893

 Score =  105 bits (261), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 77/251 (30%), Positives = 115/251 (45%), Gaps = 35/251 (13%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+N +IQCL  T     +F++  YK  +     K G+ G   V+++ F  L
Sbjct: 524 GLVNLGNSCYMNCIIQCLLGTHELSQMFLNDSYKNHIN-FNSKLGSKG---VLAKYFSQL 579

Query: 752 FKKMYLNGG----------------CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLI 795
              MY                     +V P++F  +C  +   F+    QQD  EF   +
Sbjct: 580 VHNMYRQNTPTSSFSSKKKLSGDERNAVQPLNFKIACGTINSLFR-DCSQQDCQEFCQFL 638

Query: 796 LDRLHDELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
           LD LH++L NQ        +L    EK   KL+++     +W  +  +    S I D+FQ
Sbjct: 639 LDGLHEDL-NQCGGNPRLKELSEEAEKIREKLSMRIASSIEW--ERYLTTDFSVIVDLFQ 695

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
           GQ  + L CQ CG +S  Y  F VLS+ +P          K  ++ +C   +T  E L  
Sbjct: 696 GQYASQLKCQVCGRTSTTYQPFSVLSVPLPSL--------KSCNILDCFQEFTKVETLEK 747

Query: 913 ENAWDCPNCCK 923
           +  W CP+C K
Sbjct: 748 DEQWSCPDCKK 758

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/163 (31%), Positives = 74/163 (45%), Gaps = 39/163 (23%)

Query: 1023 EMKEEMKQWKS----KKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI 1078
            E  E+ +QW      K+  + K +   R+PR LIIHL RF  ++  KN+  V+YP  L++
Sbjct: 743  ETLEKDEQWSCPDCKKRQPSTKKITITRLPRNLIIHLKRFD-NMMNKNNVFVSYPHTLDL 801

Query: 1079 V-LKSNEV-------------------VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLN 1118
                +N+                      YKLY V +HTG L  GHYT+ V K       
Sbjct: 802  TPFWANDFDGRLPPGVTELPTRGQVPPFSYKLYAVASHTGTLYGGHYTAYVHK------- 854

Query: 1119 SNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             +  GW YFDD   +R     +         +S+ YVLFY R+
Sbjct: 855  GSQRGWCYFDDTNWRRSRSDNEC-------ITSNAYVLFYHRV 890

>Skud_5.281 Chr5 complement(448432..450903) [2472 bp, 823 aa] {ON}
           YER144C (REAL)
          Length = 823

 Score =  104 bits (260), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 111/245 (45%), Gaps = 27/245 (11%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL N+GN CY+N ++QCL  T     +F+   Y  F+          GS+ ++++ + 
Sbjct: 463 IVGLENMGNCCYMNCILQCLVGTHDLTRMFLDNTYLNFINFG----NTRGSKGLLAKNYA 518

Query: 750 ILFKKMYLNGG--------CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
            L   M+ +G           V  + F K C  +   +     QQD  EF   +LD LH+
Sbjct: 519 TLVHNMHRHGAFKPPHSRTTPVQTLQFKKVCGHINSIYS-DSMQQDCQEFCQFLLDGLHE 577

Query: 802 ELSNQDAVVNEYPDLILYDEK---KLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENS 858
           +L NQ+        L   +E+    ++++     +W  +  +    S I D+FQGQ  + 
Sbjct: 578 DL-NQNGGKKHLKQLSEQEERMRESMSIRKASALEW--ERFLLTDFSAIIDLFQGQYASR 634

Query: 859 LHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDC 918
           L CQ C H+S  Y TF VLS+ +P        R +  ++ +C   +T  E L  +  W C
Sbjct: 635 LQCQACEHTSTTYQTFSVLSVPVP--------RIRTCNILDCFREFTKCEKLGVDEQWSC 686

Query: 919 PNCCK 923
             C K
Sbjct: 687 SKCLK 691

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 56/172 (32%), Positives = 75/172 (43%), Gaps = 43/172 (25%)

Query: 1018 IDELREMKEEMK-----QWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLTKKNST 1068
            +D  RE  +  K     QW   K      + K L   R+P+ LII+L RF   + K N+ 
Sbjct: 666  LDCFREFTKCEKLGVDEQWSCSKCLKKQPSTKQLKITRLPKKLIINLKRFDNQMNK-NNV 724

Query: 1069 IVTYPLILNIV------LKSNEVV-------------KYKLYGVVNHTGNLISGHYTSIV 1109
             V YP  L++            +V             +Y+LYGV  H+G+L  GHYTS V
Sbjct: 725  FVQYPCFLDLTPYWARDFNHESIVNEDIPTRGQIPPFRYRLYGVACHSGSLYGGHYTSYV 784

Query: 1110 DKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             K           GWY+FDD V     R  D      +  + + YVLFYERI
Sbjct: 785  YK-------GPQKGWYFFDDSVYC-PIRFND------EFITPNAYVLFYERI 822

>Ecym_6184 Chr6 (341652..344207) [2556 bp, 851 aa] {ON} similar to
           Ashbya gossypii AFR007W
          Length = 851

 Score =  103 bits (257), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 117/248 (47%), Gaps = 35/248 (14%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N GN+CY++ +IQCL  T+    +F++  Y+  +  +  + G+ G   V++R F  L
Sbjct: 487 GLVNCGNSCYMSCIIQCLLGTQELCTMFLNNSYQNHIN-LNSRLGSKG---VLARYFSQL 542

Query: 752 FKKMYLNGG----------CSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
             +MY  G            +V+P  F  +C  +   F+    QQD  EF   +LD LH+
Sbjct: 543 IHQMYQQGKDIRKTSGTEKTAVLPAQFKIACGSINALFR-DRSQQDCQEFCQFLLDGLHE 601

Query: 802 ELSNQDAVVNEYPDLILYDEKK------LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQM 855
           +L NQ       P L    EK       + ++     +W  +  +    S I D+FQGQ 
Sbjct: 602 DL-NQ---CGNNPPLKELSEKAEKMREMMPMRIASSIEW--ERYLTTDFSVIVDLFQGQY 655

Query: 856 ENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENA 915
            + L C+ CG +S  Y  F VLS+ +P         S++ ++ +C   +T  E L  +  
Sbjct: 656 ASQLRCKVCGRTSTTYQPFSVLSVPVPS--------SRQCTIIDCFTEFTKVETLDLDEQ 707

Query: 916 WDCPNCCK 923
           W CP+C K
Sbjct: 708 WSCPDCKK 715

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 77/166 (46%), Gaps = 41/166 (24%)

Query: 1017 DIDELREMKEEMKQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLIL 1076
            D+DE     +  K+  S K  TI      R+PR LIIHL RF  ++  KN+  V+Y  +L
Sbjct: 703  DLDEQWSCPDCKKRQPSTKKITI-----TRLPRNLIIHLKRFD-NMLNKNNVFVSYSAVL 756

Query: 1077 NI-----------VLKSNEV----------VKYKLYGVVNHTGNLISGHYTSIVDKQLDH 1115
            N+           V+ +N V            Y+LYGV  HTG L  GHYT+ V+K    
Sbjct: 757  NLTSFWANDYDKKVMNNNNVELPSRGQVPPFNYQLYGVACHTGTLYGGHYTAYVNKGATL 816

Query: 1116 SLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
                   GW Y+DD    R+ R  +      +  S + YVLFY RI
Sbjct: 817  -------GWCYYDD-TNWRQIRSSN------EYISQNAYVLFYHRI 848

>NCAS0A03910 Chr1 (791578..793965) [2388 bp, 795 aa] {ON} Anc_8.188
          Length = 795

 Score = 90.9 bits (224), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 82/279 (29%), Positives = 127/279 (45%), Gaps = 42/279 (15%)

Query: 681 NPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGS 740
           NP I     I GL N+ N+CY+N +IQCL +      + ++     FLK +  +    GS
Sbjct: 424 NPTI-----IIGLENMSNSCYMNCIIQCLLSVPELIQICLN---NSFLKHINMESKL-GS 474

Query: 741 QPVISRTFYILFKKMY---LNGGCS-----VVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
           + VI + F  L + M+   +  G S     V  I F  +C+ +   +     QQD  EF 
Sbjct: 475 KGVIMKHFAKLIQDMHSQQVKTGRSLFSYPVKTIDFKNACASVSSIYS-GSQQQDCQEFC 533

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKK-----LNVQNKEYKKWFDKSVIGNGLSPI 847
             +LD LH++L NQ       P   L D+++     L ++      W  ++ + N  S I
Sbjct: 534 EFLLDGLHEDL-NQCG--GNPPARELTDQEERLREGLCMRVASSMAW--ENFLHNNFSLI 588

Query: 848 DDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSD 907
            D+F GQ  + L C  C ++S  Y  F +LS+ +P +     SR  R S+ +C   +T  
Sbjct: 589 IDLFAGQYGSQLRCCVCQYTSTTYQPFTLLSVPVPLS-----SRVSRCSIIDCFQEFTKC 643

Query: 908 EVLSGENAWDCPNC---------CKITKDYKGMVEKTKR 937
           E L  +  W CP C          KIT+  K ++   KR
Sbjct: 644 ERLDKDEEWFCPQCKRKQPSTKQLKITRLPKNLIIHFKR 682

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 68/150 (45%), Gaps = 45/150 (30%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNI------------------- 1078
            + K L   R+P+ LIIH  RF  ++  KN+  + YP  L++                   
Sbjct: 663  STKQLKITRLPKNLIIHFKRFD-NMMNKNNIFIQYPYELDLTPFWVNDFNGELPLGMTNS 721

Query: 1079 -VLKSNEV--VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRE 1135
             + K  +V   KY+L  V  H G L SGHYT+ V+K  D        GWYYFDD      
Sbjct: 722  LLTKGGQVGPFKYQLNAVACHMGTLGSGHYTAYVNKGPD-------VGWYYFDDS----- 769

Query: 1136 TRHGDVKHGVMKISSS----DVYVLFYERI 1161
                   H ++KI++     D Y+LFY R+
Sbjct: 770  ------SHRIVKIATEYMNPDAYLLFYHRV 793

>Kpol_2001.54 s2001 complement(144924..148595) [3672 bp, 1223 aa]
           {ON} complement(144924..148595) [3672 nt, 1224 aa]
          Length = 1223

 Score = 82.4 bits (202), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 98/202 (48%), Gaps = 17/202 (8%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGNTCY+NS +QCL      R+ F+   YK F KE+       G Q  ++R+F IL
Sbjct: 343 GLNNLGNTCYMNSALQCLVHIPQLRDYFL---YKVFEKEINLD-NPLGYQGHVARSFAIL 398

Query: 752 FKKMY---LNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN-QD 807
            + ++   L    S  P +F  +       F     QQD+ EF+  +LD LH++L+   +
Sbjct: 399 IQNLFKDELLPSLSYSPTTFKSTVGHFNSMFS-GYLQQDSQEFIAFLLDGLHEDLNRITN 457

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL----SPIDDIFQGQMENSLHCQR 863
             V E P L   D+    V N+E  K        + L    S I DIF G  +++LHC  
Sbjct: 458 KPVVEKPSLKPEDD----VSNQEVIKKLADDTWNSHLLRNDSIITDIFVGLYKSTLHCPE 513

Query: 864 CGHSSFNYSTFYVLSLAIPKAT 885
           C + S  +  +  L+L +P  T
Sbjct: 514 CDNLSVTFDPYNDLTLPLPVDT 535

 Score = 39.3 bits (90), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 54/129 (41%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLI---LNIVLKSNEVVKYKLYGVV 1094
            K L     P  L+IHL RF      + K    V +P+    L+  + +N+  K  +Y +V
Sbjct: 943  KQLQLWSTPDILLIHLKRFENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLV 1002

Query: 1095 ---NHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
               NH G L  GHYT+ V   +D         WYYFDD  V        +        + 
Sbjct: 1003 SVDNHYGGLGGGHYTAYVKNFVDKK-------WYYFDDSRVTETVPERSI--------AG 1047

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1048 SAYLLFYMR 1056

 Score = 38.9 bits (89), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           K+++L++CLN++   EVL   ++W CP C
Sbjct: 907 KKITLDDCLNLFAKKEVLGMNDSWYCPTC 935

>KNAG0G01590 Chr7 complement(354369..356384) [2016 bp, 671 aa] {ON}
           Anc_8.188 YDR069C
          Length = 671

 Score = 75.9 bits (185), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 109/248 (43%), Gaps = 37/248 (14%)

Query: 682 PNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQ 741
           PN      I G++N GN CY+N +IQCL     F N F+   Y   +  V  + G  G  
Sbjct: 335 PNYTSPTVIKGIQNEGNCCYMNCIIQCLLCFPEFTNKFLDNAYLGTIN-VNSRLGHQGL- 392

Query: 742 PVI---SRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDR 798
            V+   ++     F+    N   +V    F +  + L P++     Q D +EF + +L+ 
Sbjct: 393 -VVKNWAKIIQAFFQVSQENIQPAVSITEFREQWANLFPEYG-KYQQHDCSEFCLRLLEE 450

Query: 799 LHDELS-----NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQG 853
           +H++ +     N DA                 +Q  +Y++ ++    GN  S I D F+G
Sbjct: 451 IHEDSNWGRPQNSDAA----------------MQVDDYREAWNLYRKGNS-SYIVDTFKG 493

Query: 854 QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGE 913
           Q+++ L CQ C   S NY  F +L+L IP  +           + +C+       VL+G+
Sbjct: 494 QIKSQLTCQVCQTQSNNYEPFSILNLPIPLVS--------MCHIYDCMKELFKVHVLTGD 545

Query: 914 NAWDCPNC 921
           + W C  C
Sbjct: 546 DRWYCSTC 553

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 66/133 (49%), Gaps = 21/133 (15%)

Query: 1032 KSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIV----LKSNEVVK 1087
            K+K   T+ T     +P  LIIH +RF  +L  K    V YP +L++     L     V 
Sbjct: 554  KTKTHSTLGT-TITNVPEVLIIHFNRFD-NLLNKKECFVKYPYLLDLSQGNGLLGKCDVP 611

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMK 1147
            YKL  V  HTG L SGHYT+       +   ++ +GWY+FDD      T+   V +G  +
Sbjct: 612  YKLVAVACHTGTLFSGHYTA-------YCFKNSENGWYHFDD------TQCKPVSNG--E 656

Query: 1148 ISSSDVYVLFYER 1160
              S   Y+LFY++
Sbjct: 657  CISQSAYLLFYQK 669

>Skud_10.22 Chr10 (38735..42502) [3768 bp, 1255 aa] {ON} YJL197W
           (REAL)
          Length = 1255

 Score = 75.5 bits (184), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 97/203 (47%), Gaps = 14/203 (6%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL NLGNTCY+NS +QCL      R+ F+   Y+  + E  P     G    ++R F  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYNGYESEINEENPL----GYHGYVARAFSD 419

Query: 751 LFKKMYLNGGCSV-----VPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
           L +K++ N   S+      P S  KS             QQD+ EFL  +LD LH++L+ 
Sbjct: 420 LVQKLFHNKLSSMQRNAAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNR 479

Query: 806 --QDAVVNEYPDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
             + A + E P L   D+    NV  K     ++  +  N  S I D+F G  +++L+C 
Sbjct: 480 IIKKAYI-EKPSLSPDDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGLYKSTLYCP 537

Query: 863 RCGHSSFNYSTFYVLSLAIPKAT 885
            C + S  +  +  ++L +P  T
Sbjct: 538 ECKNVSITFDPYNDVTLPLPVDT 560

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 51/130 (39%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L++HL RF      + K    V +P +  + L  + V K       Y L
Sbjct: 998  KQIQLWNTPDILLVHLKRFESQRSFSDKIDATVNFP-VTALDLSKHVVHKDDPRGSIYDL 1056

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            Y V NH G L  GHYT+ V    D         WYYFDD  V        +        S
Sbjct: 1057 YAVDNHYGGLGGGHYTAYVKNFADSK-------WYYFDDSRVTETVPENSI--------S 1101

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1102 GSAYLLFYIR 1111

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 22/32 (68%)

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++ + ++L++CL +++  E+L   ++W CP C
Sbjct: 959 AKERIITLDDCLQLFSKPEILGLNDSWYCPTC 990

>YJL197W Chr10 (63805..67569) [3765 bp, 1254 aa] {ON}
           UBP12Ubiquitin carboxyl-terminal hydrolase,
           ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1254

 Score = 74.7 bits (182), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 96/204 (47%), Gaps = 16/204 (7%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL NLGNTCY+NS +QCL      R+ F+   Y++ + E  P     G    ++R F  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYEDEINEENPL----GYHGYVARAFSD 419

Query: 751 LFKKMYLNGGC-----SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
           L +K++ N        +  P S  KS             QQD+ EFL  +LD LH++L+ 
Sbjct: 420 LVQKLFQNRMSIMQRNAAFPPSMFKSTIGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNR 479

Query: 806 QDAVVNEY---PDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
              +  EY   P L   D+    NV  K     ++  +  N  S I D+F G  +++L+C
Sbjct: 480 --IIKKEYTEKPSLSPGDDVNDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYC 536

Query: 862 QRCGHSSFNYSTFYVLSLAIPKAT 885
             C + S  +  +  ++L +P  T
Sbjct: 537 PECQNVSITFDPYNDVTLPLPVDT 560

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 52/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K    V +P I ++ L    V K       Y L
Sbjct: 996  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSRYVVYKDDPRGLIYDL 1054

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            Y V NH G L  GHYT+ V    D+        WYYFDD  V        +        +
Sbjct: 1055 YAVDNHYGGLGGGHYTAYVKNFADNK-------WYYFDDSRVTETAPENSI--------A 1099

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1100 GSAYLLFYIR 1109

 Score = 34.3 bits (77), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 22/32 (68%)

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++ + ++L++CL +++  E+L   ++W CP C
Sbjct: 957 AKERTITLDDCLQLFSKPEILGLTDSWYCPTC 988

>ZYRO0C17908g Chr3 complement(1393864..1397478) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P39538 Saccharomyces cerevisiae
           YJL197W UBP12 Ubiquitin-specific protease present in the
           nucleus and cytoplasm that cleaves ubiquitin from
           ubiquitinated proteins
          Length = 1204

 Score = 73.6 bits (179), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 67/217 (30%), Positives = 97/217 (44%), Gaps = 32/217 (14%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           S  ITGL NLGNTCY+NS +QCL      R+ F+   Y  F  E+       G Q  ++R
Sbjct: 289 SSGITGLYNLGNTCYMNSALQCLVHIPELRDYFL---YNCFEDEINCN-NPLGYQGYVAR 344

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD----------------QQDTTE 790
            F  L + ++   GC       L S S L P +  P                  QQD+ E
Sbjct: 345 AFSGLVQNLF---GCKT-----LSSGSTLTPAYS-PTGFKSTIGHFNSMFSGYMQQDSQE 395

Query: 791 FLMLILDRLHDELSN-QDAVVNEYPDLILYDEKK-LNVQNKEYKKWFDKSVIGNGLSPID 848
           F+  +LD LH++L+   D    E P L   D+    NV  +  +  +   +  N  S I 
Sbjct: 396 FITFLLDGLHEDLNRIVDKPYIEKPSLSPEDDSNDFNVIKRLAEDTWKLHLQRND-SVIT 454

Query: 849 DIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKAT 885
           D+F G  E++L C  C + S  +  +  L+L +P  T
Sbjct: 455 DLFVGLYESTLQCPECNNVSITFDPYNDLTLPLPVNT 491

 Score = 40.4 bits (93), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 40/130 (30%), Positives = 54/130 (41%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K   +V +P I  + +    V K       Y L
Sbjct: 914  KQIQLWDTPDVLLIHLKRFENLRSFSDKIDEVVHFP-ITGLDMSPYLVNKGDPRGTIYDL 972

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
              V NH G L  GHYT+       ++ N +   WYYFDD  V   T    +        +
Sbjct: 973  VAVDNHYGGLGGGHYTA-------YAKNVDDSKWYYFDDSRVTETTPERGI--------A 1017

Query: 1151 SDVYVLFYER 1160
            S  Y+LFY R
Sbjct: 1018 SSAYLLFYVR 1027

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 21/29 (72%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           K+++L +CL +++  EVL   ++W CP+C
Sbjct: 878 KKITLHDCLKLFSKREVLGMNDSWYCPSC 906

>KNAG0C02180 Chr3 (429789..433484) [3696 bp, 1231 aa] {ON} Anc_1.137
           YJL197W
          Length = 1231

 Score = 73.6 bits (179), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 98/209 (46%), Gaps = 18/209 (8%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           S    GL NLGNTCY+NS +QCL      R+ F+   Y  F KE+       G Q  ++R
Sbjct: 317 STGTIGLSNLGNTCYMNSGLQCLVHIPQIRDYFV---YNGFEKEINVN-NPLGFQGHMAR 372

Query: 747 TFYILFKKMYLNGGCSVVPI------SFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLH 800
           +F+ L + ++   G S+ P       +  KS  +          QQD+ EFL  +LD LH
Sbjct: 373 SFHGLIQSLF---GDSIAPFPSYVSPTHFKSTLVHFNSMFSGFQQQDSQEFLAFLLDSLH 429

Query: 801 DELSN-QDAVVNEYPDLILYDEKK--LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMEN 857
           ++L+   +    E P L   D+      ++    + W  KS +    S I DIF G  ++
Sbjct: 430 EDLNRIVEKPYVEKPSLKPGDDINDFDTIKKLANETW--KSHLMRNDSIITDIFVGMYKS 487

Query: 858 SLHCQRCGHSSFNYSTFYVLSLAIPKATS 886
           +L C  C + S  +  +  L+L +P  +S
Sbjct: 488 TLECPECSNVSITFDPYNDLTLPLPINSS 516

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           +  +L++CLN+++  EVL   ++W CPNC
Sbjct: 891 QETTLKDCLNLFSKKEVLGMSDSWYCPNC 919

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 52/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P   +IHL RF      + K    + +P I ++ +    V K       Y L
Sbjct: 927  KKIELWNTPDVFLIHLKRFENTRSFSDKIDATILFP-IEDLDMSEYLVYKDDPRGSVYDL 985

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
              V NH G +  GHYT+ V    D +       WYYFDD  V + +    +        +
Sbjct: 986  IAVDNHYGGMGGGHYTAYVKNLTDQN-------WYYFDDSRVSKTSPEKSI--------A 1030

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1031 GSAYLLFYLR 1040

>TDEL0C05640 Chr3 complement(1005536..1009072) [3537 bp, 1178 aa]
           {ON} Anc_1.137 YJL197W
          Length = 1178

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 96/213 (45%), Gaps = 25/213 (11%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           S  ITGL NLGNTCY+NS +QCL      R+ F+   Y  F  E+       G Q  I++
Sbjct: 298 SQGITGLTNLGNTCYMNSALQCLVHIPELRDYFL---YDGFTSEINSD-NPLGYQGNIAK 353

Query: 747 TFYILFKKMYLNGGCSVVPISF--------LKSCSLLRPDFKIPDDQQDTTEFLMLILDR 798
            F +L K ++     S    +F        +  C+ +   +     QQD+ EFL  +LD 
Sbjct: 354 AFSLLVKSLFGASYGSASSQAFSPNNFKMIMGHCNTMFSGYM----QQDSQEFLAFLLDG 409

Query: 799 LHDELSN-QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL----SPIDDIFQG 853
           LH++L+   D    E P L        +V +++  K   +      L    S + D+F  
Sbjct: 410 LHEDLNRVHDKPYIEKPSL----SPNSDVTDRDTIKKLAEDTWKMHLLRNDSIVTDLFVA 465

Query: 854 QMENSLHCQRCGHSSFNYSTFYVLSLAIPKATS 886
             E++L C  C + S  +  +  L+L +P  T+
Sbjct: 466 LYESTLECPECRNVSITFDPYNDLTLPLPVNTT 498

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 49/128 (38%), Gaps = 24/128 (18%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYP-----LILNIVLKSNEVVKYKLYG 1092
            K +     P  L+IHL RF      + K    V +P     +  ++V +      Y L  
Sbjct: 904  KQIQLWSTPDVLLIHLKRFENQRSFSDKIDDTVHFPIKSLDMTEHLVHEDPRGSIYDLIA 963

Query: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
            V NH G L  GHYT+ V            D W+YFDD  V        +        +  
Sbjct: 964  VDNHFGGLGGGHYTAYV---------KTNDKWFYFDDSRVTETKPESSI--------AGS 1006

Query: 1153 VYVLFYER 1160
             Y+LFY R
Sbjct: 1007 AYLLFYLR 1014

 Score = 36.6 bits (83), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 20/29 (68%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           + +SL +CL +++  EVLS  ++W CP C
Sbjct: 868 RAISLHDCLKLFSKKEVLSMNDSWYCPTC 896

>Smik_10.37 Chr10 (61787..65530) [3744 bp, 1247 aa] {ON} YJL197W
           (REAL)
          Length = 1247

 Score = 73.2 bits (178), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 94/204 (46%), Gaps = 16/204 (7%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL NLGNTCY+NS +QCL      R+ F+   Y+  + E  P     G    ++R F  
Sbjct: 364 TGLVNLGNTCYMNSALQCLVHIPQLRDYFLYDGYENEINEENPL----GYHGYVARAFSD 419

Query: 751 LFKKMYLNGGC-----SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
           L +K++ N           P S  KS             QQD+ EFL  +LD LH++L+ 
Sbjct: 420 LIQKIFQNRLSVMQRNGAFPPSMFKSTVGHFNSMFSGYMQQDSQEFLAFLLDSLHEDLNR 479

Query: 806 QDAVVNEY---PDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
              +  EY   P L   D+    NV  K     ++  +  N  S I D+F G  +++L+C
Sbjct: 480 --IIKKEYIEKPSLSPGDDVDDWNVVKKLADDTWEMHLKRN-CSVITDLFVGMYKSTLYC 536

Query: 862 QRCGHSSFNYSTFYVLSLAIPKAT 885
             C + S  +  +  ++L +P  T
Sbjct: 537 PECKNVSITFDPYNDVTLPLPVDT 560

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 53/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K    V +P I ++ L  N V K       Y L
Sbjct: 992  KQIQLWNTPDILLIHLKRFESQRSFSDKIDATVNFP-ITDLDLSKNVVYKDDPRGSIYDL 1050

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            Y V NH G L  GHYT+ V        N   + WYYFDD  V        +        +
Sbjct: 1051 YAVDNHYGGLGGGHYTAYVK-------NFANNKWYYFDDSRVTETVPENSI--------A 1095

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1096 GSAYLLFYIR 1105

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 22/32 (68%)

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++ + ++L++CL +++  E+L   ++W CP C
Sbjct: 953 AKERTITLDDCLQLFSKPEILGLSDSWYCPTC 984

>NDAI0B00480 Chr2 complement(89965..93726) [3762 bp, 1253 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1253

 Score = 72.0 bits (175), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 100/215 (46%), Gaps = 25/215 (11%)

Query: 683 NIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQP 742
           N+  S    GL NLGNTCY+NS +QC+     FR+ F+   Y  F KEV  +    G Q 
Sbjct: 322 NLQSSPGTIGLTNLGNTCYMNSALQCITHIPIFRDYFL---YGTFQKEVN-EGNPLGYQG 377

Query: 743 VISRTFYILFKKMYLNGGCSVVPI--SFLKSC-----SLLRPDFKIPDDQQDTTEFLMLI 795
            ++R F  L + ++ +   S      S+ KS      S+          QQD+ EFL  +
Sbjct: 378 YMARAFSDLIQSLFGDNITSTTAYSPSYFKSTLGHFNSMFSGYL-----QQDSQEFLAFL 432

Query: 796 LDRLHDELSNQDAV-VNEYPDLILYDEKKLN----VQNKEYKKWFDKSVIGNGLSPIDDI 850
           LD LH++L+  D     E P L L     LN    V+      W  K+ +    S I D+
Sbjct: 433 LDSLHEDLNRIDKKPYVEKPSLPL--TANLNDFDVVKRLADDTW--KAHLLRNDSVITDL 488

Query: 851 FQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKAT 885
           F    +++L C  C ++S  +  +  L+L +P A+
Sbjct: 489 FVAMYKSTLKCPECQNTSVTFDPYNDLTLPLPVAS 523

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 54/130 (41%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K    V +P I +  +  + V K       Y L
Sbjct: 973  KQIELWNTPDILLIHLKRFENQRSFSDKIVDTVFFP-ITDFDISEHLVYKEDPRGNVYDL 1031

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
              V NH G L  GHYT+       ++ N+N + WYYFDD  V        +        +
Sbjct: 1032 IAVDNHYGGLGGGHYTA-------YAKNANDNKWYYFDDSRVSVTAPEKSI--------A 1076

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1077 GSAYLLFYVR 1086

 Score = 37.0 bits (84), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 10/29 (34%), Positives = 22/29 (75%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           + ++L++CL +++  E+LS  ++W CP+C
Sbjct: 937 RHITLDDCLKLFSKPEILSSNDSWYCPHC 965

>Suva_6.276 Chr6 complement(481843..485613) [3771 bp, 1256 aa] {ON}
           YJL197W (REAL)
          Length = 1256

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 96/204 (47%), Gaps = 16/204 (7%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL NLGNTCY+NS +QCL      R+ F+   Y++ + E  P     G    ++R F  
Sbjct: 361 TGLVNLGNTCYMNSALQCLVHLPQLRDYFLYNGYEKEINEENPL----GYHGYVARAFSD 416

Query: 751 LFKKMYLNG------GCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS 804
           L +K++ N         +  P  F  +       F     QQD+ EFL  +LD LH++L+
Sbjct: 417 LIQKLFQNKLNIMQRNGAFPPTMFKSTIGHFNSMFS-GYMQQDSQEFLAFLLDSLHEDLN 475

Query: 805 N--QDAVVNEYPDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
              + A + E P L   D+    NV  K     ++  +  N  S I D+F G  +++L+C
Sbjct: 476 RIIKKAYI-EKPSLSPDDDVNDWNVIKKLADDTWELHLKRNR-SVITDLFVGMYKSTLYC 533

Query: 862 QRCGHSSFNYSTFYVLSLAIPKAT 885
             C   S  +  +  ++L +P  T
Sbjct: 534 PECKDVSTTFDPYNDVTLPLPVDT 557

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 54/130 (41%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K    V +P I ++ L  + V K       Y L
Sbjct: 995  KQIQLWNTPDILLIHLKRFESQRSFSDKIDDTVNFP-ITDLDLSEHVVYKDDPRGSIYDL 1053

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            Y V NH G L  GHYT+ V   +D+        WYYFDD  V        V        +
Sbjct: 1054 YAVDNHYGGLGGGHYTAYVKNFMDNK-------WYYFDDSRVTETVPENSV--------A 1098

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1099 GSAYLLFYIR 1108

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 9/32 (28%), Positives = 21/32 (65%)

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++ + ++L +CL +++  E+L   ++W CP C
Sbjct: 956 AKERTITLNDCLQLFSKPEILGLNDSWYCPTC 987

>AFR627C Chr6 complement(1572814..1576677) [3864 bp, 1287 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL197W
           (UBP12)
          Length = 1287

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 96/203 (47%), Gaps = 11/203 (5%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGNTCY+NS +QCL     F++ F+   Y++ +    P           +     L
Sbjct: 347 GLSNLGNTCYMNSALQCLLHIPEFKDYFLYNGYEKEVNIENPLGHKGHIAWAFASMVQAL 406

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN-QDAVV 810
           F K + +   S  P +F  +   L   F     QQD+ EFL  +LD LH++L+   +   
Sbjct: 407 FGKRH-SAATSYSPRNFKNTIGHLNSMFS-GYQQQDSQEFLAFLLDGLHEDLNRIIEKPY 464

Query: 811 NEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL---SPIDDIFQGQMENSLHCQRCGHS 867
            E P+L   D+     + K  KK  D +   + L   S I D+F G  +++L C  C  +
Sbjct: 465 VEKPELTSTDD---TAEFKVIKKLADDTWGKHKLRNDSVITDLFVGLYKSTLICPVCKKT 521

Query: 868 SFNYSTFYVLSLAIPKATSSTFS 890
           S  +  +  L+L +P   +ST+S
Sbjct: 522 SVTFDPYNDLTLPLP--VNSTWS 542

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 23/32 (71%)

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           S  K+++L +CL ++++ EVL   ++W CPNC
Sbjct: 957 SGEKKITLHDCLTLFSTPEVLGATDSWFCPNC 988

 Score = 38.5 bits (88), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 53/131 (40%), Gaps = 28/131 (21%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K +  V +P I ++ +    V K       Y L
Sbjct: 996  KQIELWNAPDILLIHLKRFENQRSFSDKIADTVHFP-ITDLDMTPYLVYKNEDKGDIYDL 1054

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDG-WYYFDDEVVKRETRHGDVKHGVMKIS 1149
              V NH G L  GHYT+ V          N DG WYYFDD  V        +        
Sbjct: 1055 IAVDNHYGGLGGGHYTAYV---------KNIDGKWYYFDDSRVSETLPERSI-------- 1097

Query: 1150 SSDVYVLFYER 1160
            +   Y+LFY R
Sbjct: 1098 AGSAYLLFYRR 1108

>TPHA0A02540 Chr1 (543606..547466) [3861 bp, 1286 aa] {ON} Anc_1.137
           YJL197W
          Length = 1286

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/205 (31%), Positives = 91/205 (44%), Gaps = 27/205 (13%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGNTCY+NS +QCL      R+ F    YK  +    P     G Q  I+  F  
Sbjct: 398 VGLNNLGNTCYMNSALQCLAHIPPIRDYFKFGAYKNEINLDNPL----GFQGNIANAFSA 453

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD----------QQDTTEFLMLILDRLH 800
           L + +Y N         F+ S S     FK+             QQD+ EFL  +LD LH
Sbjct: 454 LVQNLYKN--------QFIPSASYAPSQFKLTIGHYNQMFSGYFQQDSQEFLAFLLDGLH 505

Query: 801 DELSN-QDAVVNEYPDLILYDEKKLNVQNKEYKKWFD--KSVIGNGLSPIDDIFQGQMEN 857
           ++L+  +D    E P L   D   +N  N   +   D  ++ +    S I D+F G  ++
Sbjct: 506 EDLNRIKDKPYVEKPSLA--DGSDVNDYNIIARLAADTLEAHLKRNDSIIIDLFVGLYKS 563

Query: 858 SLHCQRCGHSSFNYSTFYVLSLAIP 882
           +L C  C H S  +  +  L+L IP
Sbjct: 564 TLKCPVCNHVSITFDPYCDLTLPIP 588

 Score = 39.7 bits (91), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 53/129 (41%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYY--DLTKKNSTIVTYP-----LILNIVLKSNEVVK-YKLY 1091
            K +     P  L IHL RF      + K   +V +P     L  +I+ KS   +  Y L 
Sbjct: 996  KQIQLWSTPDILTIHLKRFETQGSFSDKIDDVVDFPINGLDLSKHILDKSTSQLNIYDLI 1055

Query: 1092 GVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
             V NH G L  GHYT+ +   +D+        WYYFDD  V        V        + 
Sbjct: 1056 AVDNHYGGLGGGHYTAYIKNLIDNK-------WYYFDDSRVSETVPERSV--------AG 1100

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1101 SAYLLFYMR 1109

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           K ++LE+ LN++   EVL   ++W CP C
Sbjct: 960 KNITLEDSLNLFERAEVLGINDSWYCPKC 988

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 97/200 (48%), Gaps = 17/200 (8%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL NLGN+CY+NS +QCL      ++ F+   Y+E +    P     G + ++++ F  
Sbjct: 334 TGLSNLGNSCYMNSALQCLVHIPELKDYFLYGGYEEDVNTQNPL----GYKGLVAQAFAA 389

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD--QQDTTEFLMLILDRLHDELSN-QD 807
           L K ++     S    S  +  S++     +     QQD+ EFL  +LD LH++L+   +
Sbjct: 390 LIKSLFDERSSSAFAFSPREFKSIIGQQNSMFAGFLQQDSQEFLAFLLDGLHEDLNRIIE 449

Query: 808 AVVNEYPDLILYDEKKLNVQNKEY-----KKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
               E P+L        +V N+E       K +DK  + N  S I D+F G  +++L C 
Sbjct: 450 KPFVEKPEL----SPDEDVNNREVIHRLASKTWDKHKLRND-SVILDLFVGLYKSTLTCP 504

Query: 863 RCGHSSFNYSTFYVLSLAIP 882
            C  +S  +  +  L+L +P
Sbjct: 505 VCDKTSVTFDPYSDLTLPLP 524

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 52/129 (40%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLI-LN-----IVLKSNEVVKYKLY 1091
            K +     P  L IHL RF   +  + K S +V +P+  LN     +   + +   Y L 
Sbjct: 937  KQIQLWNSPDILTIHLKRFESRHSFSDKISDVVDFPICGLNMSDHLVCEDAEQNNLYDLV 996

Query: 1092 GVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
             V NH G L  GHYT+     +D         WYYFDD  V        V        S 
Sbjct: 997  AVDNHYGGLGGGHYTAFAKNPVDGK-------WYYFDDSRVSETDPETSV--------SG 1041

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1042 AAYLLFYRR 1050

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 21/29 (72%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           +R+SL +CL +++  EVLS  ++W CP C
Sbjct: 901 RRISLFDCLKLFSKPEVLSAADSWYCPTC 929

>NCAS0I03140 Chr9 complement(576993..580598) [3606 bp, 1201 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1201

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 92/201 (45%), Gaps = 11/201 (5%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           SL ITGL NLGNTCY+NS +QC+     FR  F+   Y++ L    P     G Q  ++ 
Sbjct: 317 SLEITGLVNLGNTCYMNSALQCITHIPVFREYFLYSGYEKELNTDNPL----GYQGHVAE 372

Query: 747 TFYILFKKMY---LNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
            F  L + ++   L    +  P  F  +       F     QQD+ EFL  +LD LH++L
Sbjct: 373 AFSELIRCLFGDKLVQFSAYAPNHFKATIGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDL 431

Query: 804 SNQDAV-VNEYPDL-ILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
           +  D     E P L    D     +  K     +   ++ N  S I D+F G  +++L C
Sbjct: 432 NRIDKKPYVEKPSLPSTADLNDFRIVKKLADDTWKAHLLRND-SVITDLFVGLYKSTLEC 490

Query: 862 QRCGHSSFNYSTFYVLSLAIP 882
             C + S  +  +  L+L +P
Sbjct: 491 PECQNISITFDPYNDLTLPLP 511

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 53/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K   +V +P I +  +  + V K       Y L
Sbjct: 930  KQIQLWNAPDVLLIHLKRFENQQSFSDKIDDVVQFP-ITDFDISEHLVYKDDPRGNVYDL 988

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
              V NH G L  GHYT+       ++ NS    WYYFDD  V        +        +
Sbjct: 989  IAVDNHYGGLGGGHYTA-------YAKNSTDGKWYYFDDSRVTETVAENSI--------T 1033

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1034 GAAYLLFYLR 1043

 Score = 38.9 bits (89), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 23/31 (74%)

Query: 891 RSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++K ++L +CLN+++  E+LS  ++W CP C
Sbjct: 892 KNKEITLNDCLNLFSKPEILSLNDSWYCPTC 922

>CAGL0L01639g Chr12 (178104..181547) [3444 bp, 1147 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197w UBP12
           ubiquitin C-terminal hydrolase
          Length = 1147

 Score = 70.9 bits (172), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 95/203 (46%), Gaps = 13/203 (6%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL NLGNTCY+NS +QCL      R+ F    Y++ +    P  G NG+   ++  F 
Sbjct: 288 IVGLSNLGNTCYMNSGLQCLVHIPKLRDYFFYGGYEQEINLDNPL-GYNGT---VATAFG 343

Query: 750 ILFKKMY-----LNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS 804
            L + +Y          S  P  F  +       F     QQD+ EFL  +LD LH++L+
Sbjct: 344 NLIQNLYSYHWNQQQYQSYSPNRFKMTLGQANSMFA-GYMQQDSQEFLAFLLDSLHEDLN 402

Query: 805 N-QDAVVNEYPDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
              D    E P L   +E    N   +  KK +D  +  N  S I+D+F G  +++L C 
Sbjct: 403 RIHDKPYIEKPTLETSEELADENAVKQLAKKTWDAHLARND-SVINDLFVGMYKSTLKCP 461

Query: 863 RCGHSSFNYSTFYVLSLAIPKAT 885
            C + S  +  +  L+L +P +T
Sbjct: 462 TCKNISITFDPYNDLTLPLPIST 484

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 57/129 (44%), Gaps = 27/129 (20%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPL--------ILNIVLKSNEVVKYK 1089
            K L     P  L+IHL RF      + K   +V +P+        +++ V++   +  Y 
Sbjct: 879  KQLELWNTPEILLIHLKRFENQRSFSDKIDAVVDFPIEGLDMTPYVVDSVVEDGCI--YD 936

Query: 1090 LYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKIS 1149
            L+ V NH G L  GHYTS V   +D+        WYYFDD  V       D K  V    
Sbjct: 937  LFAVDNHYGGLGGGHYTSYVKNNIDNR-------WYYFDDSRVSS----TDPKKSV---- 981

Query: 1150 SSDVYVLFY 1158
            +   Y+LFY
Sbjct: 982  AGSAYLLFY 990

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 895 VSLEECLNMYTSDEVLSGENAWDCPNC 921
           ++L+ CL +++  EVL   ++W CP C
Sbjct: 845 ITLDSCLKLFSKPEVLGINDSWYCPKC 871

>Kwal_33.13628 s33 (324581..328063) [3483 bp, 1160 aa] {ON} YJL197W
           (UBP12) - ubiquitin carboxyl-terminal hydrolase [contig
           114] FULL
          Length = 1160

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 91/197 (46%), Gaps = 9/197 (4%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL NLGN+CY+NS +QCL      R+ F+   +++ +    P     G Q  I++ F 
Sbjct: 297 IVGLSNLGNSCYMNSALQCLVHIPELRDYFLYGGFEQDINTSNPL----GYQGQIAQAFA 352

Query: 750 ILFKKMYLNGGCSVVPIS--FLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN-Q 806
            L K ++ +   ++   S    KS             QQD+ E L  +LD LH++L+   
Sbjct: 353 ALVKSLFDDKASALQAFSPRAFKSIIGHHNGMFAGFLQQDSQELLAFLLDGLHEDLNRIM 412

Query: 807 DAVVNEYPDLILYDE-KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCG 865
                E P+L   D+   ++V        ++K  + N  S I D+F G  +++L C  C 
Sbjct: 413 KKPFVEKPELASSDDVNDIDVIRNLASLTWEKHKLRNE-SVIVDLFVGLYKSTLTCPACD 471

Query: 866 HSSFNYSTFYVLSLAIP 882
             S  +  F  L+L +P
Sbjct: 472 RVSVTFDPFSDLTLPLP 488

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 55/129 (42%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLI-LN-----IVLKSNEVVKYKLY 1091
            K +     P  L IHL RF   +  + K S +V +P+  L+     +    N+   Y L 
Sbjct: 906  KQIQLWNTPDILTIHLKRFENRHSFSDKISDVVDFPITGLDMSEHLVCHDPNQNSMYDLI 965

Query: 1092 GVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
             V NH G L  GHYT+ V   +D         WYYFDD  V  ET          +  S 
Sbjct: 966  AVDNHYGGLGGGHYTAYVKNFMDGK-------WYYFDDSRVS-ETE-------AERAISG 1010

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1011 AAYLLFYRR 1019

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 19/27 (70%)

Query: 895 VSLEECLNMYTSDEVLSGENAWDCPNC 921
           +SL +CL +++  EVL   ++W CPNC
Sbjct: 872 ISLTDCLELFSKSEVLGAADSWYCPNC 898

>Ecym_8140 Chr8 complement(295730..299524) [3795 bp, 1264 aa] {ON}
           similar to Ashbya gossypii AFR627C
          Length = 1264

 Score = 66.6 bits (161), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 94/198 (47%), Gaps = 15/198 (7%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGNTCY+NS +QCL     F++ F+   Y++ +    P     G +  I+  F  L
Sbjct: 350 GLGNLGNTCYMNSALQCLVHIPEFKDYFLYNAYEKEINVDNPL----GHKGHIAWAFGTL 405

Query: 752 FKKMYL---NGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN-QD 807
            + ++    N   S  P  F  +   L   F     QQD+ EFL  +LD LH++L+   D
Sbjct: 406 IQSLFGKRNNLISSYSPRHFKTTIGHLNSMFA-GYQQQDSQEFLAFLLDGLHEDLNRIVD 464

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL---SPIDDIFQGQMENSLHCQRC 864
               E P+L   D+     + +  KK  D + + + L   S I D+F G  +++L C  C
Sbjct: 465 KPYVEKPELNPTDDV---TEFETIKKLADDTWLKHKLRNDSVILDLFVGLYKSTLICPTC 521

Query: 865 GHSSFNYSTFYVLSLAIP 882
              S  +  +  L+L +P
Sbjct: 522 KKVSTTFDPYNDLTLPLP 539

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 53/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K   IV +P I ++ +    V K       Y L
Sbjct: 971  KQIELWNTPDILLIHLKRFENQRSFSDKIGDIVHFP-ITDLDMSPYLVYKDDKKGTIYDL 1029

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
              V NH G L  GHYT+ V   LD+        WYYFDD  V        +        +
Sbjct: 1030 IAVDNHYGGLGGGHYTAYVKNFLDNK-------WYYFDDSRVNETVPERSI--------A 1074

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1075 GSAYLLFYRR 1084

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 22/29 (75%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           K+++L +CL ++++ EVL   ++W CP+C
Sbjct: 935 KKITLHDCLTLFSTPEVLGATDSWYCPSC 963

>KLLA0C03476g Chr3 (314815..318573) [3759 bp, 1252 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1252

 Score = 66.2 bits (160), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/201 (28%), Positives = 84/201 (41%), Gaps = 17/201 (8%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           I GL NLGNTCY+NS +QCL         F+   Y+  +    P               Y
Sbjct: 338 IMGLSNLGNTCYMNSALQCLLHIPELNEYFLYKGYEREININNPLGHKGDVAHAFGHLLY 397

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN--QD 807
            LF   Y        P +F  +       F     QQD+ EFL  +LD LH++L+   + 
Sbjct: 398 SLFAPSY-GQSTFYAPRNFKNTIGHYNSLFA-GYGQQDSQEFLAFLLDGLHEDLNRVIEK 455

Query: 808 AVVN--EYPDLILYDEKK----LNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
             VN  E+P+    D+      L     +Y K  + SVI        D+F G  +++L C
Sbjct: 456 PYVNKPEFPNDGQIDDTDQIVLLAANMWDYIKKRNDSVIM-------DLFVGLYKSTLVC 508

Query: 862 QRCGHSSFNYSTFYVLSLAIP 882
             C H S  +  +  L+L +P
Sbjct: 509 PNCNHVSITFDPYNDLTLPLP 529

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 877 LSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKGM 931
           LSL+  + T +   +S  ++L+ CL +++  E+L   ++W CPNC + T+  K +
Sbjct: 885 LSLSEVRKTRAQTEKSS-ITLDSCLRLFSQPEILGSADSWYCPNCKQHTQASKQI 938

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 51/129 (39%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYP---LILNIVL---KSNEVVKYKLY 1091
            K +     P  L+IHL RF      + K    V +P   L ++  L   K  E   Y L 
Sbjct: 936  KQIELWNTPDILLIHLKRFENQRSFSDKIDATVKFPIEGLDMSPYLSYKKEGENDVYDLI 995

Query: 1092 GVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
             V NH G L  GHYT+     +D         WYYFDD  V   +    +        + 
Sbjct: 996  AVDNHYGGLGGGHYTAYCRNFID-------GKWYYFDDSRVNEVSPENSI--------AG 1040

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1041 SAYLLFYRR 1049

>KAFR0F01560 Chr6 (310936..314451) [3516 bp, 1171 aa] {ON} Anc_1.137
           YJL197W
          Length = 1171

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/214 (27%), Positives = 93/214 (43%), Gaps = 20/214 (9%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGNTCY+NS +QCL      R+ F+   Y+  L          G +  +++ F  L
Sbjct: 324 GLSNLGNTCYMNSALQCLVHIPQLRDYFLYSAYEAELN----TDNLIGYKGYVAKAFSSL 379

Query: 752 FKKMYLN------GGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
            + ++ +         S  P  F  +       F     QQD+ EFL  +LD LH++L  
Sbjct: 380 VQNLFGDTITKQGTNSSFGPNHFKSTVGHFNSMFS-GYLQQDSQEFLAFLLDSLHEDL-- 436

Query: 806 QDAVVN----EYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
            + ++N    E P L   D+       K       K  +    S I D+F G  +++L C
Sbjct: 437 -NRIINKPSTEKPSLKEGDDYNDPAVIKSLADETWKMHLLRNDSVITDLFVGMYKSTLEC 495

Query: 862 QRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRV 895
             C + S  +  +  L+L +P    ST+S   R+
Sbjct: 496 PECTNVSITFDPYSDLTLPLP--VDSTWSSKVRI 527

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 53/130 (40%), Gaps = 25/130 (19%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYPLILNIVLKSNEVVK-------YKL 1090
            K +     P  L+IHL RF      + K    V +P I N+ +    V K       Y L
Sbjct: 906  KRIQLWNTPDVLLIHLKRFENQRSFSDKIDATVNFP-IENLDMSPYLVHKDDPRGTVYDL 964

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
            Y V NH G L  GHYT+ V   +D+        WYYFDD  V        V        S
Sbjct: 965  YAVDNHYGGLGGGHYTAYVKNFIDNK-------WYYFDDSRVYETDPEKSV--------S 1009

Query: 1151 SDVYVLFYER 1160
               Y+LFY R
Sbjct: 1010 GSAYLLFYLR 1019

 Score = 37.4 bits (85), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 21/29 (72%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           K ++L +CLN+++  EVL   ++W CP+C
Sbjct: 870 KEITLNDCLNLFSKREVLGLNDSWYCPHC 898

>NCAS0E02610 Chr5 complement(520877..523030) [2154 bp, 717 aa] {ON}
            Anc_7.390
          Length = 717

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 64/123 (52%), Gaps = 15/123 (12%)

Query: 1046 RMPRTLIIHLSRFYYDLTK----KNSTIVTYPLIL--NIVLKSNEVVKYKLYGVVNHTGN 1099
            ++P TLI+HL RF Y   +    K  + V YPLIL  N   K  + +KY+L G+V H G+
Sbjct: 517  KLPDTLILHLKRFKYSEQQLSNIKLFSKVYYPLILEVNSNYKCTDTIKYELSGIVIHVGD 576

Query: 1100 LIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
                GHY ++   +          GW ++DDE V+  +    +K    + + S  YVLFY
Sbjct: 577  GPQMGHYVALCKTE--------KYGWLFYDDETVESVSEETVLKFIGDEKTQSTAYVLFY 628

Query: 1159 ERI 1161
            +++
Sbjct: 629  KKL 631

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/78 (25%), Positives = 36/78 (46%), Gaps = 8/78 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I++IFQG + N + C  C + +     F  L + + +   +   R         L  Y+ 
Sbjct: 437 INEIFQGTLTNKVRCLTCDNVTSREEAFLDLPIEVKENGDTDIQR--------VLKYYSQ 488

Query: 907 DEVLSGENAWDCPNCCKI 924
            E+L+G N ++C  CC +
Sbjct: 489 REMLNGSNKFNCSQCCAL 506

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 42/95 (44%), Gaps = 11/95 (11%)

Query: 628 PFQSNLNFVTGQILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTI------EQN 681
           P  ++  F   ++L  + D     A    I + PF +   G  E  + P +      EQ 
Sbjct: 62  PTDASSTFQVKEVLGTNTD-----AEYSAISKNPFITNEVGEDEVLNFPILFANTINEQL 116

Query: 682 PNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFR 716
           P    S  + G  N GNTCY NS++QCL+    FR
Sbjct: 117 PFGDGSNKVFGYENFGNTCYCNSVLQCLYNLPEFR 151

>TBLA0J00600 Chr10 (129182..133570) [4389 bp, 1462 aa] {ON}
           Anc_1.137 YJL197W
          Length = 1462

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 94/220 (42%), Gaps = 34/220 (15%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           S    GL NLGNTCY+NS +QCL     F   F+   Y++ +    P            +
Sbjct: 410 STGTLGLVNLGNTCYMNSALQCLIHLPKFNEYFLLNGYQKEINLDNPIGYQGNVANAFGK 469

Query: 747 TFYILFKKMYLNGGC--------SVVPISFLKS---CSLLRPDFKIPDDQQDTTEFLMLI 795
             + LF++  ++           S  P +F  +   C+ +   +     QQD+ EFL  I
Sbjct: 470 LIHKLFEERIIDNESEKSSFSINSFSPTNFKSTVGYCNSMFSGYL----QQDSQEFLAFI 525

Query: 796 LDRLHDELSN--QDAVVNEYPDLILYDEKKLNVQNKEYK--------KWFDKSVIGNGLS 845
           LD LH++L+   +   V E P L        N   K+YK         W  ++ +    S
Sbjct: 526 LDGLHEDLNRILKKPFV-EKPSL------PENSNYKDYKVIKKLADDTW--EAHLKRNDS 576

Query: 846 PIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKAT 885
            + D+F G  +++L C  C + S  +  +  L+L +P  T
Sbjct: 577 IVTDLFVGMYKSTLQCPDCHNVSVTFDPYNDLTLPLPVET 616

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/129 (32%), Positives = 53/129 (41%), Gaps = 23/129 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRF--YYDLTKKNSTIVTYP-----LILNIVLKSNEVVK-YKLY 1091
            K +     P  L+IHL RF      + K   +V +P     L  +IV    E    Y L 
Sbjct: 1104 KQIELWNTPDILLIHLKRFENQRSFSDKIDAVVNFPITDLDLTPHIVCTDQEKSNIYDLI 1163

Query: 1092 GVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
             V NH G L  GHYT+ V   +D         WYYFDD  V       D +  +    S 
Sbjct: 1164 AVDNHYGGLGGGHYTAYVKNFVDQK-------WYYFDDSRVSL----ADPQRSI----SG 1208

Query: 1152 DVYVLFYER 1160
              Y+LFY R
Sbjct: 1209 SAYLLFYVR 1217

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 12/39 (30%), Positives = 23/39 (58%)

Query: 883  KATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
            K     F + K + L++CL +++  E+L  +++W CP C
Sbjct: 1058 KREEQIFEKEKTILLDDCLRLFSKPEILGLQDSWYCPTC 1096

>Kpol_513.25 s513 (71125..74697) [3573 bp, 1190 aa] {ON}
           (71125..74697) [3573 nt, 1191 aa]
          Length = 1190

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 59/245 (24%), Positives = 93/245 (37%), Gaps = 67/245 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISRT 747
            G RN G TCY+NS++Q  F TK FR L   +          P  G N +  V   + R 
Sbjct: 204 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYGI----------PTNGENPNDSVPLALQRA 253

Query: 748 FYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQD 807
           FY L          S  P+  L+       D      Q D  E   +++DRL + +    
Sbjct: 254 FYQL--------QVSKFPLDTLELTRSFGWDTADAFTQHDVQELNRILMDRLENRM---- 301

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
                         K  NV+ K                 +++IF G+M++ + C+   + 
Sbjct: 302 --------------KGTNVEGK-----------------LNEIFVGKMKSYIRCKNVDYE 330

Query: 868 SFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKD 927
           S     F+ + L +              SL+E    Y   E+++GEN +  P+   +   
Sbjct: 331 SSRVEDFWDIQLNVKNFK----------SLQESFENYIEVELMNGENQYAAPDFG-LQDA 379

Query: 928 YKGMV 932
           YKG+V
Sbjct: 380 YKGVV 384

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 50/105 (47%), Gaps = 19/105 (18%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKNS------TIVTYPLILNIVLKSNEVVK- 1087
            K + F   P  L + L RF YD     L K N        I   P +   +LK     K 
Sbjct: 381  KGVVFESFPAVLHLQLKRFEYDFNYDQLIKVNDRYEFPDKIDLAPYMDKELLKKTPGPKN 440

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            YKL+GV+ HTG++ +GHY +++   L+       D WY FDDE V
Sbjct: 441  YKLHGVLVHTGDISTGHYYAMIKPTLE-------DQWYRFDDEKV 478

>Smik_2.49 Chr2 complement(87575..89812) [2238 bp, 745 aa] {ON}
            YBL067C (REAL)
          Length = 745

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 42/124 (33%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P TL +HL RF Y   K+N  I     + YPL LN+    N  V  KY+L G+V H G
Sbjct: 554  QLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSEVCQKYELAGIVVHMG 612

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+   Q          GW  FDDE V+       ++      + +  YVLF
Sbjct: 613  GGPQHGHYVSLCKHQ--------KFGWLLFDDETVEAVKEETVLEFTGESANMATAYVLF 664

Query: 1158 YERI 1161
            Y+ +
Sbjct: 665  YKAV 668

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
           + G  N GNTCY NS++QCL+     R   +    K        K    G++P I
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSPLRENILQFPEKPIESGHPRKNEMRGNRPRI 193

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/140 (18%), Positives = 52/140 (37%), Gaps = 27/140 (19%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EF   +L+ L + + +++                   Q K   K  +   +    
Sbjct: 431 HQDAHEFFNFLLNELSEYIEHEN-------------------QKKATSKIKNNGFLNTST 471

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
           + I+D+F+G + N + C  C + +     F    + +           +   ++  L  Y
Sbjct: 472 NFINDLFKGTLTNQIKCLTCDNVTSRDEPFLDFPIEV--------KGEEETDIQAILKSY 523

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+L+G N + C  CC +
Sbjct: 524 HQREMLNGSNKFYCDECCGL 543

>KNAG0C03580 Chr3 complement(699604..701934) [2331 bp, 776 aa] {ON}
            Anc_7.390 YBL067C
          Length = 776

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 66/138 (47%), Gaps = 22/138 (15%)

Query: 1032 KSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNI--VLKSNE 1084
            ++++L  +K+L     P+TL +HL RF Y   +KN+ +     + YPLILN      S+ 
Sbjct: 554  EAERLVGLKSL-----PKTLSLHLKRFKYS-EEKNANVKLFNKIHYPLILNASSTFDSSV 607

Query: 1085 VVKYKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKH 1143
               Y+L GVV H GN    GHY S+   +L         GW  FDDE V+       +  
Sbjct: 608  SKSYRLQGVVVHMGNGPHHGHYVSLCHTEL--------FGWLLFDDETVESVDESYVLDF 659

Query: 1144 GVMKISSSDVYVLFYERI 1161
                 S +  YVLFY  I
Sbjct: 660  VGSHESPTTAYVLFYSEI 677

 Score = 38.9 bits (89), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+    FR
Sbjct: 160 VFGYENFGNTCYCNSVLQCLYHLPEFR 186

>KNAG0B02370 Chr2 complement(463599..465860) [2262 bp, 753 aa] {ON}
            Anc_7.390 YBL067C
          Length = 753

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 74/165 (44%), Gaps = 27/165 (16%)

Query: 1013 DAQRDIDE-LREMKEEMKQWKSKKLF---------TIKTLNFIRMPRTLIIHLSRFYYDL 1062
            DA  DI E LRE  +      + K +           + +   ++PR L +HL RF Y  
Sbjct: 504  DAATDIQEQLREFCQTELLHGANKFYCNECCGLQEAQRVVGLKKLPRILALHLKRFKYS- 562

Query: 1063 TKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTGNLIS-GHYTSIVDKQLD 1114
              +N+ I     +TYPL L +  K +  V  KY+L GVV H G     GHY S+      
Sbjct: 563  EAQNTNIKLFNKITYPLFLEVASKFDPSVSKKYELTGVVLHMGGGPQHGHYVSVC----- 617

Query: 1115 HSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYE 1159
                ++  GW +FDDE V+       +       +S+  YVLFY+
Sbjct: 618  ---KTDNFGWLFFDDETVETLDEPQVLNFTGDTTTSTTAYVLFYK 659

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 24/44 (54%), Gaps = 7/44 (15%)

Query: 681 NPNIYVSL-------SITGLRNLGNTCYINSMIQCLFATKSFRN 717
           NP + V +        I G  N GNTCY NS++QCLF    FRN
Sbjct: 97  NPKVAVGMPFGDGSNKIFGYENFGNTCYCNSILQCLFNLTEFRN 140

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/78 (23%), Positives = 33/78 (42%), Gaps = 6/78 (7%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I+D+FQG   + + C  C   + +   F    + +        S+     ++E L  +  
Sbjct: 465 INDLFQGTQTSKVRCLTCDSVTSHDERFLDFPIELED------SKDAATDIQEQLREFCQ 518

Query: 907 DEVLSGENAWDCPNCCKI 924
            E+L G N + C  CC +
Sbjct: 519 TELLHGANKFYCNECCGL 536

>Skud_2.38 Chr2 complement(77293..79539) [2247 bp, 748 aa] {ON}
            YBL067C (REAL)
          Length = 748

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/122 (33%), Positives = 58/122 (47%), Gaps = 17/122 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P TL +HL RF Y   K+N  I     + YPL LN+    N  V  KY+L G+V H G
Sbjct: 556  QLPDTLALHLKRFKYS-EKQNCNIKLFNDIHYPLTLNVCSSINSEVCQKYELSGIVVHMG 614

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+   ++         GW  FDDE V+       ++      + +  YVLF
Sbjct: 615  GGPQHGHYVSLCKHEI--------FGWLLFDDETVEAVKEEAVLEFTGESPNMATAYVLF 666

Query: 1158 YE 1159
            Y+
Sbjct: 667  YK 668

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+   S R
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSVR 166

>ZYRO0B03300g Chr2 (273903..276344) [2442 bp, 813 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 813

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 63/130 (48%), Gaps = 17/130 (13%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLK-SNEVV-KYKLYG 1092
            +++   ++P TL +HL RF Y  T KNS I     V YPL L++    SN V  KY+L G
Sbjct: 604  RSVGLKQLPHTLALHLKRFKYSET-KNSNIKLFNKVHYPLTLDVCSTYSNSVCKKYELSG 662

Query: 1093 VVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
            +V H G     GHY S+          ++  GW  FDDE V+  +    +       + +
Sbjct: 663  IVVHMGGGPQHGHYVSLCK--------NDNFGWLLFDDETVESVSEKTVLDFVGDSSTLT 714

Query: 1152 DVYVLFYERI 1161
              YVLFY  +
Sbjct: 715  TAYVLFYREL 724

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+    FR
Sbjct: 130 VFGFENFGNTCYCNSVLQCLYNMTEFR 156

 Score = 38.9 bits (89), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 52/140 (37%), Gaps = 34/140 (24%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EFL  +L+ L D L+N                 K    ++E+   F         
Sbjct: 494 HQDAHEFLNFLLNELSDYLNNG---------------AKSGKDDEEHSLNF--------- 529

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
             I DIFQG + N + C  C + +     F    + +P  +           ++  L  +
Sbjct: 530 --IKDIFQGTLTNRVKCFTCDNITSRDEPFLDFPIEVPDDS--------ETDIQALLQNF 579

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+LSG N + C  CC +
Sbjct: 580 DQREMLSGPNKFYCNVCCGL 599

>CAGL0A04477g Chr1 (442089..444401) [2313 bp, 770 aa] {ON} similar to
            uniprot|P38187 Saccharomyces cerevisiae YBL067c UBP13 or
            uniprot|P39967 Saccharomyces cerevisiae YER098w UBP9
            ubiquitin carboxyl-terminal hydrolase
          Length = 770

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 63/128 (49%), Gaps = 17/128 (13%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYG 1092
            + +   ++P+TL +HL RF Y   ++NS I     V+YPL L +    N  +   Y+L G
Sbjct: 559  RVVGLKQLPKTLALHLKRFKYS-EQQNSNIKLFDKVSYPLDLKVSSTFNPSISKNYELSG 617

Query: 1093 VVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
            +V H G     GHY S+   +          GW  FDDE V+  +    +++   K + +
Sbjct: 618  IVVHMGGGPQHGHYISLCKNE--------KFGWLLFDDETVEAISEQAVLQYTGDKDTMT 669

Query: 1152 DVYVLFYE 1159
              YVLFY+
Sbjct: 670  TAYVLFYQ 677

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 56/140 (40%), Gaps = 23/140 (16%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EFL+ +L+ + D L  Q+               K  + +K Y     +   G   
Sbjct: 438 HQDAHEFLIFLLNEISDFLDKQN---------------KNALNSKIYDSSQGRRNSGTVK 482

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
           + + DIFQG + N + C  C +++     F    + + +           + ++E L  +
Sbjct: 483 NFVSDIFQGTLTNRIKCLTCDNTTARDEPFLDFPIEVQENVD--------IDIQEILESF 534

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+L G N + C  CC +
Sbjct: 535 HQKEMLHGPNKFYCDECCGL 554

 Score = 41.2 bits (95), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 19/28 (67%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRN 717
           I G  N GNTCY NS++QCL+    FRN
Sbjct: 149 IFGYENFGNTCYCNSVLQCLYNLPEFRN 176

>Suva_2.50 Chr2 complement(90700..92952) [2253 bp, 750 aa] {ON}
            YBL067C (REAL)
          Length = 750

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P TL +HL RF Y   K+N  I     + YPL LN+    N  V  KY+L G+V H G
Sbjct: 557  QLPDTLALHLKRFKYS-EKQNCNIKLFNNIRYPLTLNVCSSINSEVCQKYQLAGIVVHMG 615

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+   +          GW  FDDE V+       ++      + +  YVLF
Sbjct: 616  GGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLF 667

Query: 1158 YERI 1161
            Y+ +
Sbjct: 668  YKAM 671

 Score = 40.4 bits (93), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
           + G  N GNTCY NS++QCL+   S R   +    K      + K    G++P I
Sbjct: 140 VFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPEKPIESNQSRKHDMKGNKPRI 194

 Score = 32.7 bits (73), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/78 (21%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I+++FQG + N + C  C + +     F    + +           +   ++  L  Y  
Sbjct: 477 INNLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEV--------QGDEETDIQAILKSYHQ 528

Query: 907 DEVLSGENAWDCPNCCKI 924
            E+L+G N + C  CC +
Sbjct: 529 REMLNGSNKFYCDECCGL 546

>TPHA0E00870 Chr5 complement(174245..176392) [2148 bp, 715 aa] {ON}
            Anc_7.390 YBL067C
          Length = 715

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 58/122 (47%), Gaps = 17/122 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P TLI+HL RF Y   ++NS I     + YPL+L +   SN  +   Y L G+V H G
Sbjct: 519  KLPETLILHLKRFKYS-EEQNSNIKLFNKINYPLVLQVSSTSNSDISKSYDLTGIVLHLG 577

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY SI   +          GW  FDDEVV   T    +K      + +  Y+L 
Sbjct: 578  GGPQHGHYVSICKNE--------KYGWLLFDDEVVVSITEESVLKFVGDPTTLTTAYLLV 629

Query: 1158 YE 1159
            Y+
Sbjct: 630  YK 631

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 19/31 (61%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFI 720
           + G  N GNTCY NS++QCL+     R+  I
Sbjct: 111 VFGYENFGNTCYCNSVLQCLYNIPELRDNVI 141

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 19/76 (25%), Positives = 39/76 (51%), Gaps = 9/76 (11%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I+D+FQG ++ +  C  C + +     F   ++ +        S ++  +++E L  Y+ 
Sbjct: 439 INDLFQGVIKYTTRCLTCDNITSREELFLDFAIEV--------SNNEETNIQEILGDYSQ 490

Query: 907 DEVLSGENAWDCPNCC 922
            E+L+G N + C +CC
Sbjct: 491 REMLNGSNKFFC-DCC 505

>NCAS0A14370 Chr1 (2830136..2832325) [2190 bp, 729 aa] {ON} Anc_7.390
          Length = 729

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIV--LKSNEVVKYKLYGVVNHTG 1098
            ++P TL +HL RF Y   ++N+ I     V YPL L++     S+   KY+L GVV H G
Sbjct: 540  QLPHTLALHLKRFKYS-EEQNTNIKLFNKVQYPLKLDVASTFDSSIAKKYELTGVVIHMG 598

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+          ++  GW  FDDE V+  T    ++      + +  YVLF
Sbjct: 599  GSPQHGHYVSLC--------KNDKFGWLLFDDETVESVTEKTVLEFTGDSSNQATAYVLF 650

Query: 1158 YERI 1161
            Y+ +
Sbjct: 651  YKEL 654

 Score = 40.0 bits (92), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 55/140 (39%), Gaps = 32/140 (22%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
           QQD  EFL  +L+ L + L N  +  +  P  I +         K Y             
Sbjct: 422 QQDAHEFLNFLLNELSEYLQNHISHPSNKPTDIPF---------KNY------------- 459

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
             + D+FQG + N + C  C + +     F    + +           + + +++ L  Y
Sbjct: 460 --VIDLFQGVLTNRIKCLTCDNITSRDEPFLDFPIGV--------KGDENIDIQDVLRCY 509

Query: 905 TSDEVLSGENAWDCPNCCKI 924
            + E+L+G N + C  CC +
Sbjct: 510 HTREMLNGSNKFYCSQCCGL 529

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 37/79 (46%), Gaps = 15/79 (18%)

Query: 653 PTKRIQQEPFRSATNGLHETYSI---PTIE-QNPNIYVSLS-----------ITGLRNLG 697
           PT+++Q        N  H   SI   P +E ++P ++  ++           + G  N G
Sbjct: 84  PTRKVQPLMQELHANDPHNRSSIISDPIVEMESPILFTPMNQLLPYGDGSNKVFGYENFG 143

Query: 698 NTCYINSMIQCLFATKSFR 716
           NTCY NS++QCL+     R
Sbjct: 144 NTCYCNSVLQCLYNLTELR 162

>YBL067C Chr2 complement(93639..95882) [2244 bp, 747 aa] {ON}
            UBP13Putative ubiquitin carboxyl-terminal hydrolase,
            ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 747

 Score = 55.8 bits (133), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P TL +HL RF Y   K+N  I     + YPL LN+    N  V  KY+L G+V H G
Sbjct: 554  QLPDTLTLHLKRFKYS-EKQNCNIKLFNNIHYPLTLNVCSSINSKVCQKYELAGIVVHMG 612

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+   +          GW  FDDE V+       ++      + +  YVLF
Sbjct: 613  GGPQHGHYVSLCKHE--------KFGWLLFDDETVEAVKEETVLEFTGESPNMATAYVLF 664

Query: 1158 YERI 1161
            Y+ +
Sbjct: 665  YKAM 668

 Score = 39.7 bits (91), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
           + G  N GNTCY NS++QCL+   S R   +    K    +   K    G +P I
Sbjct: 139 VFGYENFGNTCYCNSVLQCLYNLSSLRENILQFPKKSRESDQPRKKEMRGKKPRI 193

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 33/78 (42%), Gaps = 8/78 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I D+FQG + N + C  C + +     F    + +           +   ++E L  Y  
Sbjct: 474 ISDLFQGTLTNQIKCLTCDNITSRDEPFLDFPIEV--------QGDEETDIQEILKSYHQ 525

Query: 907 DEVLSGENAWDCPNCCKI 924
            E+L+G N + C  CC +
Sbjct: 526 REMLNGSNKFYCDECCGL 543

>KLTH0B07150g Chr2 complement(574195..576465) [2271 bp, 756 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 756

 Score = 55.5 bits (132), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/112 (35%), Positives = 56/112 (50%), Gaps = 17/112 (15%)

Query: 1032 KSKKLFTIKTLNFI-RMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIV-----LKSN 1083
            K  K       NFI R P TL++HL +F ++ T   K    V+YP+ L++       K+ 
Sbjct: 584  KCHKTTNASKHNFILRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDVTEFCENSKTT 643

Query: 1084 EVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKR 1134
              VKY+L  VV H G +L SGHY +   KQ D S       W  +DDE + +
Sbjct: 644  LPVKYQLISVVVHEGRSLTSGHYIAHC-KQPDGS-------WSTYDDEYINK 687

>CAGL0I05522g Chr9 complement(521749..523923) [2175 bp, 724 aa] {ON}
            some similarities with uniprot|P39967 Saccharomyces
            cerevisiae YER098w UBP9 or uniprot|P38187 Saccharomyces
            cerevisiae YBL067c UBP13
          Length = 724

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIV-LKSNEVVK-YKLYGVVN 1095
            KT+ F ++P+TL +HL RF  D  +  K    + YPL L +     N + K Y+L GVV 
Sbjct: 531  KTVGFEKLPKTLALHLKRFKCDGIVNSKLFNKIEYPLTLTVCSCFDNSLCKTYELTGVVL 590

Query: 1096 HTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVY 1154
            H G +   GHY SI   +          GW  +DDE ++         H     +    Y
Sbjct: 591  HVGASPTHGHYVSICKHE--------KYGWLMYDDETIESIPEEAVTSHVGEPNNPITAY 642

Query: 1155 VLFY 1158
            VLFY
Sbjct: 643  VLFY 646

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N G+TCY NS++QC++    FR
Sbjct: 120 VFGYENFGHTCYCNSVLQCIYNLPEFR 146

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/169 (23%), Positives = 62/169 (36%), Gaps = 32/169 (18%)

Query: 756 YLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVNEYPD 815
           YL+G   V P  F+K      P F     QQD  EFL  +L+ + D          +Y  
Sbjct: 390 YLSG--VVSPAEFVKLLKRQNPLFN-STMQQDAHEFLNFLLNNISD-------FAGKYKS 439

Query: 816 LILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFY 875
             L   K  N +  E    F           + D F+G + N + C  C   S N   F 
Sbjct: 440 NYL---KSSNEEECEISHDF-----------VKDQFEGVLLNRIKCLTCDCVSANEEPFL 485

Query: 876 VLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKI 924
              + I           + +++++    +   E+L G N + C  CC +
Sbjct: 486 DFPIEI--------QNDEAINIQDTFRSFYQREILCGPNKFYCNECCGL 526

>KLLA0D08459g Chr4 complement(718046..720298) [2253 bp, 750 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 750

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 68/139 (48%), Gaps = 24/139 (17%)

Query: 1032 KSKKLF-TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVLKSNEV--- 1085
            K KK+   +K+   IR P TL++HL +F ++ T   K    V+YP+ L++    +E    
Sbjct: 575  KCKKVTNALKSNKIIRAPETLVVHLKKFRFNGTSSSKMKQAVSYPMFLDLTEYCHESISS 634

Query: 1086 --VKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVK 1142
              V+Y+L  VV H G +L SGHY +   KQ D S       W  +DDE + + +    +K
Sbjct: 635  LPVRYQLISVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDDEYINKISEKQLLK 686

Query: 1143 HGVMKISSSDVYVLFYERI 1161
                     + Y L Y R+
Sbjct: 687  E-------PNAYFLVYTRL 698

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 50/266 (18%), Positives = 97/266 (36%), Gaps = 70/266 (26%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N G TCY N+ +Q +    + ++    +    F   V     +N    +++ T   +
Sbjct: 363 GLLNHGVTCYTNAAVQAMVHIPAIQHYLFQLLRGNFKDTVK----SNCVSMLLAETTMRM 418

Query: 752 F-----KKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
           +     K  Y+N       I+ L+  + +   +    +Q+D+ E+ M ++ RL ++   +
Sbjct: 419 WSSDSTKNTYINPD---KLINALEDINCMMSAW----NQEDSHEYFMSLMSRLQEDSVPK 471

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
              + E    I+YD                             +F G ++ S+ C  CG 
Sbjct: 472 GHKMTES---IIYD-----------------------------VFGGLLQQSVKCSNCGE 499

Query: 867 SSFNYSTFYVLSL-------------------AIPKATSSTFSRSKRVSLEECLNMYTSD 907
            S      Y LSL                   +I  +     S  +R S+E+ +  + + 
Sbjct: 500 ISTTEQPIYDLSLHLKGRKTTDQDQNSVGQDNSIDNSVDQQQSSKRRFSIEKSIRDFFNP 559

Query: 908 EVLS---GENAWDCPNCCKITKDYKG 930
           E++     +  + C  C K+T   K 
Sbjct: 560 ELIKRVDNKEGYTCEKCKKVTNALKS 585

>TDEL0A01100 Chr1 (186399..188384) [1986 bp, 661 aa] {ON} Anc_2.69
            YNL186W
          Length = 661

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/156 (30%), Positives = 73/156 (46%), Gaps = 29/156 (18%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL  + +E K +  +K       +K  + IR P TL+ HL +F ++ T   K    V+YP
Sbjct: 468  ELIRVDKEQKGYVCEKCHQTTNAVKRSSIIRAPETLLTHLKKFRFNGTASSKMKQAVSYP 527

Query: 1074 LILNIV--LKSNEV-----VKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWY 1125
            + L++    +SNE      VKY+L  VV H G +L SGHY       + H    +G  W 
Sbjct: 528  MFLDLTEYCESNEKDHVVPVKYQLTTVVVHEGRSLSSGHY-------IVHCKQPDG-TWA 579

Query: 1126 YFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             +DDE + + T    +K         + Y L Y R+
Sbjct: 580  TYDDEYINKITERDVLKE-------PNAYYLLYTRL 608

>ABL145W Chr2 (124839..127088) [2250 bp, 749 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YNL186W (UBP10)
          Length = 749

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 61/132 (46%), Gaps = 23/132 (17%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVLKSNEV-----VKYKL 1090
             IK    +R P TL++HL +F ++ T   K    V+YPL +++     E      VKY+L
Sbjct: 581  AIKRNMILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPLFMDLTEYCVEAAKCLPVKYQL 640

Query: 1091 YGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKIS 1149
              VV H G +L SGHY       + H    +G  W  +DDE + + T    +K       
Sbjct: 641  ISVVVHEGRSLSSGHY-------IAHCKQPDGT-WATYDDEYINKITERNVLKE------ 686

Query: 1150 SSDVYVLFYERI 1161
              + Y L Y R+
Sbjct: 687  -VNAYYLVYTRL 697

>YNL186W Chr14 (289498..291876) [2379 bp, 792 aa] {ON}
            UBP10Ubiquitin-specific protease that deubiquitinates
            ubiquitin-protein moieties; may regulate silencing by
            acting on Sir4p; involved in posttranscriptionally
            regulating Gap1p and possibly other transporters;
            primarily located in the nucleus
          Length = 792

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (53%), Gaps = 18/123 (14%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL ++ +E K +  +K       +K  + +R P TL++HL +F ++ T   K    V+YP
Sbjct: 597  ELIKVDKEQKGYVCEKCHKTTNAVKHSSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP 656

Query: 1074 LILNIV--LKSNEV-VKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDD 1129
            + L++    +S E+ VKY+L  VV H G +L SGHY +   KQ D S       W  +DD
Sbjct: 657  MFLDLTEYCESKELPVKYQLLSVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDD 708

Query: 1130 EVV 1132
            E +
Sbjct: 709  EYI 711

>CAGL0H10186g Chr8 complement(993354..995690) [2337 bp, 778 aa] {ON}
           similar to uniprot|P38237 Saccharomyces cerevisiae
           YBR058c UBP14 ubiquitin specific protease
          Length = 778

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 63/241 (26%), Positives = 88/241 (36%), Gaps = 56/241 (23%)

Query: 691 TGLRNLGNTCYINSMIQCLF--ATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTF 748
            GL NLGN+CY+NS +QCLF    K +    +       L  V P      SQ    RT 
Sbjct: 331 CGLINLGNSCYLNSTLQCLFNGGVKGWDTDMLGNSPS--LNVVYPANNLK-SQLTKLRTA 387

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDA 808
                 +Y  G   + P SF K       +F     QQD  EF    +D L         
Sbjct: 388 LKEEPTIYKQG---IRPKSFKKCIGGSHEEFS-SGRQQDALEFFTYFVDEL--------- 434

Query: 809 VVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSS 868
                                      DK +  N     +D+ +  ME+ L CQ C    
Sbjct: 435 ---------------------------DKKLFKNSDYNPNDLMKFMMEDRLQCQECHGVK 467

Query: 869 FNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDY 928
           ++  T  V+ L + ++  +         LEE +N Y S EV+     + CPNC K+    
Sbjct: 468 YSTETSNVIQLPLQESNDAQ-------DLEERINAYFSGEVIE----FKCPNCKKMVNAV 516

Query: 929 K 929
           K
Sbjct: 517 K 517

>Ecym_4685 Chr4 complement(1332993..1335329) [2337 bp, 778 aa] {ON}
            similar to Ashbya gossypii AGR370W
          Length = 778

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 17/130 (13%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYG 1092
            +T+   ++P+ L +HL RF Y   K  S I     + YPL L +  KS+ +V   Y+L G
Sbjct: 583  RTVGLKQLPKILSLHLKRFKYS-EKHQSNIKLFNKIYYPLKLKVCTKSDTIVCKNYELNG 641

Query: 1093 VVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSS 1151
            +V H G     GHY +I    +         GW  +DDE V+        K    +   +
Sbjct: 642  IVIHMGGGPQHGHYVAICKHDM--------FGWLLYDDETVESIDEETVFKFVGDEKDMT 693

Query: 1152 DVYVLFYERI 1161
              YVLF++ +
Sbjct: 694  TAYVLFFKEV 703

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 40/91 (43%), Gaps = 6/91 (6%)

Query: 659 QEPFRSATNGLHETYSIPTI-----EQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATK 713
           Q+    A + LHE +  P +     E  P    S  + GL N GNTCY NS++QCLF   
Sbjct: 97  QQFLGDAKDTLHELF-FPGLVTRESEHLPCGDGSTKVFGLENFGNTCYCNSVLQCLFNLS 155

Query: 714 SFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
             R   +    ++      PK    G +P +
Sbjct: 156 ELRTNILMYPIRKDPASRKPKLDVVGLKPRV 186

 Score = 37.0 bits (84), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 39/75 (52%), Gaps = 8/75 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           +  +FQG M NS+ C  C + + +   F  L  AIP       +  + V++++ L+ +  
Sbjct: 509 VQSLFQGTMINSIKCLTCDNVTSSDELF--LDFAIP------VNEDEEVNIQDMLSNFNQ 560

Query: 907 DEVLSGENAWDCPNC 921
            E+L+G N + C +C
Sbjct: 561 REMLNGANKFYCDSC 575

>KNAG0F01220 Chr6 (219798..222152) [2355 bp, 784 aa] {ON} Anc_2.69
            YNL186W
          Length = 784

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 28/132 (21%)

Query: 1043 NFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVL--------KSNEV--VKYKL 1090
            + +R P TL++HL +F ++ T   K    V+YP+ L++          K  +V  VKY+L
Sbjct: 588  SILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTKYCDKEATPKGQDVLPVKYQL 647

Query: 1091 YGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKIS 1149
              VV H G +L SGHY +   KQ D S       W  +DDE + + T   DV      + 
Sbjct: 648  ISVVVHEGRSLSSGHYIAHC-KQPDGS-------WSTYDDEYINKITER-DV------LR 692

Query: 1150 SSDVYVLFYERI 1161
             S+ Y L Y R+
Sbjct: 693  ESNAYYLVYTRL 704

>CAGL0J11352g Chr10 complement(1103473..1105788) [2316 bp, 771 aa]
            {ON} similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186w UBP10
          Length = 771

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 63/131 (48%), Gaps = 23/131 (17%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVLKSNEV-----VKYKLY 1091
            +K  + +R P TL++HL +F ++ T   K    V+YP+ L++     E      VKY+L 
Sbjct: 606  LKRNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDMTEYCEESKKMLPVKYELL 665

Query: 1092 GVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
             VV H G +L SGHY +   KQ D S       W  +DDE + + T    +K        
Sbjct: 666  SVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDDEYINKITEREVLKE------- 710

Query: 1151 SDVYVLFYERI 1161
             + Y + Y R+
Sbjct: 711  RNAYYVLYTRL 721

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 102/265 (38%), Gaps = 65/265 (24%)

Query: 685 YVSLSITGLRNLGNTCYINSMIQCLF---ATKSFRNLFISMKYK---------EFLKEVA 732
           Y  L   GL N G TCY N+ +Q L    A + + N  ++ KY            L E +
Sbjct: 379 YSKLKPKGLLNHGVTCYTNAAVQALLHIPAMQHYLNDILAGKYSSTISSNSVSHVLAETS 438

Query: 733 PKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
            +   N  +   S   YI  KK+          I+ L   + +  +++    Q+D+ E+ 
Sbjct: 439 RRMWHNDGKK--SGNSYINPKKL----------IARLDDINCMMSEWQ----QEDSHEYF 482

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
           M I+ RL ++   +   + E    I+YD                             IF 
Sbjct: 483 MSIMSRLQEDSVPKGHKMTES---IIYD-----------------------------IFG 510

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAI--PKATSSTFSRSKRVSLEECLNMYTSDEVL 910
           G ++ ++ C+ CG  S     FY LSL +   K   +T ++ K  S  E  +  +     
Sbjct: 511 GSLKQTVTCKSCGEVSTTEQPFYDLSLHLKGKKTDENTVNQEKSSSQSETKDSDSQTSRY 570

Query: 911 SGENA---WDCPNCCKITKDYKGMV 932
           S E +   +  P   K+ K+ KG V
Sbjct: 571 SIEKSIRDFFNPELIKVDKEKKGYV 595

>Smik_14.144 Chr14 (268784..271075) [2292 bp, 763 aa] {ON} YNL186W
            (REAL)
          Length = 763

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 74/152 (48%), Gaps = 25/152 (16%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL ++ +E K +  +K       +K  + +R P TL++HL +F ++ T   K    V+YP
Sbjct: 567  ELIKVDKEQKGYVCEKCHKTTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP 626

Query: 1074 LILNIV---LKSNEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDD 1129
            + L++       +  VKY+L  VV H G +L SGHY +   KQ D S       W  +DD
Sbjct: 627  MFLDLTEYCENKDLPVKYQLLSVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDD 678

Query: 1130 EVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            E + + +    +K        ++ Y L Y R+
Sbjct: 679  EYINKISERDVLKE-------TNAYYLLYTRL 703

 Score = 32.7 bits (73), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 81/212 (38%), Gaps = 58/212 (27%)

Query: 683 NIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQP 742
           N + +L   GL N G TCY N+ +Q +    S ++    +   ++         ++ S+ 
Sbjct: 325 NQFTNLKPRGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDILLGKY--------DSSISKS 376

Query: 743 VISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIP--DD---------QQDTTEF 791
            +S T     KKM+L    S  P   + S S + P+  I   DD         Q+D+ E+
Sbjct: 377 SVSYTLAETSKKMWL--PVSKNPRKSI-SASYINPNHLISRLDDINCMMSEWQQEDSHEY 433

Query: 792 LMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL--SPIDD 849
            M ++ RL +                                  D    G+ L  S I D
Sbjct: 434 FMSLMSRLQE----------------------------------DSVPKGHKLIESIIYD 459

Query: 850 IFQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881
           IF G ++  + C+ CG  S     FY LSL +
Sbjct: 460 IFGGLLKQIVTCKSCGSISKTEQPFYDLSLHL 491

>NDAI0E04180 Chr5 complement(941527..944010) [2484 bp, 827 aa] {ON}
            Anc_7.390 YBL067C
          Length = 827

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 57/129 (44%), Gaps = 15/129 (11%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD----LTKKNSTIVTYPLILNIVLKSNEVV--KYKLYGV 1093
            +T+   ++P TL +HL RF Y        K    + YPL LN+       +  KYKL G+
Sbjct: 618  RTVGLKKLPNTLALHLKRFKYSEEHFTNIKLFNKIVYPLELNVSSSFTSSISKKYKLQGI 677

Query: 1094 VNHTGNL-ISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
            V H G+    GHY +I          ++  GW  FDDE          +     + S + 
Sbjct: 678  VVHMGSSPQQGHYVAICK--------TDKYGWLLFDDETASWINEEEVLSFIGDEKSQNT 729

Query: 1153 VYVLFYERI 1161
             YVLFYE +
Sbjct: 730  AYVLFYEEV 738

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           I G  N GNTCY NS++QCL+    F+
Sbjct: 154 IFGYENFGNTCYCNSVLQCLYHLDDFK 180

>Suva_14.156 Chr14 (285613..287979) [2367 bp, 788 aa] {ON} YNL186W
            (REAL)
          Length = 788

 Score = 53.1 bits (126), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 74/152 (48%), Gaps = 25/152 (16%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL ++ +E K +  +K       +K  + +R P TL++HL +F ++ T   K    V+YP
Sbjct: 592  ELIKVDKEQKGYVCEKCHKTTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP 651

Query: 1074 LILNIVLKSNEV---VKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDD 1129
            + L++    ++    VKY+L  VV H G +L SGHY +   KQ D +       W  +DD
Sbjct: 652  MFLDLTEYCDDKDLPVKYQLLSVVVHEGRSLSSGHYIAHC-KQPDGT-------WATYDD 703

Query: 1130 EVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            E + + +    +K         + Y L Y R+
Sbjct: 704  EYINKISERDVLKE-------PNAYYLLYTRL 728

>NCAS0I01620 Chr9 complement(299269..301656) [2388 bp, 795 aa] {ON}
           Anc_3.270 YBR058C
          Length = 795

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 65/252 (25%), Positives = 97/252 (38%), Gaps = 65/252 (25%)

Query: 692 GLRNLGNTCYINSMIQCLF--ATKSFRNLFISMKYKEF-LKEVAPKPGANGSQPVISRTF 748
           G  NLGN+CY+NS++QCLF     ++  L  ++   EF L  V P          I   F
Sbjct: 334 GFINLGNSCYLNSVLQCLFNDGVPNWATLLANLIGNEFPLDCVYPTTNLKCQLIKILNAF 393

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDA 808
             L  + Y  G   + P SF         +FK  ++QQD TEFL  +L++L   L  +D 
Sbjct: 394 K-LNPENYPEG---IKPQSFKNYVGQSNKEFK-SNNQQDATEFLTFLLEQLEKTLFKKDN 448

Query: 809 VVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSS 868
             N                                     +I +  ME+ + CQ CG+  
Sbjct: 449 NPN-------------------------------------NIMKFIMEDKIQCQSCGNVK 471

Query: 869 FNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENA-WDCPNCCKITKD 927
           ++Y     + L +    +         +L E L  +      +GEN  +DCP C      
Sbjct: 472 YSYEPTEYIQLPLDGTNNPQ-------NLVETLTNF-----FNGENIDFDCPTC------ 513

Query: 928 YKGMVEKTKRNK 939
            K  V  TKR +
Sbjct: 514 -KKTVVATKRQR 524

>Skud_14.148 Chr14 (278827..281157) [2331 bp, 776 aa] {ON} YNL186W
            (REAL)
          Length = 776

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 74/152 (48%), Gaps = 25/152 (16%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL ++ +E K +  +K       +K  + +R P TL++HL +F ++ T   K    V+YP
Sbjct: 580  ELIKVDKEQKGYVCEKCHKTTNAVKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP 639

Query: 1074 LILNIVLKSNEV---VKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDD 1129
            + L++    ++    VKY+L  VV H G +L SGHY       + H    +G+ W  +DD
Sbjct: 640  MFLDLTEYCDDKDLPVKYQLLSVVVHEGRSLSSGHY-------IAHCKQPDGN-WATYDD 691

Query: 1130 EVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            E + + +    +K         + Y L Y R+
Sbjct: 692  EYINKISERDVLKE-------PNAYYLLYTRL 716

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/211 (21%), Positives = 80/211 (37%), Gaps = 60/211 (28%)

Query: 685 YVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
           + +L   GL N G TCY N+ +Q +    + ++    +   ++   +        S+  +
Sbjct: 338 FTNLKPRGLLNHGVTCYTNAAVQAMLHIPAIQHYLFDVLLGKYDSTI--------SKNSV 389

Query: 745 SRTFYILFKKMYL--------NGGCSVVP----ISFLKSCSLLRPDFKIPDDQQDTTEFL 792
           S T     KKM+L        N   S +     IS L   + +  +++    Q+D+ E+ 
Sbjct: 390 SYTLAETSKKMWLPLSKNYKKNSPASYINPKHLISRLDDINCMMSEWQ----QEDSHEYF 445

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL--SPIDDI 850
           M ++ RL +                                  D    G+ L  S I DI
Sbjct: 446 MSLMSRLQE----------------------------------DSVPKGHKLIESIIYDI 471

Query: 851 FQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881
           F G ++  + C+ CG +S     FY LSL +
Sbjct: 472 FGGLLKQIVTCKSCGSTSKTEQPFYDLSLHL 502

>SAKL0E13002g Chr5 complement(1070150..1072369) [2220 bp, 739 aa] {ON}
            similar to uniprot|P53874 Saccharomyces cerevisiae
            YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 739

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 44/136 (32%), Positives = 63/136 (46%), Gaps = 23/136 (16%)

Query: 1034 KKLFTIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVLKSNEV-----V 1086
            K    IK  + +R P TL+IHL +F ++ T   K    V+YP+ L++     +      V
Sbjct: 566  KTTNAIKRNSILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDMSEYCEDQQKTLPV 625

Query: 1087 KYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGV 1145
            KY+L  VV H G +L SGHY +   KQ D S       W  +DDE + + T    +K   
Sbjct: 626  KYQLISVVVHEGRSLSSGHYIAHC-KQPDGS-------WATYDDEYINKITEKQMLK--- 674

Query: 1146 MKISSSDVYVLFYERI 1161
                    Y L Y R+
Sbjct: 675  ----EPGAYYLIYTRL 686

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 51/258 (19%), Positives = 100/258 (38%), Gaps = 60/258 (23%)

Query: 688 LSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRT 747
           L   GL N G TCY N+ +Q +    S ++    +   +    ++P+         +++ 
Sbjct: 359 LKPKGLLNHGVTCYTNAAVQAMLHIPSIQHYLFDVLRGDHKTTISPQ--------SVTQV 410

Query: 748 FYILFKKMYL---NGGCSVVP---ISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHD 801
                K+M+    N    + P   I  L   + +  +++    Q+D+ E+ M ++ RL +
Sbjct: 411 LAETSKRMWSPEPNKNTYINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLMSRLQE 466

Query: 802 ELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHC 861
           +   +   + E    I+YD                             IF G +   + C
Sbjct: 467 DSVPRGHKLTES---IIYD-----------------------------IFGGLLHQKVTC 494

Query: 862 QRCGHSSFNYSTFYVLSLAI--PKATSSTFSRS------KRVSLEECLNMYTSDEVLS-- 911
           + CG  S     FY LSL +   K +  T   +      +R S+E+ ++ + + E++   
Sbjct: 495 KSCGGVSKTEQPFYDLSLHLKGKKKSDETVPENQEDVPQRRYSIEKSISDFFNPELIKVD 554

Query: 912 GENAWDCPNCCKITKDYK 929
            ++ + C  C K T   K
Sbjct: 555 KKDGYVCEKCHKTTNAIK 572

>SAKL0C04246g Chr3 (412865..416758) [3894 bp, 1297 aa] {ON} similar to
            uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
            Ubiquitin-specific protease present in the nucleus and
            cytoplasm that cleaves ubiquitin from ubiquitinated
            proteins
          Length = 1297

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 56/131 (42%), Gaps = 34/131 (25%)

Query: 1048 PRTLIIHLSRF--YYDLTKKNSTIVTYPLI----------------LNIVLKSNEVVKYK 1089
            P  L++HL RF  +Y  T K +  V +PL                  +      E V Y 
Sbjct: 975  PEILLVHLKRFESHYSSTGKLNNTVHFPLTGLDMSPHLPCRDGDGDGDGDDGGRENV-YD 1033

Query: 1090 LYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKIS 1149
            L  V NH G L SGHYT+ V   +D       D WY FDD     E R  D +     ++
Sbjct: 1034 LIAVDNHFGGLGSGHYTAYVKNPVD-------DKWYLFDDS----EVREVDAE----SVA 1078

Query: 1150 SSDVYVLFYER 1160
            SS  Y+LFY R
Sbjct: 1079 SSFGYLLFYRR 1089

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/218 (22%), Positives = 89/218 (40%), Gaps = 23/218 (10%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
           S    GL NLG+TC+INS++QCL      R+ F+   Y  F  E+  +  + G    ++ 
Sbjct: 347 SSGTMGLANLGSTCHINSVLQCLTHITELRDYFL---YNGFAAELNTR-NSLGYGGRVAG 402

Query: 747 TFYILFKKMYLNGGC---SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
            F  + + ++ +      +    +F  +    RP    P  QQD+ E +  +L  LH++L
Sbjct: 403 AFAEVVQALFGDKIAQFPTYAASNFRATIGYFRPALG-PYVQQDSHEVVAFLLGALHEDL 461

Query: 804 -----------SNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQ 852
                      + +   V            +   +      W    +  +  S I D+F 
Sbjct: 462 NRAPEGPRVGQAGESTGVGASVGASAGTRNRGRGERLAADTWSRYKLQND--SVITDLFA 519

Query: 853 GQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFS 890
           G ++++L C  C  SS  +       LA+P A  + +S
Sbjct: 520 GMLKSTLTCLTCRRSSVTFDP--CTELAVPLAVDAHWS 555

 Score = 38.9 bits (89), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 24/32 (75%)

Query: 893 KRVSLEECLNMYTSDEVLSGENAWDCPNCCKI 924
           +  +LE+CL+++T+ EVL+  ++W CP C K+
Sbjct: 931 QETTLEDCLDLFTAPEVLNTADSWYCPACKKL 962

>TPHA0L02290 Chr12 (479360..482941) [3582 bp, 1193 aa] {ON} Anc_5.18
           YMR304W
          Length = 1193

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 57/243 (23%), Positives = 92/243 (37%), Gaps = 63/243 (25%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +   E       KP  N S P+ + R FY
Sbjct: 209 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIPTDE------EKP--NDSVPLALQRAFY 260

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  L+       D      Q D  E   +++DRL   +      
Sbjct: 261 QL--------QVSNLPLDTLELTRSFGWDSADAFTQHDVQELNRILMDRLETRM------ 306

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                       K   V+ K                 + ++F G+M++ + C+   + S 
Sbjct: 307 ------------KGTKVEGK-----------------LSELFVGKMKSYIKCKNVDYESS 337

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYK 929
               F+ + L +              +L++    Y   E++ GEN +  P+   +   YK
Sbjct: 338 RVEEFWDIQLNVKDLK----------NLQQSFENYIEVELMDGENQYAAPDFG-LQDAYK 386

Query: 930 GMV 932
           G+V
Sbjct: 387 GVV 389

 Score = 52.0 bits (123), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 44/130 (33%), Positives = 63/130 (48%), Gaps = 23/130 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKNS------TIVTYPLILNIVLKS---NEV 1085
            K + F   P+ L + L RF YD     L K N       +I   P +   VLK+    E 
Sbjct: 386  KGVVFESFPKVLHLQLKRFEYDFNFDQLIKINDRYEFPDSIDLSPYLDKDVLKNENETES 445

Query: 1086 VKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHG--DVKH 1143
              YKL+GV+ HTG++ +GHY +++   L       GD WY FDDE V +  R    D   
Sbjct: 446  HIYKLHGVLVHTGDISTGHYYTMIKPDL-------GDQWYRFDDERVWKVDRKQVFDENF 498

Query: 1144 GVMKISSSDV 1153
            G+ K+  S++
Sbjct: 499  GLDKLPDSEL 508

>Kpol_534.23 s534 (53632..53653,53786..55254) [1491 bp, 496 aa] {ON}
           (53632..53653,53786..55254) [1491 nt, 497 aa]
          Length = 496

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 55/118 (46%), Gaps = 18/118 (15%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVIS---RTF 748
           GL N+GNTCY+NS +Q L+     R++   +KYKE   +   +PG      +IS   R F
Sbjct: 110 GLLNMGNTCYMNSTLQALYRVDGLRDMV--LKYKE---QANVQPGDELHYKLISELKRCF 164

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD------QQDTTEFLMLILDRLH 800
             L KK Y     SV+P+ FL       P F   D+      QQD  E    +   L+
Sbjct: 165 ENLQKKSY----ESVMPVVFLNLLRKCYPQFAEVDNANGIFKQQDAEELFTQLFSSLN 218

>NDAI0A01670 Chr1 complement(368070..370610) [2541 bp, 846 aa] {ON}
            Anc_7.390 YBL067C
          Length = 846

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVVK--YKLYGVVNHTG 1098
            ++P  L +HL RF Y    KN+ I     V YPL LN+    +  ++  Y+L GVV H G
Sbjct: 644  QLPHILALHLKRFKYSEV-KNTNIKLFNKVYYPLTLNVASTFDSSIEKAYELTGVVIHMG 702

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
            +    GHY S+          ++  GW  FDDE V+  +    ++      + +  YVLF
Sbjct: 703  SSPQHGHYVSLCK--------NDKFGWLLFDDETVESVSESTVLEFTGDPNNQATAYVLF 754

Query: 1158 YERI 1161
            Y+ I
Sbjct: 755  YKEI 758

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+    FR
Sbjct: 171 VFGYENFGNTCYCNSVLQCLYNLYEFR 197

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 33/76 (43%), Gaps = 8/76 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I ++FQG + N + C  C + +     F    + +           +  ++E  L  Y +
Sbjct: 564 ITNLFQGILTNQIKCLTCDNITSRDEPFLDFPIGV--------KDDEETNIETLLRNYHT 615

Query: 907 DEVLSGENAWDCPNCC 922
            E+L+G N + C  CC
Sbjct: 616 REMLNGSNKFYCNQCC 631

>Kpol_1045.41 s1045 complement(95233..97371) [2139 bp, 712 aa] {ON}
            complement(95235..97373) [2139 nt, 713 aa]
          Length = 712

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (46%), Gaps = 15/129 (11%)

Query: 1040 KTLNFIRMPRTLIIHLSRF-YYDLTKKNSTI---VTYPLILNIVLKSNEVVK--YKLYGV 1093
            + L    +P+TL IHL RF Y D    N  +   + YP+ L +    +E V   Y+L G+
Sbjct: 520  RLLGLKELPKTLAIHLKRFKYSDEHGTNVKLFNKIKYPITLKVSSTFDESVSKDYELGGL 579

Query: 1094 VNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
            V H G     GHY S+  K  D+       GW  FDDE V+  +    +       S+  
Sbjct: 580  VVHIGIGPQHGHYISVC-KTSDY-------GWLLFDDETVECISEDTVLSFVGDSNSAGT 631

Query: 1153 VYVLFYERI 1161
             YVLFY+ I
Sbjct: 632  AYVLFYKEI 640

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 38/70 (54%), Gaps = 7/70 (10%)

Query: 653 PTKRIQ---QEPFRSATNGLHETYSIPTIEQNPNIYVSLSIT---GLRNLGNTCYINSMI 706
           PT ++    ++ F S    + +    PT E+N N+ + + I    GL N GNTCY NS++
Sbjct: 88  PTSKVDSSLEKSFASEYTHVEKPVFSPTNEEN-NLDIDIDIHKVYGLENFGNTCYCNSIL 146

Query: 707 QCLFATKSFR 716
           QCL+    FR
Sbjct: 147 QCLYNMNEFR 156

 Score = 37.4 bits (85), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 56/142 (39%), Gaps = 31/142 (21%)

Query: 783 DDQQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGN 842
           D  QD  EFL  +L+ + D L                   K N +     K  D +  GN
Sbjct: 405 DMHQDAHEFLNFLLNDVSDYLD------------------KANTE-----KNPDNTRSGN 441

Query: 843 GLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLN 902
             + ++DIF+G + N + C  C   +  Y +F  L   I      T      + +++ + 
Sbjct: 442 ETNFVNDIFKGTITNQIRCLTCDTVTSRYESF--LDFPIEVIGDET------IDIQKMMI 493

Query: 903 MYTSDEVLSGENAWDCPNCCKI 924
            Y   E+L G N + C  C ++
Sbjct: 494 SYHQKEMLQGSNKFYCGTCFEL 515

>YMR304W Chr13 (874987..878679) [3693 bp, 1230 aa] {ON}
           UBP15Ubiquitin-specific protease involved in protein
           deubiquitination; catalytic activity regulated by an
           N-terminal TRAF-like domain and and C-terminal
           sequences; physically interacts with anaphase-promoting
           complex/cyclosome (APC/C) activator, Cdh1p
          Length = 1230

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 82/227 (36%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIP--------TEHESPNNSVPLALQRAFY 256

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  L+       D      Q D  E   +++DRL + +      
Sbjct: 257 QL--------QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPV- 307

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      E KLN                       +IF G+M++ + C    + S 
Sbjct: 308 -----------EGKLN-----------------------EIFVGKMKSYIKCINVDYESA 333

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +              +L+E  + Y   E+++GEN +
Sbjct: 334 RVEDFWDLQLNVKNFK----------NLQESFDNYIEMELMNGENQY 370

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 54/118 (45%), Gaps = 28/118 (23%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKS------ 1082
            K + F   P  L + L RF YD     + K N       TI   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLKKTLDSEN 441

Query: 1083 ---NEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
               N  V Y L+GV+ H+G++ +GHY +++   ++       D WY FDDE V R T+
Sbjct: 442  KDKNPYV-YNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERVWRVTK 491

>NDAI0F03410 Chr6 complement(820002..822614) [2613 bp, 870 aa] {ON}
            Anc_2.69 YNL186W
          Length = 870

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 68/137 (49%), Gaps = 23/137 (16%)

Query: 1033 SKKLFTIKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIV--LKSNEVV-- 1086
            +K    IK    +R P TL++HL +F ++   + K    V+YP+ L+I    +S++ V  
Sbjct: 699  NKTTNAIKRSTILRAPETLVVHLKKFRFNGSTSSKMKQAVSYPMYLDITEYCESSKKVLP 758

Query: 1087 -KYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHG 1144
             KY+L  VV H G +L SGHY       + H    +G  W  +DDE++ + +        
Sbjct: 759  AKYQLLSVVVHEGRSLSSGHY-------IAHCRQPDG-TWATYDDELINKISE------- 803

Query: 1145 VMKISSSDVYVLFYERI 1161
            +  ++  + Y L Y R+
Sbjct: 804  LKLLTEPNAYYLVYTRL 820

>KLLA0C06974g Chr3 complement(604344..605684) [1341 bp, 446 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 446

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 28/132 (21%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNIVLKSNEV-------VK 1087
             +K L   + P  L+I L RF + L  +++ +   V +PL LN+     ++       + 
Sbjct: 329  VVKQLTLHKAPNVLVIQLKRFEHQLNGQSAKLNDRVQFPLHLNLKPHLFQIEDEYIPNIA 388

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDG-WYYFDDEVVKRETRHGDVKHGVM 1146
            Y L  VV+H G +  GHYT++   +         DG W+ F+D VV   T          
Sbjct: 389  YDLLNVVSHQGTVDQGHYTTVSKTE---------DGQWFKFNDSVVTSVTEE-------- 431

Query: 1147 KISSSDVYVLFY 1158
            ++     Y+LFY
Sbjct: 432  QVLEQQAYLLFY 443

 Score = 48.1 bits (113), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 98/256 (38%), Gaps = 54/256 (21%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           + GL N+G+TC+++S+IQ +     F    +S K+         K G       +     
Sbjct: 132 LQGLVNMGSTCFMSSIIQTIIHNPYFVEDLLSHKH---CNNCDIKSGTKCVSCALDEIAC 188

Query: 750 ILFKKMYLNGGCSVVPISF--LKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQD 807
             +      G  S V   F  L S S       +   QQD  E+   +L++LH       
Sbjct: 189 DFYGNGPGTGKSSSVSKGFVNLLSASWHINHHLVGSSQQDAHEYWQFLLNQLH------- 241

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
                                 ++ + F  S   +       IFQG ++N+L C +CG S
Sbjct: 242 ---------------------TDHARVFGSSKAPDCQCITHRIFQGYLKNTLQCSQCGFS 280

Query: 868 SFNYSTFYVLSLAI---PKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKI 924
                    LSL I   PK             LE+CL+ +  +E L+ +  ++C +C   
Sbjct: 281 KTTIDPIMDLSLEIKNNPK-------------LEDCLDHFQREETLT-DFHYECQSC--- 323

Query: 925 TKDYKGMVEKTKRNKA 940
            K  +G+V++   +KA
Sbjct: 324 -KQNQGVVKQLTLHKA 338

>NCAS0D02390 Chr4 complement(451930..455565) [3636 bp, 1211 aa] {ON}
            Anc_5.18
          Length = 1211

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 53/110 (48%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSN-EVVK 1087
            K + F   P  L + L RF YD     L K N       +I   P +    L+ N E  K
Sbjct: 384  KGVIFESFPPILHLQLKRFEYDFNYDQLIKINDRYEFPESIDVSPYMDKKALRENKESCK 443

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+GV+ HTG++ +GHY +++   L        D WY FDDE V + T+
Sbjct: 444  YTLHGVLVHTGDISTGHYYAMIKPDLQ-------DQWYRFDDEKVWKVTK 486

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 80/227 (35%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 207 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYQIP--------TENESPNDSVPLALQRAFY 258

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  L+       D      Q D  E   +++DRL + +      
Sbjct: 259 QL--------QVSDIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKGTPV- 309

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      E KLN                       ++F G+M++ + C    + S 
Sbjct: 310 -----------EGKLN-----------------------ELFVGKMKSYIKCINVDYESS 335

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +               LEE    Y   E+++GEN +
Sbjct: 336 RVEDFWDLQLNVKNLK----------GLEESFKNYIEIELMNGENQY 372

>Kpol_1044.24 s1044 (56564..58738) [2175 bp, 724 aa] {ON}
            (56564..58738) [2175 nt, 725 aa]
          Length = 724

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 61/134 (45%), Gaps = 25/134 (18%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIVLKSNE-------VVKY 1088
             IK  + +R P TL++HL +F ++   + K    V YP+ L++     +        VKY
Sbjct: 548  AIKCNSILRAPETLLVHLKKFRFNGQSSSKMKQAVAYPMFLDLTEYCEDPEKGEKLPVKY 607

Query: 1089 KLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMK 1147
            +L  VV H G +L SGHY +       H    +G  W  +DDE + + +    +K     
Sbjct: 608  QLISVVVHEGRSLSSGHYIA-------HCRQPDG-SWAIYDDEYINKISERNVLKE---- 655

Query: 1148 ISSSDVYVLFYERI 1161
                + Y L Y R+
Sbjct: 656  ---PNAYYLIYTRL 666

>TPHA0P00680 Chr16 (139640..141823) [2184 bp, 727 aa] {ON} Anc_7.390
            YBL067C
          Length = 727

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 64/138 (46%), Gaps = 22/138 (15%)

Query: 1032 KSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNI--VLKSNE 1084
            ++++L  IK L     P+ L++HL RF Y   +KN  I     V YP  LNI  V   + 
Sbjct: 530  EAERLIGIKEL-----PKHLVVHLKRFKY-CEEKNCNIKLFNKVNYPFTLNISSVFDDSI 583

Query: 1085 VVKYKLYGVVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKH 1143
              KY+L  +V H G     GHY ++   +          GW  +DDE V+  +     + 
Sbjct: 584  SKKYELNSIVVHIGESPQLGHYVTLCKHK--------SYGWLIYDDETVQAVSDELVSRI 635

Query: 1144 GVMKISSSDVYVLFYERI 1161
               +  S+  Y+LFYE +
Sbjct: 636  LNNEQRSATAYLLFYEEV 653

 Score = 38.9 bits (89), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 35/81 (43%), Gaps = 13/81 (16%)

Query: 640 ILEADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNT 699
           +L A E   ++V P   +  E  R    G+   Y            V   + G +N G T
Sbjct: 68  VLNAQEPVPVEVDPESAV--EGVRREIEGILSNYD-----------VGERVFGFQNFGYT 114

Query: 700 CYINSMIQCLFATKSFRNLFI 720
           CY NS++Q LF   SFR+  I
Sbjct: 115 CYCNSILQALFNIGSFRDGII 135

>TBLA0D01070 Chr4 complement(275843..277294) [1452 bp, 483 aa] {ON}
           Anc_8.742 YMR223W
          Length = 483

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/254 (25%), Positives = 109/254 (42%), Gaps = 40/254 (15%)

Query: 674 SIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAP 733
           SIPT+ Q      +  + GL N+G+TCY++S++QCL     F +L +   +  + K   P
Sbjct: 126 SIPTLTQ------AHGLKGLVNMGSTCYMSSILQCLMHNPLFVDLSMKGVHYNYCKIQDP 179

Query: 734 -KPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFL 792
            K  +     +IS T+    KK   N G  +V I    +CS           QQD  EFL
Sbjct: 180 MKCMSCAIDNIISETYG--NKKTTPNEG--LVDI---LNCSWRVNKNLAGYTQQDAHEFL 232

Query: 793 MLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPID---- 848
             IL+++H+     D  +NE     ++D  K  +   ++K   + +     L   +    
Sbjct: 233 QFILNQMHN-----DYKLNE-----IHDTNKQEMNGTDFKTMVNGNSSKEHLHLCNCLPH 282

Query: 849 DIFQGQMENSLHCQRC-GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSD 907
            IFQG +++ + C  C   S      +  LSL +            + +L ECL  +   
Sbjct: 283 TIFQGFLKSIISCSECKAQSQTTIDPYMDLSLDV----------KGKSTLYECLESFHRT 332

Query: 908 EVLSGENAWDCPNC 921
           E L  +  ++C  C
Sbjct: 333 ERLH-DFTYNCKKC 345

 Score = 37.7 bits (86), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 50/118 (42%), Gaps = 32/118 (27%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNI------------------ 1078
            + L+ +++   ++I L RF + +T  +  I   V +PL LN+                  
Sbjct: 353  RQLSILKLAPIMVIQLKRFEHLITGSSVKINDFVEFPLHLNMKSFCTAPTPDTDPTNLNE 412

Query: 1079 -VLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDG-WYYFDDEVVKR 1134
               KS   + Y+L G+V H G +  GHY +              DG WY F+D VV +
Sbjct: 413  KTNKSTPDMIYELTGIVTHRGTVNEGHYITYT---------KTADGVWYQFNDSVVMK 461

>Ecym_2717 Chr2 (1388844..1390295) [1452 bp, 483 aa] {ON} similar to
           Ashbya gossypii AEL029W
          Length = 483

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 11/114 (9%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           G+ NLGNTCY+N+ +Q LF     R   +     EF ++ A K G +     + R   + 
Sbjct: 103 GIANLGNTCYMNATLQGLFRIDPLREQVL-----EFDEKRAIKEGVDTYHAQLVRELKVT 157

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFLMLILDRL 799
           F+K+    G ++ P+  L+    + P F   D       QQD  E    +   L
Sbjct: 158 FQKLKDRKGENITPLLLLEILRRVFPQFSETDPQGGFYKQQDAEELFTQLFHTL 211

>TPHA0O01640 Chr15 complement(325844..328084) [2241 bp, 746 aa] {ON}
            Anc_2.69 YNL186W
          Length = 746

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 20/123 (16%)

Query: 1020 ELREMKEEMKQW---KSKKLF-TIKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYP 1073
            EL +M +E K +   K KK    +K    +R P TL++HL +F ++   + K    V+YP
Sbjct: 537  ELIKMDKEKKGYVCEKCKKTTNAVKRNTILRAPETLLVHLKKFRFNGQSSSKMKQAVSYP 596

Query: 1074 LILNIV-----LKSNEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYF 1127
            + L++       KS  +V Y+L  VV H G +L SGHY       + H    +G  W  +
Sbjct: 597  MFLDLTSYCDKTKSKLLVMYQLISVVVHEGRSLSSGHY-------IAHCKQPDG-TWATY 648

Query: 1128 DDE 1130
            DDE
Sbjct: 649  DDE 651

>NDAI0A07410 Chr1 complement(1691853..1694285) [2433 bp, 810 aa]
           {ON} Anc_3.270
          Length = 810

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 101/246 (41%), Gaps = 45/246 (18%)

Query: 692 GLRNLGNTCYINSMIQCLF--ATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           GL NLGN+CY+NS++QCL      ++ +   ++   +F K+V    G    Q +     +
Sbjct: 343 GLINLGNSCYLNSVMQCLLNGGVPNWSDKLGNIIGHDFPKDVIYPTGNLRCQMIKLLNAF 402

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L  + Y  G   + P SF +       +FK  ++QQD+ EFL  + + L          
Sbjct: 403 KLNPEDYEEG---IRPRSFKECVGKHNAEFKT-NNQQDSMEFLTFVTEEL---------- 448

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      EK L      + K  D S+  N L       +  ME+ L C  C +  +
Sbjct: 449 -----------EKGL------FPKIQDASINPNNL------LKFIMEDKLQCVECKNVKY 485

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYK 929
            Y     + L + +      + ++ + +E   + +  +E+      + CP C ++TK  K
Sbjct: 486 TYQPNECIQLPLKEGNDLVGTTTQNL-MELITDYFQGEEI-----EFSCPTCKRMTKAVK 539

Query: 930 GMVEKT 935
               KT
Sbjct: 540 KQSFKT 545

>Suva_13.495 Chr13 (857778..861470) [3693 bp, 1230 aa] {ON} YMR304W
           (REAL)
          Length = 1230

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 82/227 (36%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIP--------TEHESPNNSVPLALQRAFY 256

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  L+       D      Q D  E   +++DRL + +      
Sbjct: 257 QL--------QVSDIPLDTLELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPV- 307

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      E KLN                       +IF G+M++ + C    + S 
Sbjct: 308 -----------EGKLN-----------------------EIFVGRMKSYIKCINVDYESS 333

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L + +              +L+E  + Y   E+++GEN +
Sbjct: 334 RVEDFWDLQMNVKNFK----------NLQESFDNYIEMELMNGENQY 370

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 25/116 (21%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLK------- 1081
            K + F   P  L + L RF YD     + K N       TI   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDKYEFPETIDLSPFVDKDVLKKTLDSGD 441

Query: 1082 SNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            +     Y L+GV+ H+G++ +GHY +++   ++       D WY FDDE V R T+
Sbjct: 442  NGNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERVWRVTK 490

>KNAG0J00800 Chr10 complement(134836..137133) [2298 bp, 765 aa] {ON}
           Anc_3.270 YBR058C
          Length = 765

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 60/127 (47%), Gaps = 7/127 (5%)

Query: 678 IEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGA 737
           ++ NP+  V     GL N+GN+CY+NS++QCLF  +++         +EF  +V      
Sbjct: 310 VKLNPSKEVG---CGLINMGNSCYLNSVLQCLFQDETWTGKLQMAVGEEFPTDVVFPSNN 366

Query: 738 NGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILD 797
              Q +       L  ++Y  G   + P SF K  S    +F     QQD  EFL  ++D
Sbjct: 367 LRCQLIKLYRAMKLEPELYPQG---IKPQSFKKCFSAGHEEFA-SQRQQDAMEFLTYMID 422

Query: 798 RLHDELS 804
            L  +LS
Sbjct: 423 NLDKKLS 429

 Score = 32.7 bits (73), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 8/58 (13%)

Query: 1088 YKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHG 1144
            YKLYG+V H GN   SGHY + + ++       +G    Y D+++V  E+    +++G
Sbjct: 707  YKLYGIVCHKGNSTQSGHYVAYIRQR-------DGQWTLYNDEKIVCVESLDEALRNG 757

>TBLA0B09760 Chr2 complement(2316180..2318876) [2697 bp, 898 aa] {ON}
            Anc_2.69 YNL186W
          Length = 898

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 60/127 (47%), Gaps = 24/127 (18%)

Query: 1044 FIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIV------LKSNEVVKYKLYGVVN 1095
             +R P TL+IHL +F ++ T   K    V+YP+ L++         S   VKY+L  VV 
Sbjct: 703  ILRAPETLLIHLKKFRFNGTSSSKMKQAVSYPMFLDLTEFCEAGKDSILPVKYQLLSVVV 762

Query: 1096 HTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVY 1154
            H G +L SGHY +   KQ D S       W  +DDE + + +    +K         + Y
Sbjct: 763  HEGRSLSSGHYIAHC-KQPDGS-------WATYDDEYINKISEREMLKE-------PNAY 807

Query: 1155 VLFYERI 1161
             L Y R+
Sbjct: 808  YLLYTRL 814

>TBLA0C07020 Chr3 (1694706..1698449) [3744 bp, 1247 aa] {ON} Anc_5.18
            YMR304W
          Length = 1247

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 52/110 (47%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSNEVVK- 1087
            K + F   P  L + L RF YD     L K N       TI   P +   VLK  +    
Sbjct: 436  KGVVFESFPEVLHLQLKRFEYDFNYDQLVKVNDRFEFPETIDLSPYMDKEVLKKQKGPNN 495

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+GV+ HTG++ +GHY +++    D       D WY FDDE V R T+
Sbjct: 496  YNLHGVLVHTGDISTGHYYAMIKPTTD-------DKWYRFDDEKVWRVTK 538

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 80/223 (35%), Gaps = 58/223 (26%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISRT 747
            G RN G TCY+NS++Q  F TK FR+L   +          P    N +  V   + R 
Sbjct: 259 VGFRNQGATCYLNSLLQSYFFTKYFRDLVYQI----------PTADENPNDSVALALQRA 308

Query: 748 FYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQD 807
           FY L          S  P+  L+       D      Q D  E   +++DRL   +    
Sbjct: 309 FYQL--------QVSNYPLDTLELTRSFGWDTAEAFTQHDVQELNRILMDRLESRM---- 356

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
                         K  +V+ K                 + D+F G+M++ + C    + 
Sbjct: 357 --------------KGTSVEGK-----------------LTDVFVGKMKSYIKCVNIDYE 385

Query: 868 SFNYSTFYVLSLAIP--KATSSTFSRSKRVSLEECLNMYTSDE 908
           S     F+ + L +   +  ++ F     V L +  N Y + +
Sbjct: 386 SSRVEDFWDIQLNVKGLEGLANAFENYIEVELMDGENQYAAQD 428

>ZYRO0C09812g Chr3 complement(743861..745969) [2109 bp, 702 aa] {ON}
            some similarities with uniprot|P53874 Saccharomyces
            cerevisiae YNL186W UBP10 Ubiquitin-specific protease that
            deubiquitinates ubiquitin-protein moieties may regulate
            silencing by acting on Sir4p involved in
            posttranscriptionally regulating Gap1p and possibly other
            transporters primarily located in the nucleus
          Length = 702

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (51%), Gaps = 15/102 (14%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIV---LKSNEV-VKYKLY 1091
             IK  + +R P TL++HL +F ++ T   K    V+YP+ L++    ++  E+ +KY+L 
Sbjct: 531  AIKHNSILRAPETLLVHLKKFRFNGTSSSKMKQAVSYPMFLDLTDYCVEGKELPLKYQLI 590

Query: 1092 GVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
             VV H G +L SGHY     +   H        W  +DDE +
Sbjct: 591  TVVVHEGRSLSSGHYIVHCKQPEGH--------WATYDDEYI 624

>ZYRO0F01276g Chr6 (102883..105213) [2331 bp, 776 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 776

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 47/193 (24%), Positives = 75/193 (38%), Gaps = 42/193 (21%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CY+NS++QCLF     +   +    ++F ++V         Q +       
Sbjct: 323 CGLINLGNSCYLNSVLQCLF-NGGVKGWSLKGLGQDFPQDVLYPTNNFKCQLIKLNNAMK 381

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVV 810
           +  + Y  G   + P SF K       +F     QQD+ EFL  ++D L           
Sbjct: 382 VEPQNYPEG---IRPKSFKKCVGQSHEEFS-SGRQQDSMEFLGYLVDVL----------- 426

Query: 811 NEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFN 870
                                    DK +  NG +P +D+ +  ME+ L C  CG   ++
Sbjct: 427 -------------------------DKKIFKNGSNP-NDLMKFTMEDRLQCTNCGKVKYS 460

Query: 871 YSTFYVLSLAIPK 883
                 L L +P+
Sbjct: 461 SEAAESLQLPMPE 473

>TDEL0G00410 Chr7 complement(82945..86505) [3561 bp, 1186 aa] {ON}
            Anc_5.18 YMR304W
          Length = 1186

 Score = 49.3 bits (116), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 54/110 (49%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKNS------TIVTYPLILNIVLKSNEVVK- 1087
            K + F   P  L + L RF YD     L K N       +I   P + +  L+ N   K 
Sbjct: 380  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDLAPYMDSEALEQNPGPKI 439

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            YKL+GV+ HTG++ +GHY +++         S  D WY FDD+ V R T+
Sbjct: 440  YKLHGVLVHTGDISTGHYYTLIKP-------STKDEWYRFDDDRVWRATK 482

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 82/229 (35%), Gaps = 66/229 (28%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISRT 747
            G RN G TCY+NS++Q  + TK FR L   +          P  G N +  V   + R 
Sbjct: 203 VGFRNQGATCYLNSLLQSYYFTKYFRRLVYQI----------PTEGENPNDSVTLALQRA 252

Query: 748 FYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQD 807
           FY L          S  P+  ++       D      Q D  E   +++DRL   +    
Sbjct: 253 FYQL--------QVSQFPLDTMELTRSFGWDNAEAFTQHDVQELNRILMDRLETRM---- 300

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
                         K  +V+ K                 I+++F G+M++ + C    + 
Sbjct: 301 --------------KGTSVEGK-----------------INELFVGKMKSYIRCINVDYQ 329

Query: 868 SFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
           S     F+ + L +         R  + S E     Y   E++ GEN +
Sbjct: 330 SVRTEDFWDIQLNVKNM------RDLQTSFEN----YIEVELMDGENQY 368

>KNAG0G02930 Chr7 (644555..645934) [1380 bp, 459 aa] {ON} Anc_8.742
            YMR223W
          Length = 459

 Score = 48.5 bits (114), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 16/102 (15%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNIVL-----KSNEVVKYKL 1090
            IK L   R+  TL++ L RF +  + +N  +   V +PL L++       +    + Y+L
Sbjct: 339  IKQLTIERLAPTLVLQLKRFEHLTSGQNVKLNDPVQFPLHLDMSRYCTGGEPTTSIVYRL 398

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
             GVV+H+G +  GHYT++        L  N   W+ F+D ++
Sbjct: 399  SGVVSHSGTVNEGHYTAV--------LQLNSGEWFKFNDSMI 432

>Smik_13.521 Chr13 (857682..861377) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 83/227 (36%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIP--------TEHESPNNSVPLALQRAFY 256

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  ++       D      Q D  E   +++DRL + +      
Sbjct: 257 QL--------QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNM------ 302

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                       K   V+ K                 + +IF G+M++ + C    + S 
Sbjct: 303 ------------KGTPVEGK-----------------LSEIFVGKMKSYIKCVNVDYESA 333

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +              +L+E  + Y   E+++GEN +
Sbjct: 334 RVEDFWDLQLNVKNFK----------NLQESFDNYIEMELMNGENQY 370

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 53/117 (45%), Gaps = 26/117 (22%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLK------- 1081
            K + F   P  L + L RF YD     + K N       TI   P +   VLK       
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKEVLKKSLDSGD 441

Query: 1082 -SNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
             S     Y L+GV+ H+G++ +GHY +++   ++       D WY FDDE V R T+
Sbjct: 442  KSRNPYVYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERVWRVTK 491

>Kwal_33.14430 s33 (669559..671094) [1536 bp, 511 aa] {ON} YNL186W
            (UBP10) - predicted to encode a ubiquitin-processing
            protease [contig 103] PARTIAL
          Length = 511

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (50%), Gaps = 16/99 (16%)

Query: 1044 FIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVLKSNEV-----VKYKLYGVVNH 1096
             +R P TL++HL +F ++ T   K    V+YP+ L++            VKY+L  VV H
Sbjct: 344  LLRAPETLLVHLKKFRFNGTSSSKLKQAVSYPMFLDLTEYCENSATALPVKYQLISVVVH 403

Query: 1097 TG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKR 1134
             G +L SGHY +   KQ D S       W  +DDE + +
Sbjct: 404  EGRSLSSGHYIAHC-KQPDGS-------WSTYDDEYINK 434

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 53/260 (20%), Positives = 98/260 (37%), Gaps = 66/260 (25%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N G TCY N+ +Q L    + ++    +   E+   +AP+         +++     
Sbjct: 125 GLLNHGVTCYTNAAVQALVHIPAIQHYLFDVLRGEYKSTIAPQS--------VTQVLAET 176

Query: 752 FKKMYLNGGCS---VVP---ISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
            K+M+ N       + P   I  L   + +  +++    Q+D+ E+ M ++ RL ++   
Sbjct: 177 TKRMWSNESSKNQFINPKKLIGRLDDINCMMSEWQ----QEDSHEYFMSLISRLQEDSVP 232

Query: 806 QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCG 865
           +   + E    ILYD                             IF G +   + C+ CG
Sbjct: 233 RGHKLTES---ILYD-----------------------------IFGGLLRQEVTCKSCG 260

Query: 866 HSSFNYSTFYVLSLAIPKATSSTFSRS------------KRVSLEECLNMYTSDEVLSGE 913
             S      Y LSL +    +S+   S            +R S+E+ +  + + E++  +
Sbjct: 261 EVSKTEQPIYDLSLHLKGKKNSSQGESAKNSSEYEEEPQRRFSIEKSIRDFFNPELIKAD 320

Query: 914 NA----WDCPNCCKITKDYK 929
            A    + C  C K T   K
Sbjct: 321 KATKEGYVCEKCHKTTNASK 340

>KAFR0C00410 Chr3 complement(85302..87611) [2310 bp, 769 aa] {ON}
           Anc_3.270 YBR058C
          Length = 769

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 60/244 (24%), Positives = 96/244 (39%), Gaps = 59/244 (24%)

Query: 691 TGLRNLGNTCYINSMIQCLFA--TKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTF 748
            GL NLGN+CY+NS++Q LFA     + ++ +    K+F  +V   P  N    +I    
Sbjct: 319 CGLINLGNSCYLNSILQALFAQDVSQWADVLMDTIGKDFPVDVV-YPSNNVKCQLIK--- 374

Query: 749 YILFKKMYLNGGC---SVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
             L   M +N       + P SF K+C          + QQD  EFL   ++ L      
Sbjct: 375 --LLNAMKINPSRYPEGIKPRSF-KNCIGQNNKEFTSNKQQDALEFLSYFVNELD----- 426

Query: 806 QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCG 865
                                     KK F K +   G     D+ +  ME+ L C RC 
Sbjct: 427 --------------------------KKLFKKELTNPG-----DLMRCYMEDRLQCLRCK 455

Query: 866 HSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKIT 925
           H  ++Y     + L +          ++   + E L+ +   EV+     ++CP+C K+T
Sbjct: 456 HVKYSYQANESIQLPLK-------DNNEPQDIRERLDAFFKGEVIE----FNCPHCQKMT 504

Query: 926 KDYK 929
           +  K
Sbjct: 505 EASK 508

>KAFR0A07580 Chr1 complement(1528362..1530770) [2409 bp, 802 aa] {ON}
            Anc_2.69 YNL186W
          Length = 802

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (48%), Gaps = 22/129 (17%)

Query: 1020 ELREMKEEMKQWKSKKLF----TIKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYP 1073
            EL ++ +E K +  +K       +K    +R P TL++HL +F ++ T   K    V+YP
Sbjct: 592  ELIKVDKEQKGYVCEKCHKTTNAVKRNTILRAPETLLVHLKKFRFNGTSSSKMKQAVSYP 651

Query: 1074 LILNIV-LKSNE------VVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWY 1125
            + L++     NE       VKY+L  VV H G +L SGHY +       H    +G  W 
Sbjct: 652  MFLDLTEYCDNEGNKKILPVKYQLISVVVHEGRSLSSGHYVA-------HCKQPDG-LWA 703

Query: 1126 YFDDEVVKR 1134
             +DDE + +
Sbjct: 704  TYDDEYINK 712

>TBLA0H03600 Chr8 complement(877069..878517) [1449 bp, 482 aa] {ON}
           Anc_8.540 YPL072W
          Length = 482

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 66/236 (27%), Positives = 102/236 (43%), Gaps = 47/236 (19%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS-MKYKEFLKEVAPKPGANGSQP---VISR 746
           TGL N GN C+INS +Q L  ++ F +   S ++  +FL E   + G   + P   V++ 
Sbjct: 69  TGLINKGNDCFINSSLQGLAGSQRFNHYLNSVLRCLKFLNENPKQEGNRYALPLHQVMAE 128

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
             Y L    +LN   S   I  +   S+ +   K+   Q D  EF  L+L+ LH      
Sbjct: 129 FIYDLQAPTFLNTVESSDKI-IVTMESIFKQ--KMSRRQNDAQEFTQLLLEVLH------ 179

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
               NEY +LI    + +N              I N L      F+G+  + L C +CG 
Sbjct: 180 ----NEYQELI----RLMN-------------FITNNLDIPTYPFEGKYCHELTCLKCGR 218

Query: 867 SS-FNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           +S      F +L+L +P   S        +SL+E ++   SD V+ G   + C  C
Sbjct: 219 NSEVKMFDFDILTLNLPAQPS--------ISLDELISGSNSD-VIEG---FSCTVC 262

>YER098W Chr5 (355466..357730) [2265 bp, 754 aa] {ON}  UBP9Ubiquitin
            carboxyl-terminal hydrolase, ubiquitin-specific protease
            that cleaves ubiquitin-protein fusions
          Length = 754

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 72/164 (43%), Gaps = 25/164 (15%)

Query: 1013 DAQRDIDEL------REMKEEMKQWKSKKLFTI----KTLNFIRMPRTLIIHLSRFYYDL 1062
            D + DI ++      REM   + ++   K + +    + +   ++P  L +HL RF Y  
Sbjct: 510  DEETDIQKMLKSYHQREMLNGVNKFYCNKCYGLQEAERMVGLKQLPHILSLHLKRFKYSE 569

Query: 1063 TKKNS----TIVTYPLILNIVLKSNEVV--KYKLYGVVNHTGNLIS-GHYTSIVDKQLDH 1115
             +K++      + YPL L++    N  V  KY+L GVV H G+    GHY  I   +   
Sbjct: 570  EQKSNIKLFNKILYPLTLDVSSTFNTSVYKKYELSGVVIHMGSGPQHGHYVCICRNE--- 626

Query: 1116 SLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYE 1159
                   GW  +DDE V+       ++        +  YVLFY+
Sbjct: 627  -----KFGWLLYDDETVESIKEETVLQFTGHPGDQTTAYVLFYK 665

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFR 716
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

>CAGL0M13783g Chr13 (1354198..1357788) [3591 bp, 1196 aa] {ON}
           similar to uniprot|P50101 Saccharomyces cerevisiae
           YMR304w UBP15
          Length = 1196

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 53/227 (23%), Positives = 82/227 (36%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R+FY
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQIP--------TENESPNNSVPLALQRSFY 254

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S  P+  L+       D      Q D  E   +++DRL + +      
Sbjct: 255 QL--------QVSKFPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRMKG---- 302

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                                       SV G     +++IF G+M++ + C    + S 
Sbjct: 303 ---------------------------TSVEG----MLNEIFVGKMKSYIKCIDVDYESS 331

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +               L+E  + Y   E+L+GEN +
Sbjct: 332 RVEDFWDLQLNVKNMK----------GLKESFDNYIEIELLNGENQY 368

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 18/110 (16%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSNEVVKY 1088
            K + F   P  L + L RF YD     + K N       TI   P + +   +      Y
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQMIKVNDRYEFPETIDLSPYLEDSKKEKENNCVY 439

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRH 1138
             L+GV+ H G++ +GHY +++   L+       D WY FDDE V + T++
Sbjct: 440  NLHGVLVHAGDISTGHYYTLIKPGLE-------DQWYRFDDERVWKVTKN 482

>Suva_5.217 Chr5 (329688..331952) [2265 bp, 754 aa] {ON} YER098W
            (REAL)
          Length = 754

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 69/152 (45%), Gaps = 21/152 (13%)

Query: 1022 REMKEEMKQWKSKKLFTIKTLNFI----RMPRTLIIHLSRFYYDLTKKNSTI-----VTY 1072
            REM   + ++   K + ++    I    ++P  L +HL RF Y   ++NS I     + Y
Sbjct: 528  REMLNGVNKFYCNKCYGLQEAERIVGLKQVPYILSLHLKRFKYS-EEQNSNIKLFNKIRY 586

Query: 1073 PLILNIVLKSNEVV--KYKLYGVVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDD 1129
            PL L++    +  V  +Y+L GVV H G+    GHY  I   +          GW  +DD
Sbjct: 587  PLRLDVSSTFDTSVSKRYELSGVVIHMGSGPQHGHYVCICKNE--------KFGWLLYDD 638

Query: 1130 EVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            E V+  +    +K        +  YVLFY+ I
Sbjct: 639  ETVESVSEETVLKFTGHSGDQTTAYVLFYKEI 670

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+    FR
Sbjct: 135 VFGYENFGNTCYCNSVLQCLYNIPEFR 161

>NCAS0G01800 Chr7 (319652..322279) [2628 bp, 875 aa] {ON} Anc_2.69
          Length = 875

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 25/132 (18%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNIVL-------KSNEVVKYKL 1090
            K  + +R P TL++HL +F ++ T   K    V+YP+ L++              VKY+L
Sbjct: 634  KRSSILRAPETLLVHLKKFRFNGTTSSKMKQAVSYPMYLDMTEYCETPSGTKQLPVKYEL 693

Query: 1091 YGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKIS 1149
              VV H G +L SGHY +       H    +G  W  +DDE + + +    +K       
Sbjct: 694  LSVVVHEGRSLSSGHYIA-------HCRQPDG-SWATYDDEYINKISELNVLKE------ 739

Query: 1150 SSDVYVLFYERI 1161
             ++ Y L Y R+
Sbjct: 740  -ANAYYLLYTRL 750

>TPHA0G00560 Chr7 complement(105403..106794) [1392 bp, 463 aa] {ON}
           Anc_8.742 YMR223W
          Length = 463

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 64/242 (26%), Positives = 101/242 (41%), Gaps = 55/242 (22%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSF-RNLFISMKYKEFLKEVAPKPGANGSQPVISRTF 748
           ++GL N+G+TCY++ +IQCL     F ++ F    YKE  K   P    + +   +    
Sbjct: 136 LSGLVNMGSTCYMSCIIQCLVRNPYFLKHSFNQTHYKE-CKIRDPVSCLSCALDSVVFEL 194

Query: 749 YILFKKMYL---NGGCSVVPISFLKSCSLLRPDFKIPDD-----QQDTTEFLMLILDRLH 800
           Y   +K  +   NGG  ++ I        L   +KI +D     QQD  EF   +++R+H
Sbjct: 195 YGKTQKKAVDDKNGG--LIDI--------LNCTWKINEDLVGYSQQDAHEFWQFLMNRIH 244

Query: 801 DELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLH 860
            E                    KLN    E  K  D   + N +     +FQG +E+++ 
Sbjct: 245 SEY-------------------KLNNNTIEVPK--DTHQLCNCI--YHKVFQGFLESTIE 281

Query: 861 CQRCGHSSFNYSTFYV-LSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCP 919
           C  C   S   +  Y+ LSL +            + +L ECLN +   E L  +  + C 
Sbjct: 282 CANCRKESKTTTEAYMDLSLDLK----------DKKTLYECLNSFHMKEELK-DFTFHCS 330

Query: 920 NC 921
           NC
Sbjct: 331 NC 332

 Score = 38.5 bits (88), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 55/131 (41%), Gaps = 29/131 (22%)

Query: 1023 EMKEEMKQWK------SKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYP 1073
             MKEE+K +             +K L   ++P  L++ L RF + L  ++S +   + YP
Sbjct: 317  HMKEELKDFTFHCSNCGGPQGALKQLTISKLPPVLLLQLKRFEHKLNGQSSKLNDSIEYP 376

Query: 1074 LILNI----VLKSNEVVK--------YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNG 1121
              L +       SNE +         Y+L GV+ HTG +  GHY          S     
Sbjct: 377  PYLRMNDYCQTSSNETIDSPDDSDIIYELIGVICHTGTVNEGHYIC--------SCKLAN 428

Query: 1122 DGWYYFDDEVV 1132
            + W  F+D ++
Sbjct: 429  NQWVKFNDSMI 439

>KAFR0K01810 Chr11 (375304..377448) [2145 bp, 714 aa] {ON} Anc_7.390
            YBL067C
          Length = 714

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 59/124 (47%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYG-VVNHT 1097
            ++P TL +HL RF Y L +KN+       + YPLIL++    N+ +  KY+L   VV+  
Sbjct: 503  KLPHTLALHLKRFKY-LEEKNANTKLFNKIEYPLILSVSSTFNDSIHKKYELISIVVHLG 561

Query: 1098 GNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
            G    GHY SI          S+  GW  FDDE V+       +K        +  YVLF
Sbjct: 562  GGPHHGHYVSIC--------KSDKFGWLLFDDETVESINEETVLKFVGDPEDQTTAYVLF 613

Query: 1158 YERI 1161
            Y  I
Sbjct: 614  YREI 617

 Score = 40.4 bits (93), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           I G  N GNTCY NS++QCLF    FR
Sbjct: 121 IFGYENFGNTCYCNSILQCLFFLDDFR 147

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 51/137 (37%), Gaps = 42/137 (30%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
           QQD  EFL  +L+ L+D L              L +EK                      
Sbjct: 395 QQDAHEFLNFLLNELNDFLQ-------------LSNEKNF-------------------- 421

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
             I D FQG + N + C  C   + N   F    + +        +  + +++++ LN Y
Sbjct: 422 --ILDQFQGTLTNQIKCLTCDTLTSNNEPFLDFPIEVK-------NDDEDLNIQDILNKY 472

Query: 905 TSDEVLSGENAWDCPNC 921
              E+L+G N + C  C
Sbjct: 473 HQREILNGTNKFYCNQC 489

>ZYRO0A05962g Chr1 complement(474545..475942) [1398 bp, 465 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 465

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 58/128 (45%), Gaps = 23/128 (17%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDL---TKKNSTIVTYPLILNI--VLKSNEV--VKYKL 1090
             IK L   ++P  L++ L RF + L   + K + IV +PL LN+      ++V  + ++L
Sbjct: 348  AIKRLIIHKLPAVLVLQLKRFEHHLNGNSAKLNDIVEFPLFLNMRNYCDGDDVPDIIFEL 407

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
             G++ H G +  GHY +       H        W+ F+D +V   T          ++  
Sbjct: 408  IGIIAHRGTVNEGHYIAFTKVTTGH--------WFKFNDSMVSSITEE--------ELLQ 451

Query: 1151 SDVYVLFY 1158
               Y+LFY
Sbjct: 452  EQAYLLFY 459

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 31/136 (22%), Positives = 58/136 (42%), Gaps = 8/136 (5%)

Query: 675 IPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPK 734
           + T  Q P +     + GL N+G+TC+++S++QCL     F    I+  + +      P 
Sbjct: 121 VVTKTQIPKLERRDGLQGLLNMGSTCFMSSIVQCLIHNPYFFQFSINQLHSQRCPLQDPL 180

Query: 735 PGANGSQPVISRTFYI---LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD-----QQ 786
              + +   +   FY    L K    +   S     +     L    +KI ++     QQ
Sbjct: 181 SCISCALDRMVWEFYGHPELIKNGEDDSNNSRTSDEYAGFIGLFVSSWKINENLAGYFQQ 240

Query: 787 DTTEFLMLILDRLHDE 802
           D  E+   +L++LH++
Sbjct: 241 DAHEYWQFLLNQLHND 256

>ZYRO0G01188g Chr7 (95655..95676,95759..97239) [1503 bp, 500 aa]
           {ON} highly similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 500

 Score = 47.0 bits (110), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 51/130 (39%), Gaps = 21/130 (16%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI---SRTF 748
           G +N+GNTCY+NS +Q L+  K  R L +S    E     A        + ++    R F
Sbjct: 109 GFQNMGNTCYLNSTLQALYRIKPLRELILSYNGSETATSSAADSTVESHKKIVLELQRCF 168

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD------QQDTTEFLMLIL------ 796
             L  K +     SV+P+  L +     P F   D       QQD  E    +       
Sbjct: 169 QNLKNKSF----KSVMPMVLLTALRKCYPQFAERDSQMGFYKQQDAEELFTQLFHSLSVV 224

Query: 797 --DRLHDELS 804
             D+  DE S
Sbjct: 225 FGDKFEDEFS 234

>Smik_5.244 Chr5 (364470..366719) [2250 bp, 749 aa] {ON} YER098W
            (REAL)
          Length = 749

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 71/162 (43%), Gaps = 21/162 (12%)

Query: 1011 DVDAQRDIDEL--REMKEEMKQWKSKKLFTIKTLNFI----RMPRTLIIHLSRFYYDLTK 1064
            D D QR +     REM   + ++   K + ++    I    ++P  L +HL RF Y   +
Sbjct: 510  DTDIQRILKSYHQREMLNGINKFYCNKCYGLQEAERIVGLKQLPYILSLHLKRFKYSEEQ 569

Query: 1065 KNS----TIVTYPLILNI--VLKSNEVVKYKLYGVVNHTGNL-ISGHYTSIVDKQLDHSL 1117
            K++      + YPL L++     ++   KY+L GVV H G+    GHY  I   +     
Sbjct: 570  KSNIKLFNKILYPLTLDVSSTFDTSVSKKYELSGVVIHMGSGPQHGHYVCICKNE----- 624

Query: 1118 NSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYE 1159
                 GW  +DDE V+       ++        +  YVLFY+
Sbjct: 625  ---KFGWLLYDDETVESIREETVLQFTGHPGDQTTAYVLFYK 663

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFR 716
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 130 SNKVFGYENFGNTCYCNSVLQCLYNIPEFR 159

>Skud_13.478 Chr13 (848446..852141) [3696 bp, 1231 aa] {ON} YMR304W
           (REAL)
          Length = 1231

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 81/227 (35%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 205 VGFRNQGATCYLNSLLQSYFFTKYFRKLVYEIP--------TEHESPNNSVPLALQRAFY 256

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S +P+  ++       D      Q D  E   +++DRL + +      
Sbjct: 257 QL--------QVSDIPLDTMELTRSFGWDTAESFTQHDVQELNRILMDRLENNMKGTPV- 307

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      E KLN                       +IF G+M++ + C    + S 
Sbjct: 308 -----------EGKLN-----------------------EIFVGKMKSYIKCINVDYESA 333

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +              +L+   + Y   E+++GEN +
Sbjct: 334 RVEDFWDLQLNVKNFE----------NLQGSFDNYIEMELMNGENQY 370

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 52/117 (44%), Gaps = 26/117 (22%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVL-------- 1080
            K + F   P  L + L RF YD     + K N       TI   P +   VL        
Sbjct: 382  KGVIFESFPPVLHLQLKRFEYDFNYDQMVKVNDKYEFPETIDLSPFVDKDVLRKTLDSGD 441

Query: 1081 KSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            K      Y L+GV+ H+G++ +GHY +++   ++       D WY FDDE V R T+
Sbjct: 442  KDKNPYIYNLHGVLVHSGDISTGHYYTLIKPGVE-------DQWYRFDDERVWRVTK 491

>TDEL0C01570 Chr3 complement(269169..271466) [2298 bp, 765 aa] {ON}
            Anc_7.390 YBL067C
          Length = 765

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 58/124 (46%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILN--IVLKSNEVVKYKLYGVVNHTG 1098
            ++P TL +HL RF Y   ++N  I     + YPL L+      S+   KY+L G+V H G
Sbjct: 567  QLPHTLALHLKRFKYS-EEQNCNIKLFNKIHYPLKLDVCSSFCSSVSKKYELTGIVVHMG 625

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY S+          ++  GW  FDDE V+        K    + S +  YVLF
Sbjct: 626  GGPQHGHYVSLC--------KNDNFGWLLFDDETVEAVHESTVSKFIGDRDSLTTAYVLF 677

Query: 1158 YERI 1161
            Y+ I
Sbjct: 678  YKEI 681

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 20/31 (64%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFI 720
           + G  N GNTCY NS++QCL+    FR L +
Sbjct: 123 VFGYENFGNTCYCNSVLQCLYNLTEFRLLLL 153

 Score = 32.3 bits (72), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 59/163 (36%), Gaps = 37/163 (22%)

Query: 763 VVPISFLKSCSLLRPDFKIPDD-QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDE 821
           V PISF+++  L R +        QD  EFL  +L              NE  + I  D 
Sbjct: 430 VSPISFVET--LKRENLLFNTTMHQDAHEFLNFLL--------------NELSEYIQKDI 473

Query: 822 KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881
             +    K+Y  +            I+ +FQG +   + C  C + +     F    + +
Sbjct: 474 DSIQDPAKKYDNF------------INGLFQGTLTYRIKCLTCDNVTSRDEPFLDFPIEV 521

Query: 882 PKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKI 924
                      +   ++  L  Y   E+LSG N + C  CC +
Sbjct: 522 --------QDDEETDIQALLRSYQQREMLSGSNKFYCDECCGL 556

>SAKL0H00418g Chr8 (50575..54147) [3573 bp, 1190 aa] {ON} similar to
           uniprot|P50101 Saccharomyces cerevisiae YMR304W UBP15
           Ubiquitin-specific protease that may play a role in
           ubiquitin precursor processing
          Length = 1190

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 81/227 (35%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G +N G TCY+NS++Q  F TK FR L   +           K   N S P+ + R F+
Sbjct: 206 VGFKNQGATCYLNSLLQSYFFTKYFRKLVYQIP--------TDKESPNNSVPLALQRAFF 257

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L K        S  P+  L+       D      Q D  E   +++DRL +++   D  
Sbjct: 258 QLQK--------SNEPLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKGTDV- 308

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      + KLN                       ++F G+M + + C    + S 
Sbjct: 309 -----------DGKLN-----------------------EVFVGKMRSYIKCVNVDYESS 334

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ + L +               L+E    Y   E++ GEN +
Sbjct: 335 RVEDFWDIQLNVKNLR----------GLQESFKNYIEVEMMDGENQY 371

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/111 (31%), Positives = 54/111 (48%), Gaps = 19/111 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSN-EVVK 1087
            K + F   P  L + L RF YD     L K N       +I   P +   +  SN +   
Sbjct: 383  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEISSSNADSYI 442

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRH 1138
            Y L+GV+ HTG++ +GHY +++   ++       D WY FDD+ V R T++
Sbjct: 443  YDLHGVLVHTGDISTGHYYTMIKPSIE-------DQWYRFDDDKVWRVTKN 486

>KAFR0A04210 Chr1 (843659..844981) [1323 bp, 440 aa] {ON} Anc_8.742
           YMR223W
          Length = 440

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 101/259 (38%), Gaps = 63/259 (24%)

Query: 674 SIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAP 733
           S PT+     ++      G  N+G+TC+++S++Q L          +S  +    K   P
Sbjct: 110 SFPTVTNRDGLH------GFVNMGSTCFMSSILQVLIHNPFIVQNSMSQSHYSSCKIRNP 163

Query: 734 KPGANGSQPVISRTFYILFKKMYLNGGCSVVPIS-----FLKSCSLLRPDFKIPDD---- 784
               + +   I    Y  F K Y NG     PI+     F+   S+L   +KI D+    
Sbjct: 164 NNCISCALDEIIAESYGNFVK-YNNGK----PINQYHDGFI---SMLNCSWKINDNFAGY 215

Query: 785 -QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNG 843
            QQD  EFL  IL+RLH +        N                              + 
Sbjct: 216 SQQDAHEFLQFILNRLHRDYKLTSTYTNN---------------------------TDSC 248

Query: 844 LSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYV-LSLAIPKATSSTFSRSKRVSLEECLN 902
              I  IFQG++++S+ C  C  +S   +  Y+ LSL I            + +L +CL+
Sbjct: 249 SCLIHSIFQGKLKSSIVCPECHDNSKTVTDPYIDLSLDIK----------DKATLYQCLD 298

Query: 903 MYTSDEVLSGENAWDCPNC 921
            +   E L   N + CPNC
Sbjct: 299 SFHKKETLHDYN-YHCPNC 316

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 59/128 (46%), Gaps = 24/128 (18%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKN---STIVTYPLILNI-----VLKSNEVVKYKL 1090
            IK L   ++P  L++ L RF +    +N   +  + +P  LN+       ++N  + Y+L
Sbjct: 323  IKQLTIDKLPPVLVLQLKRFEHLNNGQNVKLNAFIEFPTYLNMKKYCHTEENNSSIIYEL 382

Query: 1091 YGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISS 1150
             GV++H G +  GHY +        +L  + + W+ F+D +V   +    +K        
Sbjct: 383  NGVISHIGTVNEGHYIA--------TLKLDSNNWFKFNDSMVTSISEEEVLK-------- 426

Query: 1151 SDVYVLFY 1158
               Y+LFY
Sbjct: 427  DQAYLLFY 434

>CAGL0M11198g Chr13 (1102767..1104152) [1386 bp, 461 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223w UBP8
          Length = 461

 Score = 46.2 bits (108), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 66/131 (50%), Gaps = 27/131 (20%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNI--VLKSNE------VVK 1087
            IK     ++P  L++ L RF + ++  N  +   + +P IL++   LK N+       + 
Sbjct: 341  IKQFTINKLPPVLVLQLKRFEHLMSGVNQKLNDYIEFPKILDMKPYLKDNQNPDEDPSIL 400

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMK 1147
            Y+L G+++HTG++  GHY +    +       NG+ W+ F+D +V +      ++  V+K
Sbjct: 401  YELIGIISHTGSVNEGHYVAFCKIE-------NGE-WFKFNDSMVTKI-----LEKDVLK 447

Query: 1148 ISSSDVYVLFY 1158
                  Y+LFY
Sbjct: 448  ---EQAYLLFY 455

 Score = 35.4 bits (80), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 52/248 (20%), Positives = 96/248 (38%), Gaps = 54/248 (21%)

Query: 671 ETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKE 730
           E  ++PT++Q         + GL N+G+TCY++S++QC+         F+  ++      
Sbjct: 123 EYTNVPTVDQID------GMAGLVNMGSTCYMSSIMQCIIHNPYMIRYFMCQQHS---NN 173

Query: 731 VAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKS--CSLLRPDFKIPDD---- 784
              K  +N +   IS      +     N   S    +       +LL   +K+ ++    
Sbjct: 174 CTLKMASNCTSCAISSIIADFYGNSVQNDYKSKKNNNNKHEGFINLLTCSWKVNENLAGY 233

Query: 785 -QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNG 843
            QQD  E+   IL+ +H +     + ++ +      D+K  N                  
Sbjct: 234 SQQDAHEYWQFILNHIHQDYK---SSMHSHS-----DDKLCNC----------------- 268

Query: 844 LSPIDDIFQGQMENSLHCQRCGH-SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLN 902
              +   FQG +++S+ C  C + S   +  F  LSL I            + +L ECL+
Sbjct: 269 --VVHSSFQGSLKSSIVCPECNNDSKTTFDPFIDLSLGI----------KDKHTLTECLD 316

Query: 903 MYTSDEVL 910
            +   E L
Sbjct: 317 NFHKKEQL 324

>KAFR0A06910 Chr1 complement(1393653..1395689) [2037 bp, 678 aa]
           {ON} Anc_2.307 YDL122W
          Length = 678

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 99/266 (37%), Gaps = 61/266 (22%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRT-- 747
           I GL N GNTC++NS++Q L ++K             FL  V      N      + T  
Sbjct: 57  IAGLVNDGNTCFMNSVLQSLASSKEL---------AAFLDNVIENGSENNGDIKFTETLR 107

Query: 748 --FYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD-------DQQDTTEFLMLILDR 798
               IL KK Y           + K+  LL+     P+       DQ+D  EF   IL  
Sbjct: 108 ELLLILNKKYYKEK-------PYFKTNKLLKTMSNGPNKNIILGYDQEDAQEFFQQILSD 160

Query: 799 LHDELSNQDAVVNE---------YPDLILYDEKKLNVQNKEY---KKWFDKSVIGNG--- 843
           L   +        E          PD  L  +  LN     Y   ++    SV+ N    
Sbjct: 161 LEKNIKKPSTEKKEERNNIKESDLPDDALLGQDDLNNVGTVYIPTEQIEPNSVLENPDQK 220

Query: 844 -------LSPIDDIFQGQMENSLHCQRCG-HSSFNYSTFYVLSLAIPKATSSTFSRSKRV 895
                  ++P+D    G     + C  CG +    YS F  LSL +P   S + ++S  +
Sbjct: 221 LYSPFKLITPLD----GITAERIGCLTCGENGGIRYSVFSGLSLNLP---SESLNQST-L 272

Query: 896 SLEECLNMYTSDEVLSGENAWDCPNC 921
            L E LN +   E++ G    +C  C
Sbjct: 273 KLSELLNEWVKPEIIEG---VECNRC 295

>KLTH0B09944g Chr2 complement(826050..829619) [3570 bp, 1189 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1189

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 51/110 (46%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSNE-VVK 1087
            K + F   P  L + L RF YD     L K N       TI   P +   VLK N     
Sbjct: 379  KGVVFESFPSVLHLQLKRFEYDFNYDQLVKINDRYEFPETIDLSPYLDPDVLKKNPGPCV 438

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+GV+ H+G +  GHY +++   +       GD W+ FDD+ V R T+
Sbjct: 439  YNLHGVLVHSGEISVGHYYAMIKPDV-------GDQWFRFDDDKVWRVTK 481

 Score = 39.3 bits (90), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 49/230 (21%), Positives = 80/230 (34%), Gaps = 70/230 (30%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQP-----VISR 746
           GL+N G TCY+NS++Q  F TK FR +            V   P  N S        + R
Sbjct: 203 GLKNQGATCYLNSLLQSYFFTKLFRKI------------VYKIPSENESPNDSVLLALQR 250

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
           +FY+L K        S   +  L+       D      Q D  E   +++DRL   +   
Sbjct: 251 SFYLLQK--------SNETLDTLELTRSFGWDTGDAFTQHDVQELNRILMDRLETRMKGT 302

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
           +             E  LN                       ++F G+M++ + C    +
Sbjct: 303 EV------------EGALN-----------------------ELFVGKMKSYIRCINVDY 327

Query: 867 SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
            S     F+ + L +               ++E  + Y   E++ GEN +
Sbjct: 328 ESSRVEDFWDIQLNVKNLK----------GVQESFDNYVEVEIMDGENQY 367

>Kwal_26.9598 s26 complement(1283781..1287356) [3576 bp, 1191 aa]
           {ON} YMR304W (UBP15) - putative deubiquitinating enzyme
           [contig 363] FULL
          Length = 1191

 Score = 45.8 bits (107), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 82/225 (36%), Gaps = 60/225 (26%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           G +N G TCY+NS++Q  F TK FR     M YK      +P    + +   + R+FY+L
Sbjct: 203 GFKNQGATCYLNSLLQSYFFTKLFR----KMVYKIPSDNESPNDSVSLA---LQRSFYLL 255

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVVN 811
            K        S  P+  L+       D      Q D  E   +++DRL   +   +    
Sbjct: 256 EK--------SKEPLDTLELTRSFGWDTGEAFTQHDVQELNRILMDRLETRMKGTEV--- 304

Query: 812 EYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNY 871
                    E  LN                       D+F G+M++ + C    + SF  
Sbjct: 305 ---------EGTLN-----------------------DLFVGKMKSYIRCVNVDYESFRV 332

Query: 872 STFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
             F+ + L +               ++E    Y   E++ GEN +
Sbjct: 333 EDFWDIQLNVKNLK----------DVKESFENYVEVEMMDGENQY 367

 Score = 35.0 bits (79), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 49/110 (44%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVT----YPLILNIVLKSNEVVK-------- 1087
            K + F   P  L + L RF YD        +     +P  +++    +  VK        
Sbjct: 379  KGVVFESFPPVLHLQLKRFEYDFNYDQLVKINDRHEFPESIDLSPYLDPDVKDNYPNTCI 438

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+ V+ H+G++ +GHY +++   +        D W+ FDD+ V + T+
Sbjct: 439  YNLHCVLVHSGDISAGHYYAMIKPNV-------TDQWFRFDDDKVWKVTK 481

>ZYRO0D07062g Chr4 complement(609322..612903) [3582 bp, 1193 aa] {ON}
            similar to uniprot|P50101 Saccharomyces cerevisiae
            YMR304W UBP15 Ubiquitin-specific protease that may play a
            role in ubiquitin precursor processing
          Length = 1193

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 54/110 (49%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSNEVVK- 1087
            K + F   P  L + L RF YD     L K N        I   P +   VL++N   + 
Sbjct: 380  KGVVFESFPAVLHLQLKRFEYDFNYDQLVKINDRYEFPERIDLSPYMDKDVLEANPGPRW 439

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+GV+ HTG++ +GHY +++   L+       D WY FDDE V + ++
Sbjct: 440  YGLHGVLVHTGDISTGHYYALIKPGLE-------DQWYRFDDERVWKVSK 482

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 49/223 (21%), Positives = 78/223 (34%), Gaps = 58/223 (26%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI---SRT 747
            G RN G TCY+NS++Q  F TK FR L   +          P    N    V+    R 
Sbjct: 203 VGFRNQGATCYLNSLLQSYFFTKYFRRLVYQI----------PTSQENPKDSVVLALQRA 252

Query: 748 FYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQD 807
           FY L          S  P+  ++       D      Q D  E   +++DRL   +    
Sbjct: 253 FYQL--------QVSQYPLDTMELTRSFGWDNVEAFTQHDVQELNRILMDRLETRM---- 300

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
                         K   V+NK                 +++IF G+M++ + C    + 
Sbjct: 301 --------------KGTTVENK-----------------LNEIFVGKMKSFIKCINVDYE 329

Query: 868 SFNYSTFYVLSLAIP--KATSSTFSRSKRVSLEECLNMYTSDE 908
           S     F+ + + +   K    +F     V L +  N Y + +
Sbjct: 330 SARTEDFWDIQMNVKNLKGLKDSFENYIEVELMDGENQYAAQD 372

>TDEL0D03550 Chr4 (653772..656114) [2343 bp, 780 aa] {ON} Anc_3.270
           YBR058C
          Length = 780

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 95/248 (38%), Gaps = 58/248 (23%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CYINS++QCL      +   +S   + F  +V   P  N    +I     I
Sbjct: 322 CGLINLGNSCYINSVLQCLL-NGGVKTYSLSALGESFPLDVL-YPSTNMKCQLIKLNNAI 379

Query: 751 -LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L  ++Y +G   + P SF K       +F   + QQD  EFL    D L          
Sbjct: 380 KLEPELYPSG---IRPRSFKKCIGQAHEEFS-SERQQDALEFLSFFNDTL---------- 425

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                                     DK +     +   D+ +  +EN L C +CG    
Sbjct: 426 --------------------------DKKIFSRSENNPSDLMRYIIENRLQCTKCG--KV 457

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYK 929
            Y+T    S+ +P   +S    S+ + L+  +  +  +E+      + CP C       K
Sbjct: 458 KYTTDINESMLVPLEENSDSQHSQSL-LDRLVEYFHGEEL-----DFKCPQC-------K 504

Query: 930 GMVEKTKR 937
            MV+  ++
Sbjct: 505 DMVQAIRK 512

>Kpol_1064.48 s1064 (88495..89895) [1401 bp, 466 aa] {ON}
           (88495..89895) [1401 nt, 467 aa]
          Length = 466

 Score = 45.4 bits (106), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 59/239 (24%), Positives = 92/239 (38%), Gaps = 44/239 (18%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           ++GL N+G+TCY++ +IQCL     F    ++  + +  K   P    + +   I   FY
Sbjct: 136 LSGLVNMGSTCYVSCIIQCLVRNPYFLKYSLNQSHFKICKTHDPTTCISCALDSIVTDFY 195

Query: 750 IL------FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
            +       KK   +G      +  L +CS           QQD  EF   +L+RLH E 
Sbjct: 196 GISDLDDDVKKTNNDG------LIDLLTCSWKINQNLAGYSQQDAHEFWQFLLNRLHSEY 249

Query: 804 SNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQR 863
            +     +  P      E    + N  Y K                +FQG +++S+ C  
Sbjct: 250 KSNIGPTDTAP----LKEGNHELCNCIYHK----------------VFQGFLKSSIVCPE 289

Query: 864 CGH-SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           C   +      F  LSL I            + +L ECLN +   E L   + + C NC
Sbjct: 290 CNSDAKTTIEPFMDLSLDIK----------GKNTLYECLNSFHKKEQLHDFD-YHCKNC 337

 Score = 33.9 bits (76), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 39/83 (46%), Gaps = 13/83 (15%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTK---KNSTIVTYPLILNIV----------LKSNEVV 1086
            K L   ++   L+    RF + L+    K + ++ +PL LN+             S   +
Sbjct: 345  KQLAVAKLSPVLLFQFKRFEHLLSGSSIKLNDVIEFPLYLNMKDYCDVEQRDDSNSKPDL 404

Query: 1087 KYKLYGVVNHTGNLISGHYTSIV 1109
             Y+L G++ HTG +  GHYT+I 
Sbjct: 405  IYELIGIICHTGTVNEGHYTAIC 427

>AGR023C Chr7 complement(756961..759303) [2343 bp, 780 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR058C
           (UBP14)
          Length = 780

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/245 (23%), Positives = 94/245 (38%), Gaps = 52/245 (21%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CY+NS++Q LF     ++  + M   +F ++V         Q +  R    
Sbjct: 318 CGLINLGNSCYLNSVVQVLF-NGGVKDWNLDM-LGDFPRDVVFPSTNLKCQLIKLRNALK 375

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVV 810
           +  + Y +G   V P S  K       +F     QQD  EFL   +D+L           
Sbjct: 376 IHPEKYQHG---VKPASVKKCIGEDNEEFS-SGRQQDAMEFLTYFIDKLD---------- 421

Query: 811 NEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFN 870
                                +K F K+   N     +D+ +  +E+ L C +C H  ++
Sbjct: 422 ---------------------RKVFSKASSSNP----NDLMRFMVEDRLECTKCEHVKYS 456

Query: 871 YSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKITKDYKG 930
                +L + +  +    F       L + L+ Y + E L       CP C +IT   K 
Sbjct: 457 SQVCEILQIPLLDSNDPQF-------LMDRLHSYFNGESLD----IHCPQCSEITVATKN 505

Query: 931 MVEKT 935
            + KT
Sbjct: 506 SMLKT 510

>Kwal_34.16268 s34 (268814..270163) [1350 bp, 449 aa] {ON} YFR010W
           (UBP6) - (putative) ubiquitin-specific protease [contig
           710] FULL
          Length = 449

 Score = 45.1 bits (105), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 51/122 (41%), Gaps = 13/122 (10%)

Query: 685 YVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
           ++S +  GL+NLGNTCY+NS +Q L+  K  R+  ++ K          KP       ++
Sbjct: 54  HLSQTPVGLKNLGNTCYMNSTLQALYQIKPLRDEVLNYKVPR------EKPSEEQHHQLV 107

Query: 745 SRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD------QQDTTEFLMLILDR 798
           S      F+++      SV P+  L       P F   D       QQD  E    I + 
Sbjct: 108 SE-LRRCFQQLKDKPQESVTPMLLLAMLRKCYPQFAERDQESGFYKQQDAEELFTQIFNS 166

Query: 799 LH 800
           L 
Sbjct: 167 LR 168

>TBLA0D00620 Chr4 complement(159706..163221) [3516 bp, 1171 aa] {ON}
            Anc_7.390 YBL067C
          Length = 1171

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 58/122 (47%), Gaps = 17/122 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG 1098
            ++P+TL +HL RF Y   ++N  I     V YPL L++    N  +  +Y+L G+V H G
Sbjct: 958  QLPKTLSLHLKRFKYS-EEQNCNIKLFNKVNYPLYLDVSSSFNPNINKRYELNGIVVHMG 1016

Query: 1099 NLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
                 GHY +I          ++  GW   DDE V+  +    ++        +  YVLF
Sbjct: 1017 GGPQHGHYVAICK--------NDKFGWLLMDDETVETISEETVLRCKGDSKDLTTAYVLF 1068

Query: 1158 YE 1159
            Y+
Sbjct: 1069 YK 1070

 Score = 37.0 bits (84), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+   + R
Sbjct: 515 VFGYENFGNTCYCNSVLQCLYNMTNLR 541

>Ecym_6248 Chr6 (468203..469603) [1401 bp, 466 aa] {ON} similar to
            Ashbya gossypii AFR551W
          Length = 466

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 55/115 (47%), Gaps = 20/115 (17%)

Query: 1029 KQWKSKKLFTIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNI------- 1078
            K+ KS K   I+ L   ++P  L++ L RF + +   +  I   +++PL LN+       
Sbjct: 340  KKCKSTK-NPIRQLTTAKLPPVLMLQLKRFEHLMNGTSVKINDYISFPLHLNMKDYCKPV 398

Query: 1079 -VLKSNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
              L     + YKL  +++H G +  GHYT+I           NGD W  F+D +V
Sbjct: 399  DCLHPVPNMMYKLSAIISHHGTVHQGHYTTIC--------RINGDIWAKFNDSMV 445

>TBLA0C01200 Chr3 complement(258492..259981,260188..260209) [1512
           bp, 503 aa] {ON} Anc_1.369 YFR010W
          Length = 503

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723
           GL+NLGNTCY+N+ +QCLF  +  R + ++ K
Sbjct: 110 GLKNLGNTCYLNATLQCLFRIEPLREMILNYK 141

>KLTH0H13354g Chr8 complement(1165485..1166953,1167017..1167035)
           [1488 bp, 495 aa] {ON} similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 495

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 47/116 (40%), Gaps = 15/116 (12%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            GL+NLGNTCY+NS +Q L+  +  R        +E L    PK   +G Q + +     
Sbjct: 106 VGLKNLGNTCYMNSTLQALYQIRPLR--------EEILNFQPPKENRSGEQHIQLVAELK 157

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD------QQDTTEFLMLILDRL 799
             F+++      S  PI  L +     P F   D       QQD  E    I   L
Sbjct: 158 RCFQQLRDRPQESTTPILLLATLRKCYPQFAERDQESGFYKQQDAEELFTQIFHSL 213

>AGL357W Chr7 (33383..36883) [3501 bp, 1166 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YMR304W (UBP15)
          Length = 1166

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 63/135 (46%), Gaps = 21/135 (15%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSNEV-VK 1087
            K + F   P  L + L RF YD     L K N       +I   P +   V + +    K
Sbjct: 367  KGVLFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVQEDSPANAK 426

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHG--DVKHGV 1145
            Y L+GV+ HTG++ +GHY +++   L+       D WY FDD+ V R T+    +   G 
Sbjct: 427  YNLHGVLVHTGDISTGHYYAMIKPGLE-------DAWYRFDDDKVWRVTKKQVFEQNFGF 479

Query: 1146 MKISSSDVYVLFYER 1160
             K+S  D+  L  E+
Sbjct: 480  DKLSEYDLRSLTKEQ 494

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 52/232 (22%), Positives = 83/232 (35%), Gaps = 72/232 (31%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPG---ANGSQPVISRT 747
            GL+N G TCY+NS++Q  + TK FR L   +          P  G   AN     + R 
Sbjct: 190 VGLKNQGATCYLNSLLQSYYFTKYFRKLVYQI----------PTEGETPANSVSLALQRA 239

Query: 748 FYILFKKMYLNGGCSVVPISFLKSCSLLRP---DFKIPDDQQDTTEFLMLILDRLHDELS 804
           F+ L +        S  P   L +C L R    D      Q D  E   +++DRL +++ 
Sbjct: 240 FFQLQR--------SSEP---LDTCELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMK 288

Query: 805 NQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRC 864
             +             E KLN                        +F G+M++ + C   
Sbjct: 289 GTEV------------EGKLN-----------------------GLFVGKMKSYIKCVNV 313

Query: 865 GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
            + S     F+ + L +               L++    Y   E++ GEN +
Sbjct: 314 DYESSRVEDFWDIQLNVKGLK----------GLQQSFENYIEVEMMDGENQY 355

>Skud_5.223 Chr5 (351514..353760) [2247 bp, 748 aa] {ON} YER098W
            (REAL)
          Length = 748

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 66/149 (44%), Gaps = 19/149 (12%)

Query: 1022 REMKEEMKQWKSKKLFTIKTLNFI----RMPRTLIIHLSRFYYDLTKKNS----TIVTYP 1073
            REM   + ++   K + ++    I    ++P  L +HL RF Y   ++++      + YP
Sbjct: 517  REMLNGVNKFYCNKCYGLQEAERIVGLKQLPYILSLHLKRFEYSEGQQSNIKLFNKILYP 576

Query: 1074 LILNI--VLKSNEVVKYKLYGVVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDE 1130
            L L++     S+   KY+L GVV H G+    GHY  I   +          GW  +DDE
Sbjct: 577  LSLDVSSTFDSSISKKYELSGVVIHMGSGPQHGHYVCICKNE--------KFGWLLYDDE 628

Query: 1131 VVKRETRHGDVKHGVMKISSSDVYVLFYE 1159
             V+       +K        +  YVLFY+
Sbjct: 629  TVESIREETVLKFTGHPGDQTTAYVLFYK 657

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFR 716
           S  + G  N GNTCY NS++QCL+    FR
Sbjct: 122 SNKVFGYENFGNTCYCNSVLQCLYNISEFR 151

>KNAG0E01290 Chr5 complement(254460..258050) [3591 bp, 1196 aa] {ON}
           Anc_5.18 YMR304W
          Length = 1196

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 83/227 (36%), Gaps = 62/227 (27%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G +N G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 203 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYEIP--------TDMDSPNNSVPLALQRAFY 254

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S  P+  L+       D      Q D  E   +++DRL + +      
Sbjct: 255 QL--------QVSNEPLDTLELTRSFGWDNGDAFTQHDVQELNRILMDRLENRM------ 300

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                       K+  V+ K                 ++++F G+M++ + C    + S 
Sbjct: 301 ------------KETPVEGK-----------------LNELFVGKMKSYIKCINVDYESS 331

Query: 870 NYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
               F+ L L +               LEE  + Y   E+++GEN +
Sbjct: 332 RVEDFWDLQLNVKNLK----------GLEESFSNYIEIELMNGENQY 368

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 51/111 (45%), Gaps = 20/111 (18%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLIL--NIVLKSNEVV 1086
            K + F   P  L + L RF YD     L K N       TI   P I   +  L + E  
Sbjct: 380  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPETIDVSPYIEKGSEQLSNKEAC 439

Query: 1087 KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
             Y L+GV+ H G++ +GHY +++   +        D WY FDD+ V R T+
Sbjct: 440  IYNLHGVLVHAGDISTGHYYTMIRPGV-------SDEWYRFDDDKVWRVTK 483

>Suva_6.83 Chr6 complement(143456..144958) [1503 bp, 500 aa] {ON}
           YFR010W (REAL)
          Length = 500

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 45/99 (45%), Gaps = 6/99 (6%)

Query: 689 SITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVIS--R 746
           S  G +N+GNTCY+N+ +Q L+     R++ ++    E +   + +      Q VI   R
Sbjct: 107 SPVGFKNMGNTCYLNATLQALYRVDDVRDMILNYNPSEGVSSSSAQDEETHKQIVIEMKR 166

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785
            F  L  K +     SV+PI  L +     P F   D Q
Sbjct: 167 CFENLHNKSFK----SVLPIVLLNTLRKCYPQFAERDQQ 201

 Score = 35.4 bits (80), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 1088 YKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            Y L GV+ H G N  SGHY + +  +LD       + WY F+D+ V
Sbjct: 431  YNLIGVITHQGANSESGHYQAFIRDELDE------NKWYKFNDDKV 470

>NDAI0I02530 Chr9 (584472..588065) [3594 bp, 1197 aa] {ON} Anc_5.18
            YMR304W
          Length = 1197

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 7/56 (12%)

Query: 1082 SNEVVKYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            +NE   Y L+GV+ HTG++ +GHY +++   L+       D WY FDDE V + T+
Sbjct: 432  NNEPCIYNLHGVLVHTGDISTGHYYAMIKPDLE-------DQWYRFDDEKVWKVTK 480

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 17/114 (14%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G RN G TCY+NS++Q  F TK FR L     YK   +   P    N S P+ + R FY
Sbjct: 201 VGFRNQGATCYLNSLLQSYFFTKYFRKLV----YKIPTESETP----NSSVPLALQRAFY 252

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
            L          S +P+  L+       D      Q D  E   +++DRL + +
Sbjct: 253 QL--------QVSQIPLDTLELTRSFGWDSAEAFTQHDVQELNRILMDRLENRM 298

>Ecym_5671 Chr5 complement(1362706..1366236) [3531 bp, 1176 aa] {ON}
            similar to Ashbya gossypii AGL357W
          Length = 1176

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 53/110 (48%), Gaps = 19/110 (17%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKN------STIVTYPLILNIVLKSN-EVVK 1087
            K + F   P  L + L RF YD     L K N       +I   P +   V K   E + 
Sbjct: 376  KGVVFESFPPVLHLQLKRFEYDFNYDQLIKINDRYEFPESIDLSPYLDPEVRKIRPESMM 435

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETR 1137
            Y L+GV+ HTG++ +GHY +++   LD       D WY FDD+ V + T+
Sbjct: 436  YNLHGVLVHTGDISTGHYYAMIKPGLD-------DKWYRFDDDKVWQVTK 478

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/230 (21%), Positives = 80/230 (34%), Gaps = 66/230 (28%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISR 746
             GL+N G TCY+NS++Q  + TK FR L   +          P  G   S  V   + R
Sbjct: 198 FVGLKNQGATCYLNSLLQSYYFTKYFRKLVYHI----------PTDGETPSNSVPLALQR 247

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
            FY L +        S  P+   +       D      Q D  E   +++DRL +++   
Sbjct: 248 AFYKLQR--------SSEPLDTFELTRSFGWDTGDAFTQHDVQELNRILMDRLENKMKAT 299

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
           +             E KLN                       +IF G+M++ + C    +
Sbjct: 300 EV------------EGKLN-----------------------EIFVGKMKSYIKCVNVEY 324

Query: 867 SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
            S     F+ + L +               L +    Y   E++ GEN +
Sbjct: 325 ESSRVEDFWDIQLNVKGLN----------GLNQAFENYIEVEMMDGENQY 364

>Smik_13.431 Chr13 (700800..702215) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/137 (26%), Positives = 57/137 (41%), Gaps = 32/137 (23%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNI--VLKSNEVVK----- 1087
             IK L   R+P  L++ L RF + L   N  +   + +P  LN+     + E  K     
Sbjct: 345  AIKQLGIHRLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKSYCSTGESEKHTGNG 404

Query: 1088 ------YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDV 1141
                  Y+L G+V+H G +  GHY +            +G  W+ F+D VV        +
Sbjct: 405  KVPDIIYELIGIVSHRGTVNEGHYIAFC--------KISGGQWFKFNDSVVT------SI 450

Query: 1142 KHGVMKISSSDVYVLFY 1158
              G  ++     Y+LFY
Sbjct: 451  AQG--EVLKEQAYLLFY 465

 Score = 35.4 bits (80), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 54/240 (22%), Positives = 92/240 (38%), Gaps = 44/240 (18%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           ++GL N+G+TC+++S++QCL     F    +S  +    K  +P    + +   I +  Y
Sbjct: 136 LSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNKCKVGSPDKCFSCALDKIIQELY 195

Query: 750 ILFKKMYLNGGCSVV--PISFLKSCSLLRPDFKIPDD-----QQDTTEFLMLILDRLHDE 802
            +      +   S       F+    LL   +KI  +     QQD  EF   I++++H  
Sbjct: 196 GVLNTDQPSPSSSATNRQTGFIY---LLTCAWKINQNLAGYSQQDAHEFWQFIINQIHQS 252

Query: 803 LSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQ 862
            ++      E             V NK  +              +  +F+G +E+S+ C 
Sbjct: 253 YTHDSPNAKEID----------RVNNKRCE------------CIVHSVFEGSLESSIVCP 290

Query: 863 RC-GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
            C  +S      F  LSL I            +  L ECL+ +   E L   N + C  C
Sbjct: 291 GCQKNSKTTIDPFMDLSLDIK----------DKKKLYECLDSFHKKEQLKDFN-YHCGEC 339

>CAGL0K10494g Chr11 (1023698..1025185) [1488 bp, 495 aa] {ON} highly
           similar to uniprot|P43593 Saccharomyces cerevisiae
           YFR010w UBP6 ubiquitin-specific protease
          Length = 495

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 52/125 (41%), Gaps = 14/125 (11%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL+N+GNTCY+N+ +Q LF     ++L +     +     A           + RTF  L
Sbjct: 110 GLQNMGNTCYLNATLQALFRADELKDLILQYDPSKVTNSDANDEIHYKIVLELKRTFETL 169

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFLMLILDRLH----D 801
            K+ +     SV+PI  L +     P F   D       QQD  E    +   L     D
Sbjct: 170 KKRSF----KSVLPIMLLNTLRKCYPQFAERDPQGGFYKQQDAEELFTQLFHTLTVVFGD 225

Query: 802 ELSNQ 806
           + +NQ
Sbjct: 226 KFANQ 230

>KAFR0L01730 Chr12 (316860..318965) [2106 bp, 701 aa] {ON} Anc_7.390
            YBL067C
          Length = 701

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/123 (30%), Positives = 50/123 (40%), Gaps = 17/123 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTK----KNSTIVTYPLILNI--VLKSNEVVKYKLYGVVNHTGN 1099
            R+P+TL +HL RF Y   K    K    + YP  L +     S    +Y+L   V H G+
Sbjct: 511  RLPKTLSLHLKRFKYSEDKMANIKLFNKIDYPTFLTVSSTFDSKLSKRYELASAVIHLGD 570

Query: 1100 LIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
                GHY S+   +          GW  FDDE V  E             +S   YVLFY
Sbjct: 571  GPQYGHYISLCKTET--------FGWLLFDDETV--EAVDEQTVLSFTGENSDTAYVLFY 620

Query: 1159 ERI 1161
              +
Sbjct: 621  NEV 623

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 26/59 (44%), Gaps = 10/59 (16%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTF 748
           I G  N GNTCY NS++QC F    FR   +S           P   ++G +     TF
Sbjct: 126 IFGYENFGNTCYCNSILQCFFNHSVFRTSMLSF----------PSSNSDGERARTLETF 174

 Score = 34.3 bits (77), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 16/78 (20%), Positives = 35/78 (44%), Gaps = 8/78 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           + DIFQG + N + C  C   +     F   ++ + +         + ++++  L  +  
Sbjct: 431 VQDIFQGSLTNQIRCYTCDSITSTEEPFLDFAIEVKE--------DENLNIQRHLESFHQ 482

Query: 907 DEVLSGENAWDCPNCCKI 924
            E+L+G + + C  CC +
Sbjct: 483 RELLNGSDKFYCDRCCGL 500

>SAKL0H04994g Chr8 complement(445232..446596) [1365 bp, 454 aa] {ON}
            similar to uniprot|P50102 Saccharomyces cerevisiae
            YMR223W UBP8 Ubiquitin-specific protease that is a
            component of the SAGA (Spt-Ada-Gcn5-Acetyltransferase)
            acetylation complex required for SAGA-mediated
            deubiquitination of histone H2B
          Length = 454

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 61/131 (46%), Gaps = 26/131 (19%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDL---TKKNSTIVTYPLILNI--VLKSNEV-----VK 1087
             I+ L   ++P  L++ L RF + +   + K +  + +P  L++    ++++V     + 
Sbjct: 334  AIRQLTIAKLPPVLVLQLKRFEHSINGSSVKLNNYIEFPTYLDMSKYCQTDKVGETPAIV 393

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMK 1147
            Y+L G+++H G++  GHYTSI            G  W+ F+D +V             + 
Sbjct: 394  YELIGLISHQGSVNQGHYTSICKIP--------GGQWFKFNDSMVTAVAE--------ID 437

Query: 1148 ISSSDVYVLFY 1158
            +     Y+LFY
Sbjct: 438  VLKEQAYLLFY 448

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 6/59 (10%)

Query: 651 VAPTKRIQQEPFRSATNGLHETYSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCL 709
           +   + +   P     +G+    SIP++E+         + GL N+G+TC+++S+IQ L
Sbjct: 102 IGDNELVACAPLNKVWDGVSTKSSIPSVEKRN------GLAGLVNMGSTCFMSSIIQTL 154

>Kpol_1018.93 s1018 (248094..250361) [2268 bp, 755 aa] {ON}
            (248094..250361) [2268 nt, 756 aa]
          Length = 755

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 17/123 (13%)

Query: 1047 MPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNIVLKSNEVV--KYKLYGVVNHTG- 1098
            +P+ L +HL RF Y   + N+ I     +TYP  L++    +  +  KY+L G++ H G 
Sbjct: 549  LPKILSLHLKRFKYS-EENNANIKLFNKITYPSELHVRSTFDRSISKKYELSGIIIHLGA 607

Query: 1099 NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
                GHY ++   +          GW  +DDE V+       ++H       +  Y+LFY
Sbjct: 608  GPQHGHYVAMCKTE--------KFGWLLYDDETVEAVLEKDVLRHVGDSNDLATAYILFY 659

Query: 1159 ERI 1161
            + I
Sbjct: 660  KTI 662

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 21/37 (56%)

Query: 684 IYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFI 720
           I  S  + G  N GNTCY NS++QCL+     R+  I
Sbjct: 120 IDSSTKVFGFENFGNTCYCNSVLQCLYNFSELRDNLI 156

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 57/140 (40%), Gaps = 35/140 (25%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EFL  +L+ L           +EY      D   L ++  E  + F         
Sbjct: 433 HQDAHEFLNFLLNEL-----------SEY-----IDRSNLKIEETEKTENF--------- 467

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
             I +IFQG + N + C  C + +     F  L + +        SR++   +++ L+ Y
Sbjct: 468 --IKNIFQGTLTNKIRCLTCDNVTSRDEPFLDLPIEVK-------SRNE-TDIKKALSNY 517

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+L+G N + C  CC +
Sbjct: 518 HQREMLNGSNKFYCDGCCGL 537

>TBLA0E02570 Chr5 complement(646995..649352) [2358 bp, 785 aa] {ON}
           Anc_3.270 YBR058C
          Length = 785

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 61/131 (46%), Gaps = 7/131 (5%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+NS++QC F      N  +     EF   V   P  N    ++  T  + 
Sbjct: 327 GLINLGNSCYLNSILQC-FYNGGIPNWSVEELGTEFPLSVV-YPSNNLKCQLLKLTNAMK 384

Query: 752 FKK-MYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVV 810
            +  +Y NG   + P +F K       +F   + QQD  EFL  ++D L +++ N     
Sbjct: 385 IESDLYPNG---IKPTAFKKCIGGSHNEFS-SNRQQDAMEFLTYMIDVLDNKIFNTANNP 440

Query: 811 NEYPDLILYDE 821
           N+    I+ D+
Sbjct: 441 NDTMRFIMEDK 451

>Skud_13.392 Chr13 (690758..692179) [1422 bp, 473 aa] {ON} YMR223W
            (REAL)
          Length = 473

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 73/180 (40%), Gaps = 49/180 (27%)

Query: 1012 VDAQRDIDELREMKEEMKQWKSKKLF---------------TIKTLNFIRMPRTLIIHLS 1056
            +D   DI + +++ E +  +  K+L                 IK L   R+P  L++ L 
Sbjct: 304  MDLSLDIKDKQKLYECLDSFHKKELLKDFNYHCGECNSTQDAIKQLGIHRLPSVLVLQLK 363

Query: 1057 RFYYDLTKKNSTI---VTYPLILNIV-------------LKSNEV--VKYKLYGVVNHTG 1098
            RF + L   N  +   + +P  LN+              + + +V  + Y+L G+V+H G
Sbjct: 364  RFEHLLNGTNRKLDDFIEFPTYLNMKSYCSTAESESENHIGNGKVPDIIYELIGIVSHKG 423

Query: 1099 NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
             +  GHY +            +G  W+ F+D +V   ++   +K           Y+LFY
Sbjct: 424  TVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQEEVLK--------EQAYLLFY 467

>Suva_13.407 Chr13 (697513..698928) [1416 bp, 471 aa] {ON} YMR223W
            (REAL)
          Length = 471

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 73/178 (41%), Gaps = 47/178 (26%)

Query: 1012 VDAQRDIDELREMKEEMKQWKSKKLF---------------TIKTLNFIRMPRTLIIHLS 1056
            +D   DI + +++ E +  +  K+L                 IK L   ++P  L++ L 
Sbjct: 304  MDLSLDIKDKKKLYECLDSFHKKELLKDFNYHCGECNSTQDAIKQLGIHKLPSVLVLQLK 363

Query: 1057 RFYYDLTKKNSTI---VTYPLILNI----VLKSNEV---------VKYKLYGVVNHTGNL 1100
            RF + L   N  +   + +P  LN+     ++ +E          + Y+L G+V+H G +
Sbjct: 364  RFEHLLNGSNRKLDDFIQFPTYLNMKSYCSIRESEKHIGNKKVPDIIYELIGIVSHKGTV 423

Query: 1101 ISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFY 1158
              GHY +            +G  W+ F+D +V   ++   +K           Y+LFY
Sbjct: 424  NEGHYIAFC--------KISGGQWFKFNDSMVSSISQEEVLK--------EQAYLLFY 465

>KAFR0I02600 Chr9 (525365..529006) [3642 bp, 1213 aa] {ON} Anc_5.18
           YMR304W
          Length = 1213

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/221 (22%), Positives = 78/221 (35%), Gaps = 54/221 (24%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFY 749
            G +N G TCY+NS++Q  F TK FR L   +               N S P+ + R FY
Sbjct: 193 VGFKNQGATCYLNSLLQSYFFTKYFRRLVYQIP--------TENDSPNNSVPLALQRAFY 244

Query: 750 ILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAV 809
            L          S  P+  L+       D      Q D  E   +++DRL +++      
Sbjct: 245 QL--------QVSDEPLDTLELTRSFGWDSGDAFTQHDVQELNRILMDRLENKMKGTPV- 295

Query: 810 VNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSF 869
                      E KLN                       +IF G+M++ + C    + S 
Sbjct: 296 -----------EDKLN-----------------------EIFVGRMKSYIKCINVDYESS 321

Query: 870 NYSTFYVLSLAIP--KATSSTFSRSKRVSLEECLNMYTSDE 908
               F+ L + +   K   S+F     + L    N Y + +
Sbjct: 322 RVEEFWDLQMNVKNLKDLKSSFENYIEIELMNGENQYAAQD 362

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/136 (29%), Positives = 62/136 (45%), Gaps = 22/136 (16%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYD-----LTKKNS------TIVTYPLILNIVLKSNEV--V 1086
            K + F   P  L + L RF YD     L K N       +I     I  +  +  E+   
Sbjct: 370  KGVIFESFPPVLHLQLKRFEYDFNYDQLIKVNDRYEFPDSIDVSSYIDKMGTEDTEMPPC 429

Query: 1087 KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHG--DVKHG 1144
             YKL+GV+ H G++ +GHY +++         S  D WY FDDE V + T+    D   G
Sbjct: 430  IYKLHGVLVHAGDISTGHYYAMIKP-------STEDQWYRFDDEKVWKVTKTQVFDENFG 482

Query: 1145 VMKISSSDVYVLFYER 1160
            + +I   +V ++  E+
Sbjct: 483  LDRIPDDEVRLMSREQ 498

>KLLA0E20351g Chr5 (1810593..1812686) [2094 bp, 697 aa] {ON} similar
           to uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 697

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 42/93 (45%), Gaps = 2/93 (2%)

Query: 654 TKRIQQEPFRSATNGLHETYSIP-TIEQN-PNIYVSLSITGLRNLGNTCYINSMIQCLFA 711
           T  I  +P  +       +Y+IP TI  + P    S  + G  N GNTCY NS++QCL+ 
Sbjct: 76  TSDISHDPLHTEVFEYMPSYTIPNTITADLPFGSGSTKVFGYENFGNTCYCNSVLQCLYN 135

Query: 712 TKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI 744
              FR   +    ++ L     K    G +P +
Sbjct: 136 LTEFRTEILKYPSRDGLLRRRRKSSVVGVKPRV 168

 Score = 40.4 bits (93), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 53/140 (37%), Gaps = 34/140 (24%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EFL  +L+ L D L                 + +L+    E K  F         
Sbjct: 400 HQDAHEFLNYLLNELSDTLKR---------------DMELDTDKLESKPTF--------- 435

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
             I+D+F+G + NS  C  C   +     F    + I           + + +++ LN Y
Sbjct: 436 --IEDLFKGSLCNSTKCFTCDTITARDEPFLDFPIEI--------QEDEEIKIQDILNNY 485

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+L+G N + C  CC +
Sbjct: 486 KHRELLTGANKFYCDKCCGL 505

 Score = 38.1 bits (87), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 56/127 (44%), Gaps = 15/127 (11%)

Query: 1040 KTLNFIRMPRTLIIHLSRFYYDLTKK-NSTI---VTYPLILNIVLKSNEVV--KYKLYG- 1092
            +T+    +P+TL IHL RF Y   +  N+ +   + YPL L +    +  V   Y+L G 
Sbjct: 510  RTVGLKSLPKTLAIHLKRFKYSEARNCNAKLFNRIHYPLDLRVCSSFDSAVCKDYELNGI 569

Query: 1093 VVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSD 1152
            V++  G    GHY +I    L         GW  FDDE V+       +K        + 
Sbjct: 570  VIHMGGGPHHGHYVAICKNDL--------FGWLLFDDETVESINEETVLKFIGDANELTT 621

Query: 1153 VYVLFYE 1159
             YVL Y+
Sbjct: 622  AYVLIYK 628

>KLLA0E01013g Chr5 (104991..107315) [2325 bp, 774 aa] {ON} some
            similarities with uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 774

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 58/145 (40%), Gaps = 38/145 (26%)

Query: 1046 RMPRTLIIHLSRFYY-------DLTKKNS------------------TIVTYPLILNIVL 1080
            ++P+ L+I   RF +       DL+  NS                  TI    +  N+V 
Sbjct: 636  KLPQALLIQFKRFSFVSQSSKNDLSNYNSFNGRIEKIRKMVKYNHELTIPKESISPNLVS 695

Query: 1081 KSN--EVVKYKLYGVVNHTGNLIS-GHYT-SIVDKQLDHSLNSNGDGWYYFDDEVVKRET 1136
             SN  E  KY L GV+ H G   S GHYT  + DK LD         WY  DD  V    
Sbjct: 696  TSNSEESFKYYLSGVIYHHGVSPSGGHYTCDVYDKDLDK--------WYRIDDVNVDEIK 747

Query: 1137 RHGDV-KHGVMKISSSDVYVLFYER 1160
               D+ + G     S   Y+L YE+
Sbjct: 748  NKEDILRSGDSASDSRTAYILLYEK 772

 Score = 41.2 bits (95), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 54/130 (41%), Gaps = 19/130 (14%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR----- 746
           G+ N G+ C+I+S++Q L   +SF NL   +      +  +  P  N    V  R     
Sbjct: 338 GIYNKGSICFISSVLQLLIHCRSFVNLLNVIHTTTVSRTNSVSPLLNACMDVFKRFDRET 397

Query: 747 ----------TFYILFKKMYLNGG-CSVVPISFLKSCSLLRPDFK--IPDDQQDTTEFLM 793
                           K   LN    S+ P  F KS S L P FK      Q+D  EFL 
Sbjct: 398 IVNELNETRENSKTKSKSSNLNENIISIDPEPFYKSISTL-PKFKDLTWGRQEDAEEFLT 456

Query: 794 LILDRLHDEL 803
            +LD+LH+E 
Sbjct: 457 HMLDQLHEEF 466

>Kwal_26.9151 s26 complement(1095026..1096390) [1365 bp, 454 aa] {ON}
            YMR223W (UBP8) - putative deubiquitinating enzyme [contig
            70] FULL
          Length = 454

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 49/104 (47%), Gaps = 18/104 (17%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNIVLKSNEV-------VKY 1088
            IK +   ++P  L++ L RF + +   +  +   + YP  LN+    ++        + Y
Sbjct: 335  IKQMTIAKLPPVLVLQLKRFEHLMNGNSVKLNEKIAYPTYLNMAPFCHQSESRPVPDMMY 394

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            +L  V++H G++  GHYTS+            G  W+ F+D ++
Sbjct: 395  ELVAVISHEGSVNQGHYTSMCKIP--------GGQWFRFNDSMI 430

>KLTH0D12760g Chr4 (1045108..1046469) [1362 bp, 453 aa] {ON} similar
            to uniprot|P50102 Saccharomyces cerevisiae YMR223W UBP8
            Ubiquitin-specific protease that is a component of the
            SAGA (Spt-Ada-Gcn5- Acetyltransferase) acetylation
            complex required for SAGA- mediated deubiquitination of
            histone H2B
          Length = 453

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 56/130 (43%), Gaps = 26/130 (20%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNIV-------LKSNEVVKY 1088
            IK +   ++P  L++ L RF + +   N  +   +TYP  LN+         +S   + Y
Sbjct: 334  IKQMTIAKLPPVLVLQLKRFEHLMNGNNVKLNGEITYPAYLNMAPFCHHSEARSVPDMVY 393

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKI 1148
            +L  V++  G++  GHYT +            G  W+ F+D ++   T    ++      
Sbjct: 394  ELVAVISQEGSVNQGHYTCMCKVP--------GGQWFRFNDTMIVSITEEDVLRQ----- 440

Query: 1149 SSSDVYVLFY 1158
                 Y+LFY
Sbjct: 441  ---QAYLLFY 447

>AEL242W Chr5 (182610..184451) [1842 bp, 613 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YPL072W (UBP16)
          Length = 613

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 37/74 (50%), Gaps = 10/74 (13%)

Query: 1048 PRTLIIHLSRFYYDLTK--KNSTIVTYP--LILNIVLKSN------EVVKYKLYGVVNHT 1097
            PR LI+HLSR  ++     KN+  VT+P  L++N  L  N        V+YKL  ++ H 
Sbjct: 388  PRVLILHLSRSVFNGVSYAKNTCNVTFPEELVINEQLLENNKCVGVRAVRYKLCAMIKHI 447

Query: 1098 GNLISGHYTSIVDK 1111
            G    GHY     K
Sbjct: 448  GTHSQGHYACFRHK 461

 Score = 35.0 bits (79), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 48/112 (42%), Gaps = 32/112 (28%)

Query: 780 KIPDDQQDTTEFLMLILDRL---HDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFD 836
           K+   Q D  EF  L+L+ L   H ELS           L+L  +K+L            
Sbjct: 207 KLSRGQNDAHEFTQLLLETLEKEHTELS-----------LMLKGDKRLE----------- 244

Query: 837 KSVIGNGLSPIDDIFQGQMENSLHCQRCGHSS-FNYSTFYVLSLAIPKATSS 887
                 GL+      +G + ++L C RCG SS  N   F + +L +P ATS+
Sbjct: 245 ------GLAVPAFPIRGSLADNLVCLRCGGSSKVNVHQFSMHTLPVPNATSA 290

>NCAS0D00600 Chr4 (102081..103562) [1482 bp, 493 aa] {ON} Anc_1.369
           YFR010W
          Length = 493

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 23/30 (76%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFIS 721
           GL+N+GNTCY+N+ +Q LF   S R+L ++
Sbjct: 108 GLQNMGNTCYMNATLQALFRVDSIRDLILN 137

>KNAG0A05450 Chr1 (806796..809090) [2295 bp, 764 aa] {ON} Anc_2.307
           YDL122W
          Length = 764

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 59/273 (21%), Positives = 104/273 (38%), Gaps = 61/273 (22%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFY 749
           + GL N GNTC++NS++Q L +++   +         FL ++  +   N ++   S  F 
Sbjct: 65  VAGLVNDGNTCFMNSVLQSLASSRELAH---------FLDDIIEESEPNKNELNFSVAFK 115

Query: 750 ILFKKMYLNGGCS---VVPISFLKSC-SLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
            L  K+    G +     P + LK+  S    +  +  DQ+D  EF   I+ +L  +L  
Sbjct: 116 TLLDKLNAKYGRNRKYYRPNALLKTMESGPNKNILLGYDQEDAQEFFQQIISQLEKDLKK 175

Query: 806 QDA---------------------VVNEYPDLILYDEKKLNVQNKEY---KKWFDKSVIG 841
           +D                      + ++ P   L +++ L      Y   ++      +G
Sbjct: 176 EDTDGDFKKEESVQPSSEDDKTPILESDLPADALLNQENLEKVGTVYIPTEQVEPNFALG 235

Query: 842 NG-----------LSPIDDIFQGQMENSLHCQRCG-HSSFNYSTFYVLSLAIPKATSSTF 889
            G           L+P+D    G +   + C  CG +    YS    LSL +P       
Sbjct: 236 KGEHESFYTPYKLLTPLD----GIIAERIGCLNCGENGGIRYSVSSGLSLNLPNENIGA- 290

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDCPNCC 922
                + L E L+ +   E++ G    DC  C 
Sbjct: 291 ----TLKLSELLDKWVEPEIIEG---VDCNRCA 316

>AGR139C Chr7 complement(1010460..1012829) [2370 bp, 789 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YER151C
            (UBP3)
          Length = 789

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 56/145 (38%), Gaps = 38/145 (26%)

Query: 1046 RMPRTLIIHLSRF-----------------YYDLTKKNSTIVTYPLILNIVLK------- 1081
            R+PR L+I L RF                 Y    +K    + Y   L I  +       
Sbjct: 653  RLPRVLLIQLKRFEFVNNSSERRELINYNAYNGRIEKIRKWIRYDQELTIPKEALSSVNA 712

Query: 1082 ----SNEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRET 1136
                S +   Y+L GVV H G +   GHYT+ V       L+   D WY  DD  V  E 
Sbjct: 713  KFYLSGKDTTYRLTGVVYHHGLSPSGGHYTADV-------LHQTQDKWYRIDDNNVT-EI 764

Query: 1137 RHGDV-KHGVMKISSSDVYVLFYER 1160
            R  DV K G     S   Y+L Y+R
Sbjct: 765  RQEDVFKRGDEASDSKTAYILIYQR 789

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 56/135 (41%), Gaps = 28/135 (20%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           G+ N GN C+++S++Q L   + F  +   +  +  +K     P   GS       FY  
Sbjct: 350 GIMNKGNICFMSSVLQVLLFCEPFIEMLNVVHARTGVKSWTLLPPLLGS----CLEFYKE 405

Query: 752 FKKMYL-----------NGGC----------SVVPISFLKSCSLLRPDFKIPD--DQQDT 788
           F+K++            NG            ++ P  F K  S L P FK      Q+D 
Sbjct: 406 FEKLHADKDKNDKQSNGNGKSAKANRSSQPDAIDPEHFYKCISKL-PMFKDLQWGHQEDA 464

Query: 789 TEFLMLILDRLHDEL 803
            EFL   LD+LH+E 
Sbjct: 465 EEFLTHFLDQLHEEF 479

>KLLA0A10791g Chr1 complement(934135..935573,935718..935733) [1455
           bp, 484 aa] {ON} similar to uniprot|P43593 Saccharomyces
           cerevisiae YFR010W UBP6 Ubiquitin-specific protease
           situated in the base subcomplex of the 26S proteasome
           releases free ubiquitin from branched polyubiquitin
           chains deletion causes hypersensitivity to cycloheximide
           and other toxic compounds
          Length = 484

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 44/111 (39%), Gaps = 17/111 (15%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GLRN+GNTCY N+ +Q L+  K  R   ++  Y E      P P  +G   +  R  +  
Sbjct: 107 GLRNMGNTCYFNASLQALYRIKPLREKVLA--YNE------PNPDLHGQLVIQLRNCFNA 158

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFLMLIL 796
           F +          PI  L     + P F   D       QQD  E    +L
Sbjct: 159 FAQ---RKEKEFTPIILLTVLRKIYPQFAEKDPSTGFYKQQDAEELFTQLL 206

>SAKL0D10120g Chr4 complement(845029..846491,846566..846581) [1479
           bp, 492 aa] {ON} highly similar to uniprot|P43593
           Saccharomyces cerevisiae YFR010W UBP6 Ubiquitin-specific
           protease situated in the base subcomplex of the 26S
           proteasome releases free ubiquitin from branched
           polyubiquitin chains deletion causes hypersensitivity to
           cycloheximide and other toxic compounds
          Length = 492

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL+N+GNTCY+N+ +Q L+     R   ++     F K+    P  + S  ++ +     
Sbjct: 105 GLKNMGNTCYMNATLQALYQITPLREAILN-----FDKKSGNFPADDESHFLLVQELKRC 159

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785
           F+++      SV PI  L       P F   D Q
Sbjct: 160 FQQLKDKPQESVTPILLLSVLRRCYPQFAERDSQ 193

>Klac_YGOB_Anc_5.18b Chr3 (1201452..1202573,1202576..1204954) [3501
           bp, 1166 aa] {ON} ANNOTATED BY YGOB -
          Length = 1166

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 48/230 (20%), Positives = 81/230 (35%), Gaps = 66/230 (28%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISR 746
             G +N G TCY+NS++Q    TK FR L   +          P    N +  V   + R
Sbjct: 196 FVGFKNQGATCYLNSLLQSYHFTKLFRKLVYQI----------PTEDENPTNSVALALQR 245

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
            FY+L          S  P+   +       D      Q D  E   +++DRL   +   
Sbjct: 246 AFYLL--------QTSKEPLDTTELTKSFGWDTGDAFTQHDVQELNRILMDRLEHRM--- 294

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
                          K  +V+ K                 I+++F G+M++ + C    +
Sbjct: 295 ---------------KGTSVEGK-----------------INELFVGKMKSCIKCINVDY 322

Query: 867 SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAW 916
            S     F+ + L +              +L+E    Y   E+++GEN +
Sbjct: 323 ESSRVEDFWDIQLNVKDMK----------NLQESFEQYIEVELMNGENQY 362

 Score = 37.4 bits (85), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 64/148 (43%), Gaps = 31/148 (20%)

Query: 1013 DAQRDIDELREMKEEMKQWKSKKLFT--------------IKTLNFIRMPRTLIIHLSRF 1058
            D Q ++ +++ ++E  +Q+   +L                 + + F   P  L + L RF
Sbjct: 332  DIQLNVKDMKNLQESFEQYIEVELMNGENQYAAQDHGLQDAQKVVFESFPPVLHLQLKRF 391

Query: 1059 YYD-----LTKKNSTI-----VTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSI 1108
             YD     L K N        +     L+     +    Y L+GV+ H+G++ +GHY ++
Sbjct: 392  EYDFNYDQLIKINDRYEFPESIDLSHYLDSAAPKDTPADYILHGVLVHSGDISTGHYYAM 451

Query: 1109 VDKQLDHSLNSNGDGWYYFDDEVVKRET 1136
            +        +++G  WY FDD+ V + T
Sbjct: 452  IQP------DAHG-SWYRFDDDRVIKAT 472

>ZYRO0B11044g Chr2 complement(869260..871740) [2481 bp, 826 aa] {ON}
            similar to uniprot|Q01477 Saccharomyces cerevisiae
            YER151C UBP3 Ubiquitin-specific protease that interacts
            with Bre5p to co-regulate anterograde and retrograde
            transport between endoplasmic reticulum and Golgi
            compartments inhibitor of gene silencing cleaves
            ubiquitin fusions but not polyubiquitin
          Length = 826

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 71/164 (43%), Gaps = 36/164 (21%)

Query: 1027 EMKQWKSKKLFTI--KTLNFI-RMPRTLIIHLSRF-YYDLTKKNSTIVTY---------- 1072
            E+  +KS   + +  K   FI R+P+ L+I L RF + + T K++++V Y          
Sbjct: 670  ELLPFKSSSGYDVEAKKQTFIDRLPQVLLIQLKRFQFINNTDKDNSMVNYNAYNGRIEKI 729

Query: 1073 --------PLILNIVLKS------NEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSL 1117
                     LI+ I   S      +E  +Y L GV+ H G +   GHYT+ V        
Sbjct: 730  RKKINYEHELIIPIESISSANAYKDENRRYHLTGVIYHHGVSSDGGHYTADV-------Y 782

Query: 1118 NSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            +   D WY  DD  +    +   +K G     S   Y+L Y++I
Sbjct: 783  HRESDKWYRIDDVSIIELEKEDVLKGGEESGDSRTAYILMYQKI 826

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 66/148 (44%), Gaps = 34/148 (22%)

Query: 687 SLSITGLRNLGNTCYINSMIQCLFATKSFRNLF--ISMK--------------------Y 724
           S++  G+ N  N C+++S++Q L   + F N+   +S++                    Y
Sbjct: 375 SVAPRGIVNRANVCFMSSVLQVLLYCRPFINILNVVSVRNVVARAGPIQSKLLDACLNIY 434

Query: 725 KEFLKEV-------APKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRP 777
           K+F K+        A K G+  +  V S +  I    +  +   ++ P  F ++ S + P
Sbjct: 435 KQFDKDTVELEKKNAAKNGSGNNSNVGSGS--IRQSNVVSSISEAIKPDEFYEALSTI-P 491

Query: 778 DFKIPD--DQQDTTEFLMLILDRLHDEL 803
            FK      Q+D  EFL  +LD+LH+E 
Sbjct: 492 KFKDLKWGHQEDAEEFLTHLLDQLHEEF 519

>YMR223W Chr13 (716715..718130) [1416 bp, 471 aa] {ON}
            UBP8Ubiquitin-specific protease that is a component of
            the SAGA (Spt-Ada-Gcn5-Acetyltransferase) acetylation
            complex; required for SAGA-mediated deubiquitination of
            histone H2B
          Length = 471

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/137 (24%), Positives = 57/137 (41%), Gaps = 32/137 (23%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDLTKKNSTI---VTYPLILNI--VLKSNEVVK----- 1087
             IK L   ++P  L++ L RF + L   N  +   + +P  LN+     + E  K     
Sbjct: 345  AIKQLGIHKLPSVLVLQLKRFEHLLNGSNRKLDDFIEFPTYLNMKNYCSTKEKDKHSENG 404

Query: 1088 ------YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDV 1141
                  Y+L G+V+H G +  GHY +            +G  W+ F+D +V   ++   +
Sbjct: 405  KVPDIIYELIGIVSHKGTVNEGHYIAFCK--------ISGGQWFKFNDSMVSSISQEEVL 456

Query: 1142 KHGVMKISSSDVYVLFY 1158
            K           Y+LFY
Sbjct: 457  K--------EQAYLLFY 465

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 96/237 (40%), Gaps = 38/237 (16%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAP-KPGANGSQPVISRTF 748
           ++GL N+G+TC+++S++QCL     F    +S  +    K  +P K  +     ++   +
Sbjct: 136 LSGLINMGSTCFMSSILQCLIHNPYFIRHSMSQIHSNNCKVRSPDKCFSCALDKIVHELY 195

Query: 749 YILFKKMYLNGGCSV---VPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN 805
             L  K   +   S        +L +C+           QQD  EF   I++++H     
Sbjct: 196 GALNTKQASSSSTSTNRQTGFIYLLTCAWKINQNLAGYSQQDAHEFWQFIINQIH----- 250

Query: 806 QDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRC- 864
           Q  V++      L + K+++  N +  +             +  +F+G +E+S+ C  C 
Sbjct: 251 QSYVLD------LPNAKEVSRANNKQCECI-----------VHTVFEGSLESSIVCPGCQ 293

Query: 865 GHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
            +S      F  LSL I            +  L ECL+ +   E L   N + C  C
Sbjct: 294 NNSKTTIDPFLDLSLDIK----------DKKKLYECLDSFHKKEQLKDFN-YHCGEC 339

>KLTH0H07370g Chr8 (655985..658330) [2346 bp, 781 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 781

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 33/137 (24%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNL--FISMK-------------------YKEFLKE 730
           G+ N GN C+++S++Q L   + F NL   IS+K                   Y++F K+
Sbjct: 348 GIVNTGNICFMSSILQVLLFCEPFVNLMNLISVKTSAKMGSTGFLLLDACLELYRKFDKQ 407

Query: 731 VAPKPGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIP--DDQQDT 788
              +  A+ S   ++ +  +           ++ P  F K+ S L P FK      Q+D 
Sbjct: 408 AFEREKASRSSSGVNISSAL---------ADAIKPDDFYKTLSKL-PKFKDLRWGHQEDA 457

Query: 789 TEFLMLILDRLHDELSN 805
            EFL  +LD+LH+E  N
Sbjct: 458 EEFLTHLLDQLHEEFVN 474

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 57/150 (38%), Gaps = 35/150 (23%)

Query: 1040 KTLNFI-RMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVV------------ 1086
            K   FI ++P   +I L RF +      S IV Y      V K  + +            
Sbjct: 639  KKQTFIDKLPEVFLIQLKRFSFINNTDKSKIVNYNAYSGHVEKIRKKIHYGHELAIPDAT 698

Query: 1087 --------------KYKLYGVVNHTGNLIS-GHYTSIVDKQLDHSLNSNGDGWYYFDDEV 1131
                           YKL GVV H G   S GHYT  V ++   +LN     WY  DD  
Sbjct: 699  ISSVHSSFYKEAGTNYKLIGVVYHHGVSPSGGHYTCDVYQE---TLNK----WYRIDDTN 751

Query: 1132 VKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            V+   +   +K G     S   Y+L Y+++
Sbjct: 752  VQEIEKDEVLKGGEEGNDSRTAYILIYQKL 781

>TBLA0A06470 Chr1 (1588461..1592423) [3963 bp, 1320 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1320

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFI--SMKYKEFLKEVA 732
            GL N+GNTCY+NS++Q  F+ K  R+  +   M  K F  E+ 
Sbjct: 762 AGLNNIGNTCYLNSLLQYYFSIKPLRDFILQYQMTMKHFQNEIV 805

>YFR010W Chr6 (165067..166566) [1500 bp, 499 aa] {ON}
           UBP6Ubiquitin-specific protease situated in the base
           subcomplex of the 26S proteasome, releases free
           ubiquitin from branched polyubiquitin chains; works in
           opposition to Hul5p polyubiquitin elongation activity;
           mutant has aneuploidy tolerance
          Length = 499

 Score = 41.2 bits (95), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 7/109 (6%)

Query: 679 EQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGAN 738
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R++ ++    + +     +    
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLRDMILNYNPSQGVSNSGAQDEEI 156

Query: 739 GSQPVIS--RTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785
             Q VI   R F  L  K +     SV+PI  L +     P F   D Q
Sbjct: 157 HKQIVIEMKRCFENLQNKSF----KSVLPIVLLNTLRKCYPQFAERDSQ 201

 Score = 35.4 bits (80), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 1088 YKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            Y L GV+ H G N  SGHY + +  +LD       + WY F+D+ V
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDE------NKWYKFNDDKV 469

>SAKL0H18656g Chr8 (1658629..1660947) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|Q01477 Saccharomyces
           cerevisiae YER151C UBP3 Ubiquitin-specific protease that
           interacts with Bre5p to co-regulate anterograde and
           retrograde transport between endoplasmic reticulum and
           Golgi compartments inhibitor of gene silencing cleaves
           ubiquitin fusions but not polyubiquitin
          Length = 772

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/159 (25%), Positives = 64/159 (40%), Gaps = 20/159 (12%)

Query: 673 YSIPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLK--- 729
           Y+I  +    N   S+   G+ N GN C+++S++Q L   K F ++   + Y+   K   
Sbjct: 315 YTIENVPNAGNAIDSIVPRGIVNTGNICFMSSVLQVLLYCKPFISILNVISYRTVAKIGS 374

Query: 730 EVAPKPGA--------------NGSQPVISRTFYILFKKMYLNGGCSVVPISFLKSCSLL 775
            V+P   A              N  +PV                   + P  F K+ S L
Sbjct: 375 SVSPSLDACLELYRRFDKQTCENEKKPVPKSKLANGNNVGITPAAEPIKPDDFYKTLSKL 434

Query: 776 RPDFKIP--DDQQDTTEFLMLILDRLHDELSNQDAVVNE 812
            P F+      Q+D  EFL  +LD+LH+E       +NE
Sbjct: 435 -PKFRDLRWGHQEDAEEFLTHLLDQLHEEFITSIDALNE 472

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 56/150 (37%), Gaps = 35/150 (23%)

Query: 1040 KTLNFI-RMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVV------------ 1086
            K   FI ++P+ L+I L RF +        IV Y      V K  + +            
Sbjct: 630  KKQTFIDKLPQVLLIQLKRFSFINNTDKDKIVNYNAYSGRVEKIRKKIHYNHELTIPKET 689

Query: 1087 --------------KYKLYGVVNHTGNLISG-HYTSIVDKQLDHSLNSNGDGWYYFDDEV 1131
                          KYKL GVV H G   SG HYT+ V  Q         D W+  DD  
Sbjct: 690  ISSVHSNFYDDAGTKYKLVGVVYHHGVSPSGGHYTADVYHQ-------EMDKWFRIDDVN 742

Query: 1132 VKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            +    +   +K G     S   Y+L Y++I
Sbjct: 743  IAELNKEEVLKGGEDGFDSRTAYILMYQKI 772

>Kwal_55.21393 s55 (816177..819878) [3702 bp, 1233 aa] {ON} YOR124C
           (UBP2) - Ubiquitin-specific protease [contig 130] FULL
          Length = 1233

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQ 741
           TGL N+GNTCY+NS++Q  F     R   +   Y++ L E     G  GS+
Sbjct: 703 TGLNNIGNTCYLNSLLQYYFCISPLRQFIVD--YQKTLAEFHDSIGNLGSK 751

>NCAS0B00580 Chr2 (86690..88090) [1401 bp, 466 aa] {ON} Anc_8.742
          Length = 466

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 18/104 (17%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKN---STIVTYPLILNI-------VLKSNEVVKY 1088
            IK     ++P  L++ L RF + +   N   +  V YPL LN+         +    + Y
Sbjct: 347  IKQFTINKLPPMLVLQLKRFEHFVNGTNVKLNEFVQYPLYLNMRDYCDRNTNQETPDIIY 406

Query: 1089 KLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            +L G+++H G++  GHY  +        L  N   W+ F+D ++
Sbjct: 407  ELTGILSHIGSINEGHYVVV--------LKINDGRWFKFNDSMI 442

>Ecym_1166 Chr1 (339106..341196) [2091 bp, 696 aa] {ON} similar to
            Ashbya gossypii AEL242W
          Length = 696

 Score = 40.8 bits (94), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 39/79 (49%), Gaps = 14/79 (17%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIVLKSNEV----------V 1086
            +K    +  P+ L++HLSR  +D     KNS  V +P   +++L   E+          V
Sbjct: 395  LKRTVVVSSPKVLLLHLSRSVFDGVTYTKNSCNVLFPE--DLILNEQEIKEDRCIAVHCV 452

Query: 1087 KYKLYGVVNHTGNLISGHY 1105
            +YKL  ++ HTG    GHY
Sbjct: 453  RYKLQAMIKHTGTHFQGHY 471

>TDEL0B03670 Chr2 complement(656511..657902) [1392 bp, 463 aa] {ON}
            Anc_8.742 YMR223W
          Length = 463

 Score = 40.8 bits (94), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 57/132 (43%), Gaps = 27/132 (20%)

Query: 1038 TIKTLNFIRMPRTLIIHLSRFYYDL---TKKNSTIVTYPLILNI--VLKSNEV------V 1086
             IK L+  ++P  L++ L RF + L   + K +  + YP  LN+     S +       +
Sbjct: 342  AIKRLSIYKLPSVLVLQLKRFEHLLNGNSLKLNDFIEYPPYLNMRDYCSSGDSDVDVPDL 401

Query: 1087 KYKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVM 1146
             Y+L GVV H G +  GHY +             G  W+ F+D +V   T+   +     
Sbjct: 402  IYELIGVVAHKGTVNEGHYVATTKVA--------GRQWFKFNDSMVSSVTQEEAL----- 448

Query: 1147 KISSSDVYVLFY 1158
               +   Y+LFY
Sbjct: 449  ---NEQAYLLFY 457

 Score = 40.0 bits (92), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 100/260 (38%), Gaps = 63/260 (24%)

Query: 675 IPTIEQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPK 734
           +P++E+   ++      GL NLG+TC+++S++Q L     F N  IS  + +      PK
Sbjct: 127 VPSVERRDGLH------GLLNLGSTCFMSSILQILIRNPYFFNFSISQSHSKKCPIQDPK 180

Query: 735 PGANGSQPVISRTFYILFKKMYLNGGCSVVPISFLKS-CSLLRPDFKIPDD-----QQDT 788
              + +   +   FY      Y  G   V P +       LL   +KI ++     QQD 
Sbjct: 181 SCISCALEKMVCEFY--GSSAYSTG--DVEPQAMYSGFIGLLVCSWKINENLAGYSQQDA 236

Query: 789 TEFLMLILDRLHDEL------SNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGN 842
            EF   +L++LH +          DA+ ++    I +                       
Sbjct: 237 HEFWQFLLNQLHHDFQVCSGKGVNDAISDDLCTCIAH----------------------- 273

Query: 843 GLSPIDDIFQGQMENSLHCQRCGH-SSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECL 901
                   FQG +++S+ C  C + S      F  LSL I            + +L  CL
Sbjct: 274 ------STFQGLLKSSIVCPDCQNDSKTTIDPFMDLSLDIK----------DKSNLYNCL 317

Query: 902 NMYTSDEVLSGENAWDCPNC 921
           + +   E L   N + CPNC
Sbjct: 318 DSFHKKERLHDFN-YHCPNC 336

>TDEL0B03060 Chr2 (545366..547570) [2205 bp, 734 aa] {ON} Anc_8.540
            YPL072W
          Length = 734

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 10/77 (12%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLT--KKNSTIVTYPLILNI---VLKSNEVV-----KY 1088
            +K    +  P+TL++HLSR  +D    ++NS  V +  IL     V++ N+ V      Y
Sbjct: 424  VKKTVVVESPKTLVMHLSRSMFDGISYQRNSCGVAFDEILESREQVIRHNKCVGINPISY 483

Query: 1089 KLYGVVNHTGNLISGHY 1105
            KL  +V H+G+   GHY
Sbjct: 484  KLKAIVAHSGSHSQGHY 500

>KAFR0E00930 Chr5 (198914..200410) [1497 bp, 498 aa] {ON} Anc_8.540
            YPL072W
          Length = 498

 Score = 40.8 bits (94), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 40/77 (51%), Gaps = 10/77 (12%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNI--------VLKSNEVVKY 1088
            IK    I+ P +LI+HLSR  ++     +++  V Y   LN+          +  E +KY
Sbjct: 328  IKKNAVIKEPASLIVHLSRSIFNGATITRSACRVEYEQSLNLQRQVMINDAFERTEPIKY 387

Query: 1089 KLYGVVNHTGNLISGHY 1105
            +L  VV HTG+ + GHY
Sbjct: 388  ELKSVVKHTGSHVQGHY 404

>Kpol_1024.44 s1024 (118060..119550) [1491 bp, 496 aa] {ON}
           (118060..119550) [1491 nt, 497 aa]
          Length = 496

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 42/200 (21%), Positives = 86/200 (43%), Gaps = 22/200 (11%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
           TGL N    CY NS +Q L +  +F  ++++     F  E+  +     ++       Y 
Sbjct: 66  TGLVNTSTECYANSSVQVLASLSNF-TIYLNKVISIFELELKIEKVEKDAKEAFDTYLY- 123

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD--DQQDTTEFLMLILDRLHDELSNQDA 808
                       V+P+ +   C LL    ++ D   ++  + F+ ++   +H  ++    
Sbjct: 124 -----------KVIPVHY-ALCQLLADLQELIDRPRERSVSNFIRILEASIHKRITGGQQ 171

Query: 809 VVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSS 868
             NE   ++L   + L  + +  KK+ ++  +   +      F+G++ + L C  CG +S
Sbjct: 172 DANELTQIVL---EVLQNELESLKKYVNRMELSIEVPRFP--FEGKLASYLSCLNCGQTS 226

Query: 869 F-NYSTFYVLSLAIPKATSS 887
             N STF +L +  P+  S+
Sbjct: 227 IPNISTFNILPIQTPQEYSA 246

 Score = 38.5 bits (88), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 41/78 (52%), Gaps = 11/78 (14%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIVLKSN---------EVVK 1087
            IK  + I  P+ L+IHLSR  Y+  +  +NS  V +   ++I  ++          E+V 
Sbjct: 335  IKKNSIIETPKILMIHLSRSIYNGMVAVRNSCRVRFEEKMSIERQTTDEKNENLKIELVD 394

Query: 1088 YKLYGVVNHTGNLISGHY 1105
            Y+L  ++ HTG   SGHY
Sbjct: 395  YQLQSIIKHTGTHNSGHY 412

>TBLA0B01930 Chr2 (439859..442918) [3060 bp, 1019 aa] {ON} Anc_8.202
            YER151C
          Length = 1019

 Score = 40.8 bits (94), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 62/150 (41%), Gaps = 36/150 (24%)

Query: 1040 KTLNFI-RMPRTLIIHLSRF-YYDLTKKNSTIVTY------------------------P 1073
            K   FI ++P  L+IHL RF + + T K++++  Y                         
Sbjct: 878  KKQTFIDKLPTVLLIHLKRFSFINNTDKDNSMANYNAYHGRIEKIRKKISYNHELVIPAE 937

Query: 1074 LILNIVLKSNEVVKYKLYGVVNHTG-NLISGHYTS-IVDKQLDHSLNSNGDGWYYFDDEV 1131
             I N    + E   Y+L GVV H G +   GHYT+ I  K++D         WY  DD  
Sbjct: 938  TITNGKQLAPENRTYELTGVVYHHGLSSDGGHYTADIYHKEVDK--------WYRIDDVT 989

Query: 1132 VKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
            V    +   +K G     S   Y+L Y+++
Sbjct: 990  VTELEKDDVLKGGENSTDSRTAYILMYQKL 1019

 Score = 33.5 bits (75), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 70/171 (40%), Gaps = 48/171 (28%)

Query: 673 YSIPTIEQNPNIYV-SLSITGLRNLGNTCYINSMIQCLFATKSFRNLF--ISMK------ 723
           Y++ T+  + +I + S+   G+ N  N C+++S++Q L   K F ++   IS++      
Sbjct: 550 YTLKTLPASSSIPIKSIVPRGIINNANICFMSSVLQVLLYCKPFIDILNVISLRNTNSKS 609

Query: 724 --------------YKEFLKEVAPK-------------PGANGSQPVISRTFYILFKKMY 756
                         YK+F +E   K              G+N  Q   S +         
Sbjct: 610 NASSFKLIDACVEFYKQFDEETVAKEKLDAINKTTLQDAGSNNKQKAHSASVN------- 662

Query: 757 LNGGCSVVPISFLKSCSLLRPDFKIPD----DQQDTTEFLMLILDRLHDEL 803
            N   +  P++  +  S L   +K  D     Q+D  EFL  +LD+LH+E 
Sbjct: 663 -NNNGNPSPLNPEQFYSALSTIYKFKDLGWGHQEDAEEFLTHMLDQLHEEF 712

>Smik_7.314 Chr7 (526664..528163) [1500 bp, 499 aa] {ON} YFR010W
           (REAL)
          Length = 499

 Score = 40.4 bits (93), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 50/122 (40%), Gaps = 13/122 (10%)

Query: 679 EQNPNIYVSLSITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGAN 738
           EQ    +  L + G +N+GNTCY+N+ +Q L+     R + ++    + +     +    
Sbjct: 98  EQQVQQFAQLPV-GFKNMGNTCYLNATLQALYRVNDLREMILNYNPSQGVSNNGVQDEET 156

Query: 739 GSQPVI--SRTFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTE 790
             Q VI   R F  L  K +     SV+PI  L +     P F   D       QQD  E
Sbjct: 157 HKQIVIEMKRCFENLQNKSF----KSVLPIVLLNTLRKCYPQFAERDPQGGFYKQQDAEE 212

Query: 791 FL 792
             
Sbjct: 213 LF 214

 Score = 35.4 bits (80), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 1088 YKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            Y L GV+ H G N  SGHY + +  +LD       + WY F+D+ V
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDE------NKWYKFNDDKV 469

>CAGL0K10252g Chr11 complement(998144..1001947) [3804 bp, 1267 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124c UBP2 ubiquitin-specific proteinase
          Length = 1267

 Score = 40.8 bits (94), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 30/47 (63%), Gaps = 2/47 (4%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGA 737
           TG+ N+GNTCY+NS++Q  FA    R   +  +Y++ + +++  P +
Sbjct: 722 TGINNIGNTCYLNSLLQFYFAISPLREYIV--QYQKTIADLSSNPDS 766

>TPHA0D04350 Chr4 complement(934597..937161) [2565 bp, 854 aa] {ON}
            Anc_8.202 YER151C
          Length = 854

 Score = 40.8 bits (94), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 33/148 (22%)

Query: 1040 KTLNFI-RMPRTLIIHLSRF-YYDLTKKNSTIVTYPLILNIVLK-------SNEVV---- 1086
            K   FI R+P+ L++ L RF + +   K++ ++ Y  I   + K        +E+V    
Sbjct: 714  KKQTFIDRLPQVLLVQLKRFSFVNNEDKDNNMMNYNSINGRIEKIRKKISYGHELVIPEE 773

Query: 1087 ------------KYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVK 1133
                        KY+L GV+ H G +   GHYT+ V        N   D WY  DD  + 
Sbjct: 774  SLSPHSWSQTNRKYQLTGVIYHHGLSSDGGHYTADV-------FNKTADKWYRIDDINIT 826

Query: 1134 RETRHGDVKHGVMKISSSDVYVLFYERI 1161
               +   +K G     +   Y+L Y+++
Sbjct: 827  ELKKDDVLKGGEDGTDTRTAYILMYQKL 854

>AEL029W Chr5 (580062..581402) [1341 bp, 446 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR010W (UBP6)
          Length = 446

 Score = 40.0 bits (92), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 24/94 (25%), Positives = 42/94 (44%), Gaps = 5/94 (5%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           G+ N+GNTCY+N+ +Q L+     R   ++   K+     A   G +     + R     
Sbjct: 61  GIVNMGNTCYMNATLQGLYGIVPLREQILAFDDKK-----ATAEGMDLYHVQLIREIQAT 115

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785
           F+K+    G ++ P+  L+    + P F   D Q
Sbjct: 116 FRKLRDKKGEAITPMLLLEILRRVFPQFSEMDRQ 149

>KNAG0C01940 Chr3 complement(375973..377472) [1500 bp, 499 aa] {ON}
           Anc_1.369 YFR010W
          Length = 499

 Score = 39.7 bits (91), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 22/36 (61%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEF 727
           G +N+GNTCY+N+ +Q LF     R L ++   K F
Sbjct: 109 GFKNMGNTCYLNATLQSLFRMDQLRELILNYDPKAF 144

>ZYRO0G01606g Chr7 complement(123893..127810) [3918 bp, 1305 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1305

 Score = 40.0 bits (92), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 20/26 (76%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716
           TGL N+GNTCY+NS++Q  F+  S R
Sbjct: 733 TGLNNIGNTCYLNSLLQYYFSISSLR 758

>AGR370W Chr7 (1416579..1418801) [2223 bp, 740 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER098W (UBP9) and
           YBL067C (UBP13)
          Length = 740

 Score = 39.7 bits (91), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 19/27 (70%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + GL N GNTCY NS++QCL+  K  R
Sbjct: 98  VFGLENYGNTCYCNSVLQCLYNLKELR 124

 Score = 38.9 bits (89), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 847 IDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTS 906
           I  +FQG M NS+ C  C + + N   F+    AIP       S  + +++++ L  +  
Sbjct: 464 IHTLFQGTMNNSIKCLTCDNITSNEEPFF--DFAIP------VSEDEELNVQDILRDFHQ 515

Query: 907 DEVLSGENAWDCPNC 921
            E+L+G N + C +C
Sbjct: 516 REMLNGANKFYCDSC 530

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 49/113 (43%), Gaps = 15/113 (13%)

Query: 1054 HLSRFYYDLTKKNS----TIVTYPLILNIVLKSNEVV--KYKLYGVVNHTGNLIS-GHYT 1106
            HL RF Y    +++     ++ YPL L +    +  V   Y+L G+V H G     GHY 
Sbjct: 552  HLKRFKYSEKHQSNIKLFNVIHYPLNLRVCSTFDHAVCKDYELNGIVIHMGGGPQHGHYV 611

Query: 1107 SIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYE 1159
            +I   +L         GW  +DDE V+       ++        +  YVLFY+
Sbjct: 612  AICKHEL--------FGWLLYDDETVESVGEDAVLRFIGDVNDMTTAYVLFYK 656

>Skud_6.94 Chr6 complement(173619..175118) [1500 bp, 499 aa] {ON}
           YFR010W (REAL)
          Length = 499

 Score = 39.7 bits (91), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 42/97 (43%), Gaps = 6/97 (6%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVIS--RTF 748
            G +N+GNTCY+N+ +Q L+     R++ ++    +       +      Q +I   R F
Sbjct: 109 VGFKNMGNTCYLNATLQALYRVDDLRDMILNYNPSQEASNSGVQDEETHKQIIIEMKRCF 168

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQ 785
             L  K +     SV+PI  L +     P F   D Q
Sbjct: 169 ENLQNKSF----KSVLPIVLLNTLRKCYPQFAERDAQ 201

 Score = 35.4 bits (80), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 7/46 (15%)

Query: 1088 YKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            Y L GV+ H G N  SGHY + +  +LD       + WY F+D+ V
Sbjct: 430  YNLIGVITHQGANSESGHYQAFIRDELDE------NKWYKFNDDKV 469

>KNAG0B04190 Chr2 (795803..799591) [3789 bp, 1262 aa] {ON} Anc_5.443
           YOR124C
          Length = 1262

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFIS 721
           GL N+GNTCY+NS++Q  FA    RN   S
Sbjct: 726 GLNNIGNTCYLNSLLQYYFAIAPLRNYICS 755

>TPHA0E01710 Chr5 (343977..347828) [3852 bp, 1283 aa] {ON} Anc_5.443
           YOR124C
          Length = 1283

 Score = 40.0 bits (92), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 22/31 (70%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS 721
           TGL N+GNTCY+NS++Q  FA    R+  I+
Sbjct: 747 TGLNNIGNTCYLNSLLQYYFAISPLRDEIIN 777

>TDEL0A01620 Chr1 (291670..294057) [2388 bp, 795 aa] {ON} Anc_8.202
            YER151C
          Length = 795

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 62/148 (41%), Gaps = 34/148 (22%)

Query: 1040 KTLNFI-RMPRTLIIHLSRFYY--DLTKKNSTI---------------VTYPLILNIVLK 1081
            K   FI ++P+ L+I L RF +  +  K NS I               + Y   L I ++
Sbjct: 654  KKQTFIDKLPQVLLIQLKRFQFINNTDKDNSMINYNAYNGRIEKIRKKINYEHELMIPIE 713

Query: 1082 S--------NEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
            S        +E  +Y L GV+ H G +   GHYT+ V        +   D WY  DD  +
Sbjct: 714  SISSTNALRDEDRQYSLSGVIYHHGLSSDGGHYTADV-------YHKETDKWYRIDDINI 766

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYER 1160
                +   +K G   + S   Y+L Y++
Sbjct: 767  TEVQKDSVLKGGEDGVDSRTAYILMYQK 794

>AFR551W Chr6 (1427498..1428907) [1410 bp, 469 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YMR223W (UBP8)
          Length = 469

 Score = 39.7 bits (91), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 47/106 (44%), Gaps = 21/106 (19%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDLTKKNSTIVTYPLILNIVLKSNEVVK----------- 1087
            I+ L+  ++P  L++ L RF + +   +  I  Y +  ++ L   +  K           
Sbjct: 352  IRQLSMAKLPPVLMLQLKRFEHLINGTSVKINDY-IFFSVDLNMKDYCKPMDDQHPVPNL 410

Query: 1088 -YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
             +KL  ++ H G +  GHYT+I           NGD W  F+D +V
Sbjct: 411  TFKLSAIIPHQGTVDKGHYTTIC--------RINGDVWAKFNDSMV 448

>NDAI0H03550 Chr8 complement(865851..867359) [1509 bp, 502 aa] {ON}
           Anc_1.369 YFR010W
          Length = 502

 Score = 39.3 bits (90), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 45/110 (40%), Gaps = 15/110 (13%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISRTF 748
           G +N+GNTCY+N+ +Q L+ T   R + +   YK   +     P       +   I R F
Sbjct: 112 GFQNMGNTCYMNATLQALYRTDDIRQMILD--YKPPAQSSTYNPEDEMHHKIVLEIKRCF 169

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFL 792
             L KK +     SV+P+  L       P F   D       QQD  E  
Sbjct: 170 ENLEKKNFK----SVMPMMLLTVLRKCYPQFAERDPRGGFYKQQDAEELF 215

>KNAG0A01970 Chr1 (157670..159085) [1416 bp, 471 aa] {ON} Anc_8.540
            YPL072W
          Length = 471

 Score = 38.9 bits (89), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 43/149 (28%), Positives = 58/149 (38%), Gaps = 41/149 (27%)

Query: 1048 PRTLIIHLSRFYYDLTK--KNSTIVTYPLILNIVLK------SNEVVKYKLYGVVNHTGN 1099
            P  L +HLSR  ++     +N   V YP  L IVL+      + E + Y+L  ++ HTG 
Sbjct: 328  PSILSLHLSRSMFNGASFTRNPCRVEYPETL-IVLQRDVENGTAERITYRLRSMIKHTGT 386

Query: 1100 LISGHYTSIVDKQLDHSLNSNG--------------------------DGW-YYFDDEVV 1132
              SGHY     K     L   G                            W Y+F  + V
Sbjct: 387  HYSGHYQCYKHKPDLVKLMGTGVTVNRSPTVLARPPMIQERVKTPKSVRRWPYWFISDAV 446

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             RE+  G      M   S  VY+LFYER+
Sbjct: 447  VRESNAGK-----MLRESKYVYMLFYERV 470

>KAFR0C04520 Chr3 complement(901847..903330,903422..903437) [1500
           bp, 499 aa] {ON} Anc_1.369 YFR010W
          Length = 499

 Score = 38.9 bits (89), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 44/107 (41%), Gaps = 10/107 (9%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           G +N+GNTCY+N+ +Q L+     R+  ++      +     K G N +   +       
Sbjct: 108 GFKNMGNTCYLNATLQALYRIDDLRDAVLNFD----VSINNDKNGENETHIKLVTELKRC 163

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFL 792
           F+ +      SV+P+  L +     P F   D       QQD  E L
Sbjct: 164 FEGLKNKSFKSVMPVVLLNALRKTYPQFAERDPQSGFYKQQDAEELL 210

>Ecym_5544 Chr5 (1102256..1104760) [2505 bp, 834 aa] {ON} similar to
            Ashbya gossypii AGR139C
          Length = 834

 Score = 39.3 bits (90), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 54/144 (37%), Gaps = 36/144 (25%)

Query: 1046 RMPRTLIIHLSRF-----------------YYDLTKKNSTIVTYPLILNI---------- 1078
            R+P+ L+I L RF                 Y    +K    + Y   L I          
Sbjct: 697  RLPQVLLIQLKRFEFVNNNSERRELVNYNAYNGRIEKICKWIKYDHDLTIPKEALSSINA 756

Query: 1079 -VLKSNEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRET 1136
              L S+    YKL GVV H G +   GHYT+ V       L+ + + WY  DD  V    
Sbjct: 757  KFLFSDNDTSYKLTGVVYHHGLSSSGGHYTADV-------LHQDEEKWYRIDDTTVTEIN 809

Query: 1137 RHGDVKHGVMKISSSDVYVLFYER 1160
            +   V  G     S   Y+L Y+R
Sbjct: 810  KEEVVTGGEEGSHSRTAYILIYQR 833

>KLTH0C06732g Chr3 complement(584097..586241) [2145 bp, 714 aa] {ON}
           some similarities with uniprot|P39967 Saccharomyces
           cerevisiae YER098W UBP9 Ubiquitin-specific protease that
           cleaves ubiquitin-protein fusions
          Length = 714

 Score = 39.3 bits (90), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 36/163 (22%), Positives = 63/163 (38%), Gaps = 30/163 (18%)

Query: 763 VVPISFLKSCSLLRPDFKIPDD-QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDE 821
           V PI F+++  L R +        QD  EFL  +L+ + D ++                 
Sbjct: 380 VSPIQFVET--LKRENILFSSTMHQDAHEFLNFLLNDISDYINAH--------------- 422

Query: 822 KKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAI 881
            K N+Q  E     D     N L+ +D +F+G + N   C  C + ++    F   ++ +
Sbjct: 423 SKNNIQAHETTNPMDD----NHLNFVDRLFKGTLTNRTKCLTCDNMTYRNEPFLDFAIEV 478

Query: 882 PKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNCCKI 924
                          ++  L  Y   E+L+G N + C  CC +
Sbjct: 479 QD--------DGETDIQTTLADYHQKELLNGANKFYCDECCGL 513

>TPHA0J02620 Chr10 complement(580898..584575) [3678 bp, 1225 aa]
           {ON} Anc_5.443 YOR124C
          Length = 1225

 Score = 39.3 bits (90), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716
           TG+ N+GNTCY+NS++Q  F+   FR
Sbjct: 758 TGINNIGNTCYLNSLLQYYFSITLFR 783

>TPHA0A02510 Chr1 (536076..536097,536233..537728) [1518 bp, 505 aa]
           {ON} Anc_1.369 YFR010W
          Length = 505

 Score = 38.9 bits (89), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 13/115 (11%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV-ISRTFYI 750
           G +N+GNTCY+NS +Q LF     +++ ++  YK     ++P+   +    + + + F  
Sbjct: 110 GFQNMGNTCYMNSTLQALFRVDVLKDMILN--YKTEGNNISPEDELHHKIVIELKKCFET 167

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDD------QQDTTEFLMLILDRL 799
           L  K +      VV +S L+ C    P F   D       QQD  E    +   L
Sbjct: 168 LDGKKF-KAVMPVVLLSVLRKC---YPQFAERDSQSGFYKQQDAEELFTQLFQTL 218

>SAKL0F12430g Chr6 (969369..971633) [2265 bp, 754 aa] {ON} similar to
            uniprot|P39967 Saccharomyces cerevisiae YER098W UBP9
            Ubiquitin-specific protease that cleaves
            ubiquitin-protein fusions
          Length = 754

 Score = 38.9 bits (89), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 55/124 (44%), Gaps = 17/124 (13%)

Query: 1046 RMPRTLIIHLSRFYYDLTKKNSTI-----VTYPLILNI--VLKSNEVVKYKLYG-VVNHT 1097
            ++P  L +HL RF Y  T +N  I     + YPL L +     S+   +Y+L G VV+  
Sbjct: 557  QLPHILALHLKRFKYSET-QNCNIKLFNKIRYPLYLKVCSTFDSSICKRYELTGIVVHMG 615

Query: 1098 GNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLF 1157
            G    GHY S+   +          GW  FDDE V+       +K        +  YVLF
Sbjct: 616  GGPHHGHYVSLCKNE--------KFGWLLFDDETVESVDESSVMKFCGDLHDLTTAYVLF 667

Query: 1158 YERI 1161
            Y+ I
Sbjct: 668  YKEI 671

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFR 716
           + G  N GNTCY NS++QCL+    FR
Sbjct: 145 VFGYENFGNTCYCNSVLQCLYNLTEFR 171

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 31/140 (22%), Positives = 52/140 (37%), Gaps = 35/140 (25%)

Query: 785 QQDTTEFLMLILDRLHDELSNQDAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGL 844
            QD  EFL  +L+ L D L  Q +                           D S+I    
Sbjct: 442 HQDAHEFLNFLLNELSDSLQRQIS---------------------------DDSIITPND 474

Query: 845 SPIDDIFQGQMENSLHCQRCGHSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMY 904
           + ID +F+G M N   C  C + +     F    + +        + +    ++E L+ +
Sbjct: 475 NFIDRLFKGTMTNQTKCLTCDNITSRDEPFLDFPIEV--------NGNCETDIQEMLSDF 526

Query: 905 TSDEVLSGENAWDCPNCCKI 924
              E+L+G N + C  CC +
Sbjct: 527 HQKEMLNGSNKFYCDKCCGL 546

>KLTH0F15862g Chr6 (1288742..1292467) [3726 bp, 1241 aa] {ON}
           similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1241

 Score = 38.9 bits (89), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 57/126 (45%), Gaps = 23/126 (18%)

Query: 623 SQHRAPFQSNLNFVTGQILE-ADEDTALQVAPTKRIQQEPFRSATNGLHETYSIPTIEQN 681
           S  +  +Q  LN +  Q+ E A +D  L+V   ++  QEP  S    L  + ++  I Q 
Sbjct: 620 SADKLTYQEALNLL--QVNENASDDVILEVF-QRKWHQEPVSSPDQFLISSSALTKIGQV 676

Query: 682 PNI-----YVSLSI------------TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKY 724
            N      Y+   I            TGL N+GNTCY+NS++Q  F     R   +  +Y
Sbjct: 677 RNSLLINRYLETGIIDVSCLPAGNWPTGLNNIGNTCYLNSLLQYYFCISPLRQSIV--EY 734

Query: 725 KEFLKE 730
           ++ L E
Sbjct: 735 QKTLSE 740

>NDAI0E00810 Chr5 complement(163826..165307) [1482 bp, 493 aa] {ON}
           Anc_8.742
          Length = 493

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 75/181 (41%), Gaps = 7/181 (3%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL N+G+TC+++S++Q L       N  +   +    +   P    + +  +I   FY  
Sbjct: 138 GLVNMGSTCFMSSILQTLIHNPYVVNYSMCQTHYNMCQSKNPLSCTSCALDLIITEFYAT 197

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELS-NQDAVV 810
             K   N       IS L S   +  +F     QQD  EFL  IL+++H++   N    V
Sbjct: 198 ESKG--NNSSHTGFISLLNSLLQVNENFA-GYSQQDAHEFLQFILNQIHNDYKLNSMEDV 254

Query: 811 NEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSP---IDDIFQGQMENSLHCQRCGHS 867
           N      +  +     QN          + GN +S        FQG +++S+ C +C + 
Sbjct: 255 NSGNTTAIAMKTLPGTQNSNNNNNNTNHIHGNDVSCKCLSHSNFQGSLKSSILCPQCNND 314

Query: 868 S 868
           S
Sbjct: 315 S 315

 Score = 36.6 bits (83), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 36/139 (25%), Positives = 55/139 (39%), Gaps = 35/139 (25%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYDL---TKKNSTIVTYPLILNI---VLKSNEVVK----- 1087
            IK L   ++   L+  L RF + L   T K +  + YPL LN+      SN   +     
Sbjct: 365  IKQLTLNKLSPLLVFQLKRFEHLLNGTTVKINDFIEYPLYLNMKTYCQSSNNDTEEEESN 424

Query: 1088 --------YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVVKRETRHG 1139
                    Y+L  +++H G +  GHY  +V          N   W+ F+D +V   T   
Sbjct: 425  SENVPDMIYELTSIISHKGTVNEGHYIVVVK--------VNDGQWFKFNDSMVSAITEEE 476

Query: 1140 DVKHGVMKISSSDVYVLFY 1158
             +K           Y+LFY
Sbjct: 477  ALKQ--------QAYLLFY 487

>Skud_16.209 Chr16 (389855..391366) [1512 bp, 503 aa] {ON} YPL072W
            (REAL)
          Length = 503

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 35/72 (48%), Gaps = 11/72 (15%)

Query: 1045 IRMPRTLIIHLSRFYYDLT-----------KKNSTIVTYPLILNIVLKSNEVVKYKLYGV 1093
            +++P+ L+IHLSR  ++             ++   +  Y  I N+ L  N  + Y L  V
Sbjct: 345  VKLPKVLVIHLSRSTFNGVTYSRNPCNVKFQEEIKLTEYTSIENMKLTENRQIVYNLKSV 404

Query: 1094 VNHTGNLISGHY 1105
            V HTG+   GHY
Sbjct: 405  VKHTGSHSRGHY 416

>KLLA0E02377g Chr5 complement(218647..222309) [3663 bp, 1220 aa]
           {ON} uniprot|O42726 Kluyveromyces lactis UBP2 Ubiquitin
           carboxyl-terminal hydrolase 2
          Length = 1220

 Score = 38.9 bits (89), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 21/31 (67%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS 721
            G+ N+GNTCY+NS++Q  F  K  R+  ++
Sbjct: 698 AGINNVGNTCYLNSLLQFFFTIKPLRDFILN 728

>Kpol_251.7 s251 (12280..13719) [1440 bp, 480 aa] {ON}
           (12280..13719) [1440 nt, 480 aa]
          Length = 480

 Score = 38.5 bits (88), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 54/116 (46%), Gaps = 5/116 (4%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CY+NS++Q LF      +  +     EF  +V         Q +  R    
Sbjct: 322 CGLINLGNSCYMNSVLQLLF-NAGVPDWSLEQIGTEFPLDVVYPSNNILCQLIKLRNAMK 380

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
           +  + Y NG   + P SF +  +    +F     QQD+ EF   ++++L  ++ N+
Sbjct: 381 IEPERYPNG---IKPTSFKRCIAQAHEEFS-SSRQQDSMEFFTFLIEQLDKKVLNK 432

>Smik_2.189 Chr2 complement(335612..337960) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/184 (25%), Positives = 77/184 (41%), Gaps = 44/184 (23%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CY+NS++Q L       N  +     EF  +V   PG N     +   +  
Sbjct: 323 CGLINLGNSCYLNSVMQSLL-NGGIPNWSLDFLGSEFPLDVV-YPGNN-----LKCQWIK 375

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSN---QD 807
           LF  M                     P+F  P+  + TT      + + H+E S+   QD
Sbjct: 376 LFNAMR------------------CEPEF-YPNGIKPTT--FKKCIGQNHEEFSSNRQQD 414

Query: 808 AVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHS 867
           A+           E    + +   +K+F  S+  +G S ++D+ +  ME+ L C +CG  
Sbjct: 415 AM-----------EFLTFLLDLLDRKFF--SIGSSGASNVNDLVRFIMEDRLQCNKCGKV 461

Query: 868 SFNY 871
            ++Y
Sbjct: 462 KYSY 465

>YPL072W Chr16 (418512..420011) [1500 bp, 499 aa] {ON}
            UBP16Deubiquitinating enzyme anchored to the outer
            mitochondrial membrane, probably not important for
            general mitochondrial functioning, but may perform a more
            specialized function at mitochondria
          Length = 499

 Score = 38.1 bits (87), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 27/78 (34%), Positives = 39/78 (50%), Gaps = 11/78 (14%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYD-LTKKNS----------TIVTYPLILNIVLKSNEVVK 1087
            IK    +++P  LI+HLSR  ++ +T   +          T+  Y L  +  +  N  VK
Sbjct: 331  IKKDVVVQLPDILIVHLSRSTFNGITYSRNPCNVKFGERITLSEYTLAESGTITENRQVK 390

Query: 1088 YKLYGVVNHTGNLISGHY 1105
            Y L  VV HTG+  SGHY
Sbjct: 391  YNLKSVVKHTGSHSSGHY 408

>Kpol_1016.1 s1016 (585..4340) [3756 bp, 1251 aa] {ON} (585..4340)
           [3756 nt, 1252 aa]
          Length = 1251

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 20/32 (62%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISM 722
            GL N+GNTCY+NS++Q  FA    R   I+ 
Sbjct: 762 VGLNNIGNTCYLNSLLQYYFAISPLREYLINF 793

>SAKL0G02728g Chr7 complement(223607..227320) [3714 bp, 1237 aa]
           {ON} similar to uniprot|Q01476 Saccharomyces cerevisiae
           YOR124C UBP2 Ubiquitin-specific protease that removes
           ubiquitin from ubiquitinated proteins cleaves at the C
           terminus of ubiquitin fusions capable of cleaving
           polyubiquitin and possesses isopeptidase activity
          Length = 1237

 Score = 38.5 bits (88), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 20/27 (74%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717
           TGL N+GNTCY+NS++Q  F+    R+
Sbjct: 701 TGLNNIGNTCYLNSLLQYYFSISPLRD 727

>Skud_2.177 Chr2 complement(322000..324348) [2349 bp, 782 aa] {ON}
           YBR058C (REAL)
          Length = 782

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 42/191 (21%), Positives = 69/191 (36%), Gaps = 38/191 (19%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYI 750
            GL NLGN+CY+NS++Q L       N  +     EF  +V         Q +       
Sbjct: 323 CGLINLGNSCYLNSVLQSLL-NGGVPNWSLDFLGSEFPLDVVYPASNLKCQWIKLLNAMK 381

Query: 751 LFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQDAVV 810
              ++Y NG   + P +F K       +F   + QQD  EFL  + D L  +  +  +  
Sbjct: 382 CEPEIYPNG---IKPTTFKKCVGKSHEEFS-SNRQQDAMEFLTFLSDLLDRKFFSDSSSA 437

Query: 811 NEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGHSSFN 870
           +  P                                 +D+ +  ME+ L C +CG   ++
Sbjct: 438 DSNP---------------------------------NDLVRFMMEDRLQCNKCGKVKYS 464

Query: 871 YSTFYVLSLAI 881
           Y     + L +
Sbjct: 465 YEPAEAIQLPL 475

>TDEL0D02580 Chr4 (493355..497173) [3819 bp, 1272 aa] {ON} Anc_5.443
           YOR124C
          Length = 1272

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPG 736
           TGL N+GNTCY+NS++Q  F+    R     ++Y+E ++      G
Sbjct: 732 TGLNNIGNTCYLNSLLQYYFSLAPLRRYV--LEYQETMEHFRHHTG 775

>Kpol_219.1 s219 (1..750) [750 bp, 249 aa] {ON} (1..750) [750 nt, 250
            aa]
          Length = 249

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 40/81 (49%), Gaps = 16/81 (19%)

Query: 1083 NEVVKYKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDE-VVKRETRHGD 1140
            NE  KYKL  VV H GN + SGHY + + K+++     N + W  ++DE +V  E     
Sbjct: 182  NEPGKYKLTSVVCHKGNSVQSGHYVAFIKKEIE-----NVERWVLYNDEKIVIAEDLEEL 236

Query: 1141 VKHGVMKISSSDVYVLFYERI 1161
             K+G         Y+  Y R+
Sbjct: 237  SKNG---------YIYIYSRV 248

>Kpol_1062.23 s1062 (51365..55165) [3801 bp, 1266 aa] {ON}
           (51365..55165) [3801 nt, 1267 aa]
          Length = 1266

 Score = 37.7 bits (86), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 18/27 (66%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717
            GL N+GNTCY+NS++Q  F     RN
Sbjct: 726 AGLNNIGNTCYLNSLLQYYFCISPLRN 752

>Smik_16.163 Chr16 (301703..303208) [1506 bp, 501 aa] {ON} YPL072W
            (REAL)
          Length = 501

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 60/143 (41%), Gaps = 23/143 (16%)

Query: 1023 EMKEEMKQWKSKKLFT-------IKTLNFIRMPRTLIIHLSRFYYDLTK----------- 1064
            E+++ +K++   KL         IK    +++P  L++HLSR  ++              
Sbjct: 308  ELEQYIKRYSKDKLHISKVKGKIIKKDVAVQLPDILVVHLSRSTFNGITYCRNPCNVEFG 367

Query: 1065 KNSTIVTYPLILNIVLKSNEVVKYKLYGVVNHTGNLISGHYTSI---VDKQLDHSLNSNG 1121
            +   +  Y L  N  +  N  VKY L  VV HTG+   GHY       D + D    S+ 
Sbjct: 368  ERVKLPEYTLAENRAITENRQVKYNLKSVVKHTGSHSRGHYICYRRKADIRFDKGEESSL 427

Query: 1122 DGWYYFDDEVVKRETRHGDVKHG 1144
            +G     +   K  TR+ D K G
Sbjct: 428  EGASTIVNNEAK--TRNHDQKIG 448

>NDAI0C01550 Chr3 (327953..331840) [3888 bp, 1295 aa] {ON} Anc_5.443
           YOR124C
          Length = 1295

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 2/39 (5%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFI--SMKYKEF 727
           TG+ N+GNTCY+NS++Q  F+    R   +  S  Y++F
Sbjct: 752 TGINNIGNTCYLNSLLQYYFSISPLREYVLGYSKTYEDF 790

>Ecym_4514 Chr4 complement(1025172..1028912) [3741 bp, 1246 aa] {ON}
           similar to Ashbya gossypii ACL164C
          Length = 1246

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 19/27 (70%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717
           TGL N+GNTCY+NS++Q  F     R+
Sbjct: 696 TGLNNIGNTCYLNSLLQYYFTISPLRD 722

>NDAI0E02820 Chr5 (598119..599606) [1488 bp, 495 aa] {ON} Anc_8.540
           YPL072W
          Length = 495

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 57/205 (27%), Positives = 77/205 (37%), Gaps = 54/205 (26%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPV---ISRTF 748
           GL N  N C+INS +Q L    SF     S+  K  L+E       N S P+   +++T 
Sbjct: 75  GLINARNDCFINSSLQALVPLSSFTVYLNSILSK--LQE-----DKNLSLPLHKNLAKTV 127

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFK--IPDDQQDTTEFLMLILDRLHDELSNQ 806
           Y L K +  +   S   I      S +   FK  I   Q D  EF  L+L+ L  EL+  
Sbjct: 128 YELQKLIVDSESYSAELI-----ISTMEHIFKGTISRQQNDAHEFTQLLLETLFKELAVL 182

Query: 807 DAVVNEYPDLILYDEKKLNVQNKEYKKWFDKSVIGNGLSPIDDIFQGQMENSLHCQRCGH 866
              V E P                      K V+GN L                C RCGH
Sbjct: 183 PKGVIEVP---------------------MKGVVGNHLI---------------CIRCGH 206

Query: 867 -SSFNYSTFYVLSLAIPKATSSTFS 890
            S      F +  L +P+ +SS  +
Sbjct: 207 ISQIKEEMFSIYELNVPQCSSSKLT 231

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 16/78 (20%)

Query: 1044 FIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNI--------------VLKSNEVVK 1087
             ++ P+ L+IHLSR  Y+     +N   V +  IL +               + SN  ++
Sbjct: 326  LLQCPKVLLIHLSRSMYNGMAYTRNPCNVEFENILELEEEQMLQSSPGEKTFINSNSKIR 385

Query: 1088 YKLYGVVNHTGNLISGHY 1105
            Y+L  +V HTG+   GHY
Sbjct: 386  YELKSLVKHTGSHYQGHY 403

>TDEL0D02400 Chr4 (467340..467361,467436..468898) [1485 bp, 494 aa]
           {ON} Anc_1.369 YFR010W
          Length = 494

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 47/110 (42%), Gaps = 18/110 (16%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVI---SRTF 748
           G +N+GNTCY+N+ +Q L+  +  R++ +     ++ +     P     + ++    R F
Sbjct: 110 GFQNMGNTCYLNATLQALYRIEPLRDMIL-----DYNQNSTTTPVDETHKKIVVEMKRCF 164

Query: 749 YILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPD------DQQDTTEFL 792
             L  K Y     SV+P+  L +     P F   D       QQD  E  
Sbjct: 165 ENLKSKSY----KSVMPMVLLTALRKCYPQFAERDPQSGFYKQQDAEELF 210

>Suva_8.176 Chr8 complement(312595..316407) [3813 bp, 1270 aa] {ON}
           YOR124C (REAL)
          Length = 1270

 Score = 37.4 bits (85), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723
           TG+ N+GNTCY+NS++Q  F+    R+  ++ +
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLRSYILNYQ 768

>CAGL0I06600g Chr9 (639096..641546) [2451 bp, 816 aa] {ON} similar to
            uniprot|Q01477 Saccharomyces cerevisiae YER151c UBP3
            ubiquitin-specific proteinase
          Length = 816

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 58/149 (38%), Gaps = 34/149 (22%)

Query: 1040 KTLNFI-RMPRTLIIHLSRF-----------------YYDLTKKNSTIVTYPLILNI--- 1078
            K   FI ++P+ L+I L RF                 Y    +K    ++Y   L I   
Sbjct: 673  KKQTFIDKLPQILLIQLKRFSFISNADKDNGMTNYNAYSGRIEKIRKKISYGHTLEIPDE 732

Query: 1079 -----VLKSNEVVKYKLYGVVNHTG-NLISGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
                  L++N    Y+L GV+ H G +   GHYT+ V        +     WY  DD  +
Sbjct: 733  TLASSALRNNSSKTYELSGVIYHHGMSPDGGHYTADV-------FHKQTKTWYRIDDVNI 785

Query: 1133 KRETRHGDVKHGVMKISSSDVYVLFYERI 1161
             +      +K G   + S   Y+L Y+ +
Sbjct: 786  TKLEDDDVLKGGEDNMDSRTAYILMYQNV 814

>ACL164C Chr3 complement(67792..71961) [4170 bp, 1389 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR124C
           (UBP2)
          Length = 1389

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRNLFIS 721
           TG+ N+GNTCY+NS++Q  F     R   ++
Sbjct: 677 TGINNIGNTCYLNSLLQYYFTISPLREYILA 707

>KAFR0D05070 Chr4 complement(996195..999878) [3684 bp, 1227 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1227

 Score = 37.4 bits (85), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 21/32 (65%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMK 723
           GL N+GNTCY+NS++Q  F+    R   ++ K
Sbjct: 711 GLNNIGNTCYLNSLLQYYFSIAPLREYILNYK 742

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
           Anc_5.443 YOR124C
          Length = 1269

 Score = 37.0 bits (84), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFRN 717
            G+ N+GNTCY+NS++Q  F+    RN
Sbjct: 713 AGINNIGNTCYLNSLLQYYFSIAPLRN 739

>Kwal_14.1957 s14 (549510..550844) [1335 bp, 444 aa] {ON} YER151C
           (UBP3) - Ubiquitin-specific protease [contig 231]
           PARTIAL
          Length = 444

 Score = 37.0 bits (84), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 61/134 (45%), Gaps = 30/134 (22%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNL--FISMKYKEFLKEVAPKPGANGSQPV-----I 744
           G+ N GN C+++S++Q L   + F +L   IS+K        + K G  G   +     +
Sbjct: 10  GIVNSGNICFMSSILQVLLFCEPFVSLMNLISIK-------TSAKMGNTGFLLLDACLEL 62

Query: 745 SRTF-YILF---KKMYLNGGCS---------VVPISFLKSCSLLRPDFKIP--DDQQDTT 789
            R F  + F   K   +N G S         + P  F K+ S L P FK      Q+D  
Sbjct: 63  YRKFDKVTFEREKAARINAGNSGISSALADAIKPDDFYKTLSKL-PKFKDLRWGHQEDAE 121

Query: 790 EFLMLILDRLHDEL 803
           EFL  +LD+LH+E 
Sbjct: 122 EFLTHLLDQLHEEF 135

>Skud_15.286 Chr15 complement(511346..515182) [3837 bp, 1278 aa]
           {ON} YOR124C (REAL)
          Length = 1278

 Score = 37.0 bits (84), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>YOR124C Chr15 complement(554824..558642) [3819 bp, 1272 aa] {ON}
           UBP2Ubiquitin-specific protease that removes ubiquitin
           from ubiquitinated proteins; interacts with Rsp5p and is
           required for MVB sorting of membrane proteins; can
           cleave polyubiquitin and has isopeptidase activity
          Length = 1272

 Score = 37.0 bits (84), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 736 TGINNIGNTCYLNSLLQYYFSIAPLR 761

>Smik_15.301 Chr15 complement(515941..519759) [3819 bp, 1272 aa]
           {ON} YOR124C (REAL)
          Length = 1272

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 19/26 (73%)

Query: 691 TGLRNLGNTCYINSMIQCLFATKSFR 716
           TG+ N+GNTCY+NS++Q  F+    R
Sbjct: 735 TGINNIGNTCYLNSLLQYYFSIAPLR 760

>Kwal_56.23084 s56 complement(392398..394686) [2289 bp, 762 aa] {ON}
           YBR058C (UBP14) - Ubiquitin-specific protease [contig
           183] FULL
          Length = 762

 Score = 36.6 bits (83), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 52/120 (43%), Gaps = 14/120 (11%)

Query: 691 TGLRNLGNTCYINSMIQCLF----ATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISR 746
            GL NLGN+CY+N+++Q LF    ++ S   L       +F  +V         Q +  R
Sbjct: 309 CGLLNLGNSCYMNAVLQVLFNGGVSSWSLDEL------GDFPTDVVYVSSNLKCQLIKLR 362

Query: 747 TFYILFKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDELSNQ 806
                  +MY NG   V P +F         +F     QQD  EF   ++D L  +L N+
Sbjct: 363 NALRTNPEMYPNG---VKPSTFKDCVGGTHEEFS-SGRQQDALEFFSYLIDLLDKKLFNR 418

>KLLA0E08801g Chr5 (784991..787306) [2316 bp, 771 aa] {ON} similar
           to uniprot|P25037 Saccharomyces cerevisiae YDL122W UBP1
           Ubiquitin-specific protease that removes ubiquitin from
           ubiquitinated proteins cleaves at the C terminus of
           ubiquitin fusions irrespective of their size capable of
           cleaving polyubiquitin chains
          Length = 771

 Score = 36.6 bits (83), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 65/310 (20%), Positives = 114/310 (36%), Gaps = 96/310 (30%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISM------KYKEFLKE------------- 730
           + GL N GNTC++NS++QCL ++K       ++        +  + E             
Sbjct: 83  VGGLVNDGNTCFMNSVLQCLASSKELHKFMDTIILDSNDDSQNTIDENGEESDLPNEQST 142

Query: 731 VAPKPGA-----------------------NGSQPVISRTFYI--LFKKM----YLNGGC 761
           V  KP A                       N ++P +  T  +  LF K+    Y N   
Sbjct: 143 VEKKPKATKNKTYGKRKKIAVRQADNELLKNSTEPNMHFTLALQDLFSKLNAKHYRNR-- 200

Query: 762 SVVPISFLKSCSLLRPDFKIPD-------DQQDTTEFLMLILDRLHDELSN--------- 805
                 + K+  LL+   K P+       DQ+D  EF   IL  L   + +         
Sbjct: 201 -----PWFKTNKLLKTMSKAPNRNIILGYDQEDAQEFFQTILSELEKNVESIYGKPEKDP 255

Query: 806 QDAVVNEYPDLILYDEKKLNVQNKEY---KKWFDKSVIGNG---------LSPIDDIFQG 853
           +    ++ P+  +  ++ L      Y   ++    SV+ +G         ++P+D    G
Sbjct: 256 KPVPQDDLPEDAIVGQEHLGEIGDVYIPTEQIDPNSVLASGRKFYSPYKIVTPLD----G 311

Query: 854 QMENSLHCQRCG-HSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSG 912
                + C +CG +    YS F  LSL +P     +      + L + L+ ++  E++ G
Sbjct: 312 ITAERIGCLQCGENGGIRYSVFSGLSLNLPSDNIGS-----PIKLSQLLDEWSKPEIIEG 366

Query: 913 ENAWDCPNCC 922
               DC  C 
Sbjct: 367 ---VDCNRCA 373

>CAGL0H05335g Chr8 complement(512683..514134) [1452 bp, 483 aa] {ON}
            weakly similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072w UBP16
          Length = 483

 Score = 36.2 bits (82), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 61/164 (37%), Gaps = 48/164 (29%)

Query: 1039 IKTLNFIRMPRTLIIHLSRFYYD--LTKKNSTIVTYPLILNIV------LKSNEV---VK 1087
            +K   F+  P   +IHLSR  Y+     +N   V +   L+          SNE    V+
Sbjct: 326  LKQCKFVNAPDIFVIHLSRSTYNGMTFTRNGCKVHFGETLDAFETVACSTSSNEFTKRVR 385

Query: 1088 YKLYGVVNHTGNLISGHYTSIVDKQLDHSLNSNGD------------------------- 1122
            Y+L  +V HTG+  SGHY  +  K +      +GD                         
Sbjct: 386  YRLKSIVIHTGSHYSGHYQVLRRKPIIMKSKVSGDIVNTGTTIGEKKPTVMDSNFRRMKS 445

Query: 1123 -----GWYYFDDEVVKRETRHGDVKHGVMKISSSDVYVLFYERI 1161
                  W   D  V  +E R  D+ +         VY+LFYERI
Sbjct: 446  TTIYPFWLISDTNV--KEKRISDIVN-----EQKSVYMLFYERI 482

>NCAS0B06130 Chr2 complement(1159264..1161576) [2313 bp, 770 aa]
           {ON} Anc_2.307 YDL122W
          Length = 770

 Score = 36.2 bits (82), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 60/269 (22%), Positives = 106/269 (39%), Gaps = 50/269 (18%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATK---SFRNLFISMKYKEFLKEV----APKPGANGSQP 742
           + GL N GNTC++NS++Q L ++K   +F +  I  K++E  +++     P       + 
Sbjct: 90  VGGLVNDGNTCFMNSVLQSLASSKELNAFLDDSIIKKFQEQEEKIQNEEDPNEKEEEEEK 149

Query: 743 VISRTFYILFKKMY--LNGGCSVVPISFLKSCSLLRPDFKIPD-------DQQDTTEFLM 793
            +   F + FK++   LN         + ++  LL+     P+       DQ+D  EF  
Sbjct: 150 DVDVRFSVAFKELLDKLNSK-YYRDKPYFRTNKLLKTMSNAPNKNMLLGYDQEDAQEFFQ 208

Query: 794 LILDRLHDELSNQDAVV--------NEYPDLILYDEKKLNVQNKEY---KKWFDKSVIGN 842
            IL  L   + + D           NE PD  +  +  L      +   ++    SV+ N
Sbjct: 209 NILSELEKNVKSLDPKKFDNTPIPENELPDDAIIGQANLGDVGTVFLPTEQIEPNSVLNN 268

Query: 843 G------------LSPIDDIFQGQMENSLHCQRCG-HSSFNYSTFYVLSLAIPKATSSTF 889
                        ++P+D    G     + C +CG +    YS F  LSL +P     + 
Sbjct: 269 DENDTKFYTPFKLITPLD----GISAERIGCLQCGENGGIRYSVFSGLSLNLPGENIGS- 323

Query: 890 SRSKRVSLEECLNMYTSDEVLSGENAWDC 918
                + L   L  +   E++ G   + C
Sbjct: 324 ----TLKLTGLLKEWIKPEIIEGVECYRC 348

>Kwal_27.11444 s27 complement(802766..805039) [2274 bp, 757 aa] {ON}
           YDL122W (UBP1) - Ubiquitin-specific protease [contig 27]
           FULL
          Length = 757

 Score = 35.8 bits (81), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 67/301 (22%), Positives = 111/301 (36%), Gaps = 77/301 (25%)

Query: 690 ITGLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEV---------APKPGANGS 740
           + GL N GNTC++NS+IQ L ++KS    F+  +  E  KE+           + G  GS
Sbjct: 97  VGGLINDGNTCFMNSVIQSLASSKSLMQ-FLDEELMEASKELENPNETSSAVEEEGNLGS 155

Query: 741 QPVI------SRTFYILFKKMYLNGGCSV------VPISF-------------------- 768
              +       +T+    K++  N           V + F                    
Sbjct: 156 NSELRNRSSSKKTYGKRKKRLTRNAEKDAALEDEGVNMEFSAALKELLEKLNDKYHRDKP 215

Query: 769 -LKSCSLLRPDFKIPD-------DQQDTTEFLMLILDRLHDEL------SNQDAVVNEYP 814
             K+  LL+   K P+       DQ+D  EF   IL  L   +      S++D    E  
Sbjct: 216 YFKTNKLLKTMSKAPNKNIILGYDQEDAQEFFQTILSELEKNIKSLRGKSDKDNEPTELA 275

Query: 815 DL---ILYDEKKLNVQNKEY---KKWFDKSVIGNGLS----PIDDI--FQGQMENSLHCQ 862
           D+    +  +++L      Y   ++     V+G+       P D +    G     + C 
Sbjct: 276 DIPKNAMIGQERLGEMGTVYLPAEQIDPNCVLGHEAKQLFFPFDLVTPLDGITAERIGCL 335

Query: 863 RCG-HSSFNYSTFYVLSLAIPKATSSTFSRSKRVSLEECLNMYTSDEVLSGENAWDCPNC 921
           +CG +    YS F  LSL +P  T  +      + L + L  +   E++ G    +C  C
Sbjct: 336 QCGENGGIRYSVFSGLSLNLPSDTVGS-----ALKLSQLLREWVKPEIIEG---VECNRC 387

Query: 922 C 922
            
Sbjct: 388 A 388

>KLLA0F18700g Chr6 (1718738..1721050) [2313 bp, 770 aa] {ON} similar
           to uniprot|P38237 YBR058C Saccharomyces cerevisiae UBP14
           Ubiquitin-specific protease that specifically
           disassembles unanchored ubiquitin chains
          Length = 770

 Score = 35.4 bits (80), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 49/112 (43%), Gaps = 6/112 (5%)

Query: 692 GLRNLGNTCYINSMIQCLFATKSFRNLFISMKYKEFLKEVAPKPGANGSQPVISRTFYIL 751
           GL NLGN+CY+NS++Q L      RN  +          V P+   +  Q +  R    L
Sbjct: 317 GLLNLGNSCYLNSVLQVLL-NGGIRNWNLDGLGSFPTDVVYPRTNLH-CQLIKIRNAMTL 374

Query: 752 FKKMYLNGGCSVVPISFLKSCSLLRPDFKIPDDQQDTTEFLMLILDRLHDEL 803
            +  Y  G   + P +F K       +F     QQD+ EF   + D+L  E+
Sbjct: 375 QQSRYPEG---IKPTTFKKVIGGSHEEFS-SGRQQDSLEFFSYLSDKLDREI 422

 Score = 32.3 bits (72), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 26/48 (54%), Gaps = 6/48 (12%)

Query: 1086 VKYKLYGVVNHTGNLI-SGHYTSIVDKQLDHSLNSNGDGWYYFDDEVV 1132
             KYKL  V+ H GN + SGHY + + K ++       + W  ++DE +
Sbjct: 703  AKYKLTAVICHKGNSVHSGHYVAFIKKVVE-----GKEQWVLYNDEKI 745

>ZYRO0D03982g Chr4 (324687..327152) [2466 bp, 821 aa] {ON} weakly
            similar to uniprot|Q02863 Saccharomyces cerevisiae
            YPL072W UBP16 Putative ubiquitin-specific protease
          Length = 821

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 40/81 (49%), Gaps = 10/81 (12%)

Query: 1035 KLFTIKTLNFIRMPRTLIIHLSRFYYDLTK--KNSTIVTYPLILNI---VLKSNEVV--- 1086
            K   +K    +  P+ L+IHLSR  ++ T   +N   V +  IL +   V++++  V   
Sbjct: 457  KSTIVKKNVVVDAPQVLLIHLSRSMFNGTNYTRNPCAVNFDEILQLQEQVIQNDRCVGIN 516

Query: 1087 --KYKLYGVVNHTGNLISGHY 1105
               Y+L  +V H G+   GHY
Sbjct: 517  SVNYELKAIVKHAGSHSQGHY 537

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 117,245,377
Number of extensions: 5175813
Number of successful extensions: 15401
Number of sequences better than 10.0: 280
Number of HSP's gapped: 15197
Number of HSP's successfully gapped: 534
Length of query: 1161
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1040
Effective length of database: 39,606,813
Effective search space: 41191085520
Effective search space used: 41191085520
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 71 (32.0 bits)