Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021905.711ON64564532880.0
KLLA0A00418g5.711ON64259320770.0
KAFR0D021705.711ON66060520340.0
TPHA0E001505.711ON64659020290.0
NCAS0G001805.711ON65459620250.0
SAKL0E15114g5.711ON64965820100.0
TDEL0B020905.711ON64359220020.0
Kpol_1043.775.711ON65760420030.0
Kwal_55.196495.711ON64159419920.0
KLTH0E00836g5.711ON64159419880.0
CAGL0H06699g5.711ON65060019850.0
AFR295W5.711ON63159419720.0
ZYRO0B16522g5.711ON64359319480.0
TBLA0E017505.711ON66560019430.0
Ecym_40105.711ON64459219400.0
NDAI0F002105.711ON65359819190.0
YIL155C (GUT2)5.711ON64959919040.0
Skud_9.135.711ON64960318920.0
Smik_9.145.711ON65259918720.0
Suva_9.325.711ON53854117570.0
TBLA0A092905.671ON818115830.20
TBLA0D015305.546ON45360714.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02190
         (645 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5....  1271   0.0  
KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON...   804   0.0  
KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {O...   788   0.0  
TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}...   786   0.0  
NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}...   784   0.0  
SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} high...   778   0.0  
TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {O...   775   0.0  
Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON} (1687...   776   0.0  
Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON...   771   0.0  
KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON...   770   0.0  
CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} simila...   769   0.0  
AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic ho...   764   0.0  
ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} high...   754   0.0  
TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.7...   753   0.0  
Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON} s...   751   0.0  
NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}...   743   0.0  
YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}  GU...   738   0.0  
Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON} Y...   733   0.0  
Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON} Y...   725   0.0  
Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON} Y...   681   0.0  
TBLA0A09290 Chr1 (2292903..2295359) [2457 bp, 818 aa] {ON} Anc_5...    37   0.20 
TBLA0D01530 Chr4 complement(382006..383367) [1362 bp, 453 aa] {O...    32   4.7  

>KNAG0L02190 Chr12 (391987..393924) [1938 bp, 645 aa] {ON} Anc_5.711
           YIL155C
          Length = 645

 Score = 1271 bits (3288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/645 (95%), Positives = 618/645 (95%)

Query: 1   MFRAVTRHKWAVLLGGVAGRGPVWAVNTQRRPIWDDYGDSGTTGPEXXXXXXXXXXXXPD 60
           MFRAVTRHKWAVLLGGVAGRGPVWAVNTQRRPIWDDYGDSGTTGPE            PD
Sbjct: 1   MFRAVTRHKWAVLLGGVAGRGPVWAVNTQRRPIWDDYGDSGTTGPEAVAAAAAAAAAAPD 60

Query: 61  RAKVLQRLQDTKFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKLAHG 120
           RAKVLQRLQDTKFD               DASLRGLKVALVEKADFAAGTSSKSTKLAHG
Sbjct: 61  RAKVLQRLQDTKFDVLVVGGGATGTGVALDASLRGLKVALVEKADFAAGTSSKSTKLAHG 120

Query: 121 GVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAGC 180
           GVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAGC
Sbjct: 121 GVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAGC 180

Query: 181 KMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISAV 240
           KMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISAV
Sbjct: 181 KMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISAV 240

Query: 241 ERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQMD 300
           ERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQMD
Sbjct: 241 ERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQMD 300

Query: 301 ANPQGLPEKEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTSDGRV 360
           ANPQGLPEKEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTSDGRV
Sbjct: 301 ANPQGLPEKEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTSDGRV 360

Query: 361 MFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSAWAGI 420
           MFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSAWAGI
Sbjct: 361 MFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSAWAGI 420

Query: 421 RPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETVDEVIKV 480
           RPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETVDEVIKV
Sbjct: 421 RPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETVDEVIKV 480

Query: 481 GKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAPIICEMF 540
           GKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAPIICEMF
Sbjct: 481 GKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAPIICEMF 540

Query: 541 EADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALDFLLRRSRFA 600
           EADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALDFLLRRSRFA
Sbjct: 541 EADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALDFLLRRSRFA 600

Query: 601 FLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           FLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV
Sbjct: 601 FLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645

>KLLA0A00418g Chr1 complement(33084..35012) [1929 bp, 642 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 642

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/593 (65%), Positives = 465/593 (78%), Gaps = 10/593 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P RA +L RL  T KFD               DAS RGL VALVE  DFA+GTSSKSTK+
Sbjct: 54  PSRANLLSRLSKTDKFDVLIIGGGATGTGCALDASTRGLNVALVEMNDFASGTSSKSTKM 113

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNERAH+L  APHL KILPI+IPVY YW+VPYFY
Sbjct: 114 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLNTAPHLCKILPIMIPVYNYWQVPYFY 173

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            G KMYD FAG+QNLKSSYLLS    S +APMLD  KLK GLVYHDG FNDSR+ ++LAI
Sbjct: 174 VGTKMYDLFAGSQNLKSSYLLSPSRASEVAPMLDASKLKAGLVYHDGSFNDSRMNSSLAI 233

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E+GATV NYV ++QL+K+K TG + GA   D+ETG  + + AK+VVNATGPYSD++L
Sbjct: 234 TAIEKGATVLNYVQIKQLVKNKETGKVEGAIAVDRETGDEYQIKAKVVVNATGPYSDRLL 293

Query: 298 QMDANPQGLPEKEPEKATPENAL----IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353
           QMD +P GLP+    +   ENA     IAV NPKMVVPS GVHI LPSFYCP E+GLLDA
Sbjct: 294 QMDQSPTGLPDDSVLQKINENATVSTKIAVPNPKMVVPSAGVHIVLPSFYCPKEIGLLDA 353

Query: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413
            TSDGRVMFFLPWQGKV+AGTTDIP+KQ+P +P+ TEADIQDIL+ELQHYI FPV+REDV
Sbjct: 354 QTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYINFPVKREDV 413

Query: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473
           LSAWAGIRPLV+DPR A+  +GSG T+ LVRSHF+FTSP+ LVTI+GGKWTTYREMAEET
Sbjct: 414 LSAWAGIRPLVKDPRKAD--SGSGSTQQLVRSHFLFTSPSNLVTISGGKWTTYREMAEET 471

Query: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533
           +DEV+KVG+F   KPC T+K KL+G ++WN N  A L Q+Y  L  +++EHLANNYG RA
Sbjct: 472 IDEVVKVGQFNS-KPCVTKKLKLVGGENWNPNLSALLSQKYH-LSSAMSEHLANNYGTRA 529

Query: 534 PIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDF 592
           P+ICE+F  D  +KLPV L G  +  V  ++D ++F YP+TI ELKY +++EY R  LDF
Sbjct: 530 PLICELFNEDPRNKLPVALAGQENVSVFGHVDYDSFRYPYTIGELKYSLKYEYARNCLDF 589

Query: 593 LLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           L+RR+R+AFLDA++ALNAV+ TV ++GDELGWD++KR  E  +   YIKTFGV
Sbjct: 590 LMRRTRYAFLDAKQALNAVEGTVKVMGDELGWDSKKRQDEIQQATEYIKTFGV 642

>KAFR0D02170 Chr4 complement(435640..437622) [1983 bp, 660 aa] {ON}
           Anc_5.711 YIL155C
          Length = 660

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/605 (62%), Positives = 460/605 (76%), Gaps = 20/605 (3%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R  ++ +L  T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+
Sbjct: 58  PTRNDLISKLNKTNQFDVLVIGGGATGAGCALDATTRGLNVALVEKYDFASGTSSKSTKM 117

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNERAHLL  APHL KILPI+IPVY YW++PYFY
Sbjct: 118 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHLLNTAPHLCKILPIMIPVYNYWQIPYFY 177

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AGCKMYD FAG+QNLKSSYLLS+ + + +APMLD  KLK GLVYHDG FNDSR+ +TLA+
Sbjct: 178 AGCKMYDLFAGSQNLKSSYLLSKRSAADVAPMLDTTKLKAGLVYHDGTFNDSRMNSTLAV 237

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E G+TV NY+ V+QL+K+K +G I GA VED ETG  + + AK+V+NATGPYSD IL
Sbjct: 238 TAIENGSTVLNYMEVKQLLKEKGSGKIEGAIVEDLETGKQYNIKAKVVINATGPYSDAIL 297

Query: 298 QMDANPQGLPEKEPEKATPENAL---IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDAS 354
           QMD NP GLP+         N +   ++V NPKMVVPS GVHI LPSFYCP ++GLLDA 
Sbjct: 298 QMDQNPTGLPDPLNVNLKTNNDIATKVSVSNPKMVVPSAGVHIILPSFYCPKDIGLLDAK 357

Query: 355 TSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVL 414
           TSDGRVMFFLPWQGKV+AGTTD+P+KQ+P +P+ TEADIQDIL+ELQHYI+FPV+REDVL
Sbjct: 358 TSDGRVMFFLPWQGKVLAGTTDVPMKQIPENPTATEADIQDILKELQHYIRFPVKREDVL 417

Query: 415 SAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474
           SAWAGIRPLV+DPR  + + G G T+GLVRSHFIFTS   LVTIAGGKWTTYR MAEETV
Sbjct: 418 SAWAGIRPLVKDPRTLDKN-GDGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYRAMAEETV 476

Query: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534
           DE IKVGKF  +KPC TR  KL G ++WN N QA L QRY  L   L++HLA+NYG RAP
Sbjct: 477 DEAIKVGKFANVKPCITRDIKLAGGENWNPNLQALLAQRYH-LSSKLSQHLADNYGTRAP 535

Query: 535 IICEMFEADKSSKLPVGL---YGDGDDKVKNMDA-----------NAFDYPFTIAELKYC 580
           IICEM+  D+ +KLP+ L   Y + +D+++N +              F YPFT+ E+KY 
Sbjct: 536 IICEMYAKDRKNKLPIALAANYNEHEDEIENANDLIYNNERGDVFECFRYPFTVGEVKYS 595

Query: 581 IRFEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYI 640
           + +EY  TALDFL+RRSRFAFLDA+EA++AV+ TV ++GDEL WD  +R  E   T  YI
Sbjct: 596 VNYEYAITALDFLMRRSRFAFLDAKEAVHAVEGTVKIMGDELNWDESRRHKEIENTIKYI 655

Query: 641 KTFGV 645
           KTFGV
Sbjct: 656 KTFGV 660

>TPHA0E00150 Chr5 complement(11922..13862) [1941 bp, 646 aa] {ON}
           Anc_5.711 YIL155C
          Length = 646

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/590 (64%), Positives = 465/590 (78%), Gaps = 8/590 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R++++  L+ T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+
Sbjct: 62  PTRSELVNNLKTTDQFDVLIIGGGATGSGSALDAATRGLNVALVEKDDFASGTSSKSTKM 121

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAVF+LSK QLDLV+EALNERAHLLY APHL KILPI+IPVY+YW+VPYFY
Sbjct: 122 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYKYWQVPYFY 181

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AG KMYD FAG+QNLKSSYL+S+ N   IAPMLD+ KLK GLVYHDG FNDSR+ +TLAI
Sbjct: 182 AGVKMYDIFAGSQNLKSSYLVSKANACEIAPMLDESKLKAGLVYHDGTFNDSRMNSTLAI 241

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E GATV NY+ V+QL+KD ++  +TGA VED ETG    +NAK++VNATGPYSDKIL
Sbjct: 242 TAIENGATVLNYMEVKQLLKDPSSDQLTGAIVEDIETGEKIQINAKVIVNATGPYSDKIL 301

Query: 298 QMDANPQGLPEKEPEKATPENAL-IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTS 356
           QMD N  G P++  + A    A  +AV+NP MVVPS GVHI LPSFYCP EMGLLDA+TS
Sbjct: 302 QMDNNKNGKPDEFTQSAETSIATKVAVQNPHMVVPSAGVHIILPSFYCPREMGLLDANTS 361

Query: 357 DGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSA 416
           DGRVMFFLPWQGKV+AGTTDIP+K VP +P+ TEADIQDIL+ELQHYI+FPV+REDVLSA
Sbjct: 362 DGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHYIKFPVKREDVLSA 421

Query: 417 WAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETVDE 476
           WAGIRPLV+DPR    +   G T+ LVRSHFIFTS   LVTIAGGKWTTYREMAEET+D 
Sbjct: 422 WAGIRPLVQDPR---KTPKEGATQELVRSHFIFTSDHGLVTIAGGKWTTYREMAEETIDT 478

Query: 477 VIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAPII 536
           V+K GKF  +KPC+TRK KL G ++++ N  A L Q+Y  L   L+EHLANNYG R+P+I
Sbjct: 479 VVKNGKF-NVKPCSTRKLKLAGGENYDPNLAALLAQKYH-LPSKLSEHLANNYGTRSPLI 536

Query: 537 CEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDFLLR 595
           C+MF AD  ++LP+ L G  ++KV   +D ++F YP++IAE+KYC+  EY RT LDFL+R
Sbjct: 537 CDMFVADDHNRLPIYLAGKEENKVYGTVDFDSFRYPYSIAEVKYCVHHEYARTTLDFLMR 596

Query: 596 RSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           RSRFAFLDA++AL +V+ TV ++GDEL WD E+R  E+  +  YIKTFGV
Sbjct: 597 RSRFAFLDAKQALKSVEGTVKIMGDELNWDEERRKQETDYSIEYIKTFGV 646

>NCAS0G00180 Chr7 complement(25495..27459) [1965 bp, 654 aa] {ON}
           Anc_5.711 YIL155C
          Length = 654

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/596 (64%), Positives = 454/596 (76%), Gaps = 10/596 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R+K+LQ+L++  +FD               DA+ RGL+VALVE+ DFA+GTSSKSTK+
Sbjct: 60  PTRSKLLQQLKEKGQFDVLIIGGGATGTGCAVDAATRGLQVALVEQNDFASGTSSKSTKM 119

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA F+LSK QLDLV+EALNERAHLL  APHL KILPI+IPVY YW+VPYFY
Sbjct: 120 AHGGVRYLEKAFFQLSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYTYWQVPYFY 179

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AGCK+YD FAG QNLK+SYLLSR N   +APML+   LK  LVYHDG FNDSRL ATLAI
Sbjct: 180 AGCKLYDLFAGNQNLKNSYLLSRSNAIELAPMLEATNLKAALVYHDGSFNDSRLNATLAI 239

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+ERGATV NYV V++L+KD  TG I G  V D ETG T  V +K+VVNATGP+SDKIL
Sbjct: 240 TAIERGATVLNYVEVQKLLKDSETGTINGVTVRDIETGDTMDVLSKVVVNATGPFSDKIL 299

Query: 298 QMDANPQGLPEK---EPEKATPEN--ALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352
           QMD NP GLP+     P+   PE+  + IAV+NP MVVPS GVHI LPS+YCP +MGLLD
Sbjct: 300 QMDKNPTGLPDDMNLNPKMINPEDISSKIAVKNPNMVVPSSGVHIILPSYYCPKQMGLLD 359

Query: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412
             TSDGRVMFFLPWQGKVIAGTTDIP+ QVP  P   EADIQDIL+ELQHYI+FPV+RED
Sbjct: 360 VRTSDGRVMFFLPWQGKVIAGTTDIPMNQVPETPVAKEADIQDILKELQHYIKFPVKRED 419

Query: 413 VLSAWAGIRPLVRDPRVAEGSAGS--GQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMA 470
           VLSAWAGIRPLVRDPR+         G T+GLVRSHFIFTS   LVTIAGGKWTTYREMA
Sbjct: 420 VLSAWAGIRPLVRDPRLVSPDEKKVLGSTQGLVRSHFIFTSDNGLVTIAGGKWTTYREMA 479

Query: 471 EETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYG 530
           EET+DEV+K G F   KPC TR+ KL GA+ W+ N  A L Q+Y  L   +A +L++NYG
Sbjct: 480 EETIDEVVKNGAFVDAKPCITRELKLAGAEFWDPNISALLSQKYN-LPSMMANYLSDNYG 538

Query: 531 DRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTA 589
            R+PIICE+F  D+ +KLPV L G+  +++  N D N F YP TI ELKY +R+EY RTA
Sbjct: 539 TRSPIICELFLNDEINKLPVLLAGEEKEQILGNTDFNTFRYPITIGELKYSMRYEYARTA 598

Query: 590 LDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           LDFL+RR+RFAFLDA+EAL AV  TV ++GDE  W +E+R  E  KT  +IK+FGV
Sbjct: 599 LDFLMRRTRFAFLDAKEALRAVSGTVKIMGDEFNWSSERRQEEKEKTIQFIKSFGV 654

>SAKL0E15114g Chr5 (1256624..1258573) [1950 bp, 649 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  778 bits (2010), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/658 (59%), Positives = 476/658 (72%), Gaps = 22/658 (3%)

Query: 1   MFRAVTRHK---WAVLLGGVAGRGPVWAVNTQRRPIWDDYGDSGTTGPEXXXXXXXXXXX 57
           MF   TR      A     V G   +W    Q++ + ++  D   T P            
Sbjct: 1   MFANATRRMVVPAAFAAATVGGATILWHQQQQQKSVINN--DVTVTNP-----VQKSKIN 53

Query: 58  XPDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTK 116
            P R  +L +L  T +FD               DA+ RGL VALVE  DFA+GTSSKSTK
Sbjct: 54  LPTRQDLLSKLSKTNQFDVLIIGGGATGTGSALDAATRGLNVALVEMNDFASGTSSKSTK 113

Query: 117 LAHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYF 176
           +AHGGVRYLEKA +ELSK QLDLVVEALNERAH+LY APHL KILPI+IPVY YW+ PYF
Sbjct: 114 MAHGGVRYLEKAFWELSKAQLDLVVEALNERAHMLYTAPHLCKILPIMIPVYNYWQAPYF 173

Query: 177 YAGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLA 236
           Y GCKMYD FAG+QNLKSSY+L+    + +APMLD  KLK GLVYHDG FNDSR+ ATLA
Sbjct: 174 YVGCKMYDLFAGSQNLKSSYMLTASRAAEVAPMLDASKLKAGLVYHDGSFNDSRMNATLA 233

Query: 237 ISAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKI 296
           ++AVE+GATV NY+ V+QLIK++ TG + GA  +D+ETG TF + AK+VVNATGP+SD+I
Sbjct: 234 VTAVEKGATVLNYMEVKQLIKNEQTGKVEGAVAQDRETGETFRIKAKVVVNATGPFSDRI 293

Query: 297 LQMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352
           LQMD + +GLP+    +++  NA I    AV NP+MVVPS GVHI LPSFYCP E+GLLD
Sbjct: 294 LQMDEDSKGLPDDRLLQSSNINATISSKVAVANPQMVVPSAGVHIVLPSFYCPKEIGLLD 353

Query: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412
           A TSDGRVMFFLPWQGKV+AGTTDIP+KQ+P +P+ TEADIQDIL+ELQHYI+FPV+RED
Sbjct: 354 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQIPENPTATEADIQDILKELQHYIKFPVKRED 413

Query: 413 VLSAWAGIRPLVRDPRVAEGS----AGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYRE 468
           VLSAWAGIRPLV+DPR   G       +  T+ LVRSHF+FTS   LVTIAGGKWTTYRE
Sbjct: 414 VLSAWAGIRPLVKDPRKRIGENPHRVAASSTQELVRSHFLFTSDNDLVTIAGGKWTTYRE 473

Query: 469 MAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANN 528
           M+EET++EV+KVGKF   KPC TRK KL GA++++ N  A L Q Y  L   +AE+LANN
Sbjct: 474 MSEETINEVVKVGKFNA-KPCITRKLKLAGAENYDPNLPAMLAQEYH-LSSKMAEYLANN 531

Query: 529 YGDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVR 587
           YG RAP+ICE+F+ D  +KLP+   G  +  V  N+D ++F YPFTI ELKY I  EY R
Sbjct: 532 YGTRAPLICELFKDDDKNKLPMAFGGKENVTVYGNVDFDSFRYPFTIGELKYSINNEYTR 591

Query: 588 TALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           TALDFL+RR+R+AFLDA++AL AVD TV ++GDEL WD+ +R  E  K   +IKTFGV
Sbjct: 592 TALDFLMRRTRYAFLDAKQALTAVDGTVKVMGDELSWDSNRRQEEREKATEFIKTFGV 649

>TDEL0B02090 Chr2 complement(372755..374686) [1932 bp, 643 aa] {ON}
           Anc_5.711 YIL155C
          Length = 643

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/592 (63%), Positives = 456/592 (77%), Gaps = 10/592 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R  +L +L  T +FD               DA+ RGL VALVE  DFA+GTSSKSTK+
Sbjct: 57  PSREDLLSKLSKTDQFDVLVIGGGATGTGCAVDAATRGLNVALVEMHDFASGTSSKSTKM 116

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAVF+LSK QLDLV+EALNER H+L  APHL KILPI+IPVY YW++PYFY
Sbjct: 117 AHGGVRYLEKAVFQLSKAQLDLVIEALNERGHMLNTAPHLCKILPIMIPVYTYWQIPYFY 176

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            GCKMYD FAG+QNLK+SYLL++   + IAPMLD   LK GLVYHDG FNDSR+   LA+
Sbjct: 177 VGCKMYDLFAGSQNLKNSYLLTKRQAADIAPMLDPTTLKAGLVYHDGSFNDSRMNTALAV 236

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E GATV NY+ V+QLIKDK TG + GA V ++ETG  FTV AK+ VNATGPYSDK+L
Sbjct: 237 TAIENGATVLNYMEVKQLIKDKETGKVQGALVTNRETGEQFTVKAKVTVNATGPYSDKLL 296

Query: 298 QMDANPQGLPEKEPEKATPENAL---IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDAS 354
           QMD N  G P  +P K  P   +   +AV NPKMVVPS GVHI LPSFYCP EMGLLD  
Sbjct: 297 QMDENKDGKP--DPTKPLPNATISTKVAVENPKMVVPSAGVHIILPSFYCPREMGLLDVK 354

Query: 355 TSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVL 414
           TSDGRVMFFLPWQGKV+AGTTDIP+KQVP+ P+  E+DIQDILQELQHYI+FPV+REDVL
Sbjct: 355 TSDGRVMFFLPWQGKVLAGTTDIPMKQVPQTPTAAESDIQDILQELQHYIKFPVKREDVL 414

Query: 415 SAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474
           SAWAGIRPLV DPR ++G+ G G T+GLVRSH  FT+   +VTIAGGKWTTYREMAEET+
Sbjct: 415 SAWAGIRPLVIDPRKSQGNTG-GSTQGLVRSHLCFTTDNGMVTIAGGKWTTYREMAEETI 473

Query: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534
           +EV+KVGKF  +KPC TRK KL GA++WN N  A L Q+Y  L  +++ HL+ NYG RAP
Sbjct: 474 NEVVKVGKFN-VKPCITRKLKLSGAENWNPNLAALLAQKYH-LSGAMSNHLSENYGTRAP 531

Query: 535 IICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDFL 593
           +ICEMF+ D+ ++LPV   G  +  V  N++ ++F YPFTI EL Y + +EY RTALDFL
Sbjct: 532 LICEMFQEDERNQLPVTFGGRENVTVYGNVNFDSFRYPFTIGELNYSVDYEYTRTALDFL 591

Query: 594 LRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           +RR+RFAFLDAR+AL+AV+ TV ++GD+L WD+ +R  E  K+K +I+TFGV
Sbjct: 592 MRRTRFAFLDARQALDAVEGTVTVMGDKLNWDSTRRKHEIEKSKEFIRTFGV 643

>Kpol_1043.77 s1043 (168788..170761) [1974 bp, 657 aa] {ON}
           (168788..170761) [1974 nt, 658 aa]
          Length = 657

 Score =  776 bits (2003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/604 (64%), Positives = 465/604 (76%), Gaps = 23/604 (3%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R  +L +L+ T +FD               DA+ RGL VALVEK D+A+GTSSKSTK+
Sbjct: 60  PSRTDLLSKLKKTYQFDVLIIGGGATGTGCAIDAATRGLNVALVEKNDYASGTSSKSTKM 119

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAVF+LSK QLDLV+EALNERAHLLY APHL KILPI+IPVY+YW+VPYFY
Sbjct: 120 AHGGVRYLEKAVFQLSKAQLDLVIEALNERAHLLYTAPHLCKILPIMIPVYQYWQVPYFY 179

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            G KMYD FAG+QNLKSSYLLS+ +   IAPMLD  KLK GLVYHDG FNDSR+ ATLAI
Sbjct: 180 VGTKMYDLFAGSQNLKSSYLLSKSSACEIAPMLDSSKLKAGLVYHDGSFNDSRMNATLAI 239

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           SA+E+GATV NY+ V+QL+KD+ T  +TGA VED ETG T+ + AK++VNATGPYSD IL
Sbjct: 240 SAIEKGATVLNYMEVKQLVKDEKTQKLTGAIVEDTETGETYQIKAKVIVNATGPYSDTIL 299

Query: 298 QMDANPQGLPE---KEPEKA---TPENAL--------IAVRNPKMVVPSRGVHITLPSFY 343
           QMD N  GLP+   KE E     TP N +        +AV+NP MVVPS GVHI LPS+Y
Sbjct: 300 QMDNNKNGLPDMFKKEIETGNLKTPLNVITPESISKEVAVQNPNMVVPSAGVHIILPSYY 359

Query: 344 CPSEMGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHY 403
           CPSEMGLLDA+T+DGRVMFFLPWQGKV+AGTTDIP+K VP +P+ TEADIQDIL+ELQHY
Sbjct: 360 CPSEMGLLDANTADGRVMFFLPWQGKVLAGTTDIPMKTVPENPTATEADIQDILKELQHY 419

Query: 404 IQFPVRREDVLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKW 463
           I+FPV+REDVLSAWAGIRPLV+DPRV +G    G T+ +VRSHFIFTS   LVTIAGGKW
Sbjct: 420 IKFPVKREDVLSAWAGIRPLVQDPRVQKG----GATQEVVRSHFIFTSDNGLVTIAGGKW 475

Query: 464 TTYREMAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAE 523
           TTYREMAEET+DEV+K GKF   KPC TRK KL GA++W+ N  A L Q+Y  +   +AE
Sbjct: 476 TTYREMAEETIDEVVKQGKFNA-KPCITRKLKLAGAENWDANLAALLSQKYN-VSTPMAE 533

Query: 524 HLANNYGDRAPIICEMFEADKSSKLPVGLYGDGDDKVKNMDA--NAFDYPFTIAELKYCI 581
           HLANNYG R+PIICEM +    +KLPV L G  ++ + N     ++F YP+TIAELKY +
Sbjct: 534 HLANNYGTRSPIICEMMKESDENKLPVNLAGRENESISNAHVGYDSFRYPYTIAELKYSM 593

Query: 582 RFEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIK 641
            +EY RTALDFL+RR+R+AFLDA+EAL+AV+ TV ++GD L WD ++R  E      YIK
Sbjct: 594 DYEYTRTALDFLMRRTRYAFLDAKEALDAVNGTVKIMGDHLNWDNDRREREKVYATDYIK 653

Query: 642 TFGV 645
           TFGV
Sbjct: 654 TFGV 657

>Kwal_55.19649 s55 complement(65706..67631) [1926 bp, 641 aa] {ON}
           YIL155C (GUT2) - glycerol-3-phosphate dehydrogenase,
           mitochondrial [contig 159] FULL
          Length = 641

 Score =  771 bits (1992), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/594 (62%), Positives = 456/594 (76%), Gaps = 9/594 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R+++L+++  T +FD               DA+ RGL VALVE  DFA+GTSSKSTK+
Sbjct: 50  PTRSELLEKMAKTEQFDVLIIGGGATGTGCAVDAATRGLNVALVEMNDFASGTSSKSTKM 109

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNER H+L  APHL K+LPI+IPVY YW+VPYFY
Sbjct: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            GCKMYD FAG+QNLKSSY++S +  S +APMLD   LK GLVYHDG FNDSR+ A LA+
Sbjct: 170 VGCKMYDLFAGSQNLKSSYMMSAKRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+ERGATV NY+ V QL+K+  +G I GA V D+ETG  F + AK+VVN+TGP+SD++L
Sbjct: 230 TAIERGATVLNYMEVTQLVKNDQSGRIEGAMVRDRETGEEFRIKAKVVVNSTGPFSDRLL 289

Query: 298 QMDANPQGLPEKEPEKATPE-----NALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352
           QMDA   G P  +  +   E      + IAV NP+MVVPS GVHI LP+FYCP E+GLLD
Sbjct: 290 QMDAAKDGKPRNDLVQFANEGHDSIGSRIAVSNPRMVVPSAGVHIVLPAFYCPKEIGLLD 349

Query: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412
           A TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+R D
Sbjct: 350 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRGD 409

Query: 413 VLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472
           VLSAWAGIRPL+RDPR  +       T+GLVR+HF++TS   LVTIAGGKWTTYREMAEE
Sbjct: 410 VLSAWAGIRPLIRDPRTIKEGDDVSSTQGLVRNHFLYTSDNGLVTIAGGKWTTYREMAEE 469

Query: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532
           T+DEV+K GKFQ  KPC T+K KL GA+ W+ NF A L Q Y  L   +AEHLANNYG R
Sbjct: 470 TIDEVVKQGKFQA-KPCITKKIKLAGAEGWDPNFVAMLAQEYH-LSSKMAEHLANNYGTR 527

Query: 533 APIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALD 591
           +PIICEMF+ D+ ++LPV   G  +  V KN++ ++F YPFTI ELKY +++EY RTALD
Sbjct: 528 SPIICEMFKRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIGELKYSMQYEYTRTALD 587

Query: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           FL+RR+RF FLDAR+AL AVD TV+++GDELGW  ++R AE  +   +IKTFG+
Sbjct: 588 FLMRRTRFGFLDARQALGAVDGTVSVMGDELGWSDDRRQAERQQASEFIKTFGL 641

>KLTH0E00836g Chr5 complement(83201..85126) [1926 bp, 641 aa] {ON}
           similar to uniprot|P32191 Saccharomyces cerevisiae
           YIL155C GUT2 Mitochondrial glycerol-3-phosphate
           dehydrogenase expression is repressed by both glucose
           and cAMP and derepressed by non-fermentable carbon
           sources in a Snf1p Rsf1p Hap2/3/4/5 complex dependent
           manner
          Length = 641

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/594 (62%), Positives = 453/594 (76%), Gaps = 9/594 (1%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R+++L ++  T +FD               D + RGL VALVE  DFA+GTSSKSTK+
Sbjct: 50  PSRSELLDKMAKTDQFDVLVIGGGATGTGCAVDGATRGLNVALVEMNDFASGTSSKSTKM 109

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNER H+L  APHL K+LPI+IPVY YW+VPYFY
Sbjct: 110 AHGGVRYLEKAFWELSKAQLDLVIEALNERGHMLNTAPHLCKVLPIMIPVYNYWQVPYFY 169

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            GCKMYD FAG+QNLKSSY+++    S +APMLD   LK GLVYHDG FNDSR+ A LA+
Sbjct: 170 VGCKMYDLFAGSQNLKSSYMMTARRASEVAPMLDASILKAGLVYHDGSFNDSRMNAALAV 229

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+ERGATV NY+ V +L+K++ TG + GA   D+ETG  F +NAK+VVN+TGP+SD+IL
Sbjct: 230 TAIERGATVLNYMEVTRLLKNEKTGRVEGAMARDRETGKEFRINAKVVVNSTGPFSDRIL 289

Query: 298 QMDANPQGLPEKEPEKATPE-----NALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352
           QMD    GLP  +  +   E      + +AV NP+MVVPS GVHI LP+FYCP ++GLLD
Sbjct: 290 QMDNAKDGLPRNDLVQFANEGHDSIGSRVAVSNPRMVVPSAGVHIVLPAFYCPKQIGLLD 349

Query: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412
           A TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+RED
Sbjct: 350 AKTSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKRED 409

Query: 413 VLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472
           VLSAWAGIRPLVRDPR  +       T+GLVR+HF+FTS   LVTIAGGKWTTYREMAEE
Sbjct: 410 VLSAWAGIRPLVRDPRTLKEGDDVSSTQGLVRNHFLFTSDNGLVTIAGGKWTTYREMAEE 469

Query: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532
           T+DEV+K G FQ  KPC T+K KL GA+ W+ NF A L Q Y  L   +AEHLANNYG R
Sbjct: 470 TIDEVVKQGHFQA-KPCITKKIKLAGAEGWDPNFVAMLAQEYH-LSSKMAEHLANNYGTR 527

Query: 533 APIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALD 591
           +PIICEMF  D+ ++LPV   G  +  V KN++ ++F YPFTIAELKY +++EY RTALD
Sbjct: 528 SPIICEMFRRDEKNQLPVTFGGRENVTVYKNVNFDSFRYPFTIAELKYSVKYEYTRTALD 587

Query: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           FL+RR+RF FLDA++AL AV  TV+++GDELGWD  KR +E  +   +IKTFGV
Sbjct: 588 FLMRRTRFGFLDAKQALEAVKGTVSIMGDELGWDENKRLSEIQQASDFIKTFGV 641

>CAGL0H06699g Chr8 (665295..667247) [1953 bp, 650 aa] {ON} similar
           to uniprot|P32191 Saccharomyces cerevisiae YIL155c GUT2
          Length = 650

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/600 (64%), Positives = 458/600 (76%), Gaps = 19/600 (3%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R ++L +L  T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+
Sbjct: 57  PTRDELLDKLSRTNQFDVLIIGGGATGTGCALDAATRGLNVALVEKNDFASGTSSKSTKM 116

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +E+SK QLDLV+EALNERAHLL  APHL K+LPIIIPVY YW+VPYFY
Sbjct: 117 AHGGVRYLEKAFWEMSKAQLDLVIEALNERAHLLNTAPHLCKLLPIIIPVYNYWQVPYFY 176

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AGCKMYD FAG+QNLK SYL+S+     +APMLD   LK GLVYHDG FND+R+ ATLA+
Sbjct: 177 AGCKMYDLFAGSQNLKGSYLMSKNATMEVAPMLDGSNLKAGLVYHDGSFNDTRMNATLAV 236

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E  ATV NY+ V+QL+KDK  G + GA VED+ETG T++V AK+VVNATGPYSD++L
Sbjct: 237 TAIENSATVLNYMEVKQLVKDK-DGKVAGAVVEDRETGKTYSVRAKVVVNATGPYSDRLL 295

Query: 298 QMDANPQGLPEKEPEKATP---ENAL-------IAVRNPKMVVPSRGVHITLPSFYCPSE 347
           QMDANP GLP++  +K  P    NA        +AV  P MVVPS GVHI LPSFYCP E
Sbjct: 296 QMDANPDGLPDEVVQKTEPIIDGNATVKSIMSQVAVTKPNMVVPSAGVHIILPSFYCPKE 355

Query: 348 MGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFP 407
           MGLLDA TSDGRVMFFLPWQGKV+AGTTDIPLKQVP +P+ TEADIQDIL+ELQ YI+FP
Sbjct: 356 MGLLDAKTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPTATEADIQDILKELQPYIKFP 415

Query: 408 VRREDVLSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYR 467
           V+REDVLSAWAGIRPLV DPR  + S   G T+GLVRSHFIFTS   LVTIAGGKWTTYR
Sbjct: 416 VKREDVLSAWAGIRPLVTDPR--KKSKADGSTQGLVRSHFIFTSDHGLVTIAGGKWTTYR 473

Query: 468 EMAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLAN 527
            MAEET+DEV+K GKF   KPC TRK KL GA++W+ N  A L Q+Y  L   ++ +LA 
Sbjct: 474 AMAEETIDEVVKNGKFDA-KPCITRKLKLAGAENWDPNLPALLAQKYH-LSQKMSHYLAE 531

Query: 528 NYGDRAPIICEMFEADKSSKLPVGLYGDGDDK--VKNMDANAFDYPFTIAELKYCIRFEY 585
           NYG RAP+ICEMF  D  ++LP+ L  D +    + ++D ++F YP TIAELKY I++EY
Sbjct: 532 NYGTRAPLICEMFHEDPENRLPL-LLADKEQTPVLGHVDFDSFRYPITIAELKYAIKYEY 590

Query: 586 VRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
            RTALDFL+RR+RFAFLDA++ALNAV+ TV L+GD LGWD ++R  E   +  +IKTFGV
Sbjct: 591 ARTALDFLMRRTRFAFLDAKQALNAVEGTVRLMGDSLGWDEQRRQDEIRYSTEFIKTFGV 650

>AFR295W Chr6 (970178..972073) [1896 bp, 631 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL155C (GUT2)
          Length = 631

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/594 (63%), Positives = 455/594 (76%), Gaps = 18/594 (3%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R+++L++LQ T +FD               DAS RGL VAL+E  DFA+GTSSKSTK+
Sbjct: 49  PSRSELLEKLQKTNQFDVLVIGGGASGAGSALDASTRGLNVALLEMNDFASGTSSKSTKM 108

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAV+ELSK QLDLV+EALNERAHLLY APHL K+LPI+IPVY++W+VPYFY
Sbjct: 109 AHGGVRYLEKAVWELSKAQLDLVIEALNERAHLLYTAPHLCKVLPIMIPVYKWWQVPYFY 168

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            G KMYDFFAG+QNLKSSYLLS      +APMLD  KLK GLVYHDG FNDSR+ AT+A+
Sbjct: 169 VGTKMYDFFAGSQNLKSSYLLSASAAGEVAPMLDASKLKAGLVYHDGSFNDSRMNATIAV 228

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E GATV NY+ V++LIK+   G + GA   D+ETG  + V AK+VVNATGP+SD++L
Sbjct: 229 TAIENGATVLNYMEVKRLIKNPEDGKVEGAVAMDRETGKEYAVRAKVVVNATGPFSDRLL 288

Query: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353
           QMD +P+GLP+ +   A  +++ I    AV NPKMVVPS GVHI LPS+YCP  MGLLDA
Sbjct: 289 QMDNHPEGLPDDKILDAINKDSTIATEVAVANPKMVVPSSGVHIILPSYYCPKNMGLLDA 348

Query: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413
            TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 349 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPANPTATEADIQDILKELQHYIKFPVKREDV 408

Query: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473
            SAWAGIRPLV+DPR          T+GLVRSH +FTS   +VTI+GGKWTTYREMAEET
Sbjct: 409 QSAWAGIRPLVKDPR-----KNLSDTQGLVRSHLVFTSKNGMVTISGGKWTTYREMAEET 463

Query: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRY--APLEDSLAEHLANNYGD 531
           V+EV+KVGKF   KPC TRK KL GA+HW+ N  A L  +Y   PL   LAEHL+ NYG 
Sbjct: 464 VNEVVKVGKFVNAKPCITRKLKLSGAEHWDANLPALLSHQYNIPPL---LAEHLSQNYGT 520

Query: 532 RAPIICEMFEADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALD 591
           +A  +CE+FE D+++ LPV L     DK  ++D NAF YP+TI ELK+ +  EY RT LD
Sbjct: 521 KAAQVCELFEDDRANMLPVSL---AADKPTSIDYNAFRYPYTIGELKFTMTHEYARTPLD 577

Query: 592 FLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           FL+RR+R+AFLDA++AL AVD TV ++GD LGWD+ KR AE+     YIKTFGV
Sbjct: 578 FLMRRTRYAFLDAKQALKAVDGTVKVMGDALGWDSAKRVAETKYAIEYIKTFGV 631

>ZYRO0B16522g Chr2 (1340223..1342154) [1932 bp, 643 aa] {ON} highly
           similar to gnl|GLV|KLLA0A00418g Kluyveromyces lactis
           KLLA0A00418g and similar to YIL155C uniprot|P32191
           Saccharomyces cerevisiae YIL155C GUT2 Mitochondrial
           glycerol-3-phosphate dehydrogenase expression is
           repressed by both glucose and cAMP and derepressed by
           non-fermentable carbon sources in a Snf1p Rsf1p
           Hap2/3/4/5 complex dependent manner
          Length = 643

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/593 (62%), Positives = 446/593 (75%), Gaps = 12/593 (2%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R  +L  LQ T KFD               DA+ RGL VA VE  DFA+GTSSKSTK+
Sbjct: 57  PSREDLLSNLQKTDKFDVLIIGGGASGAGSALDAATRGLNVACVEANDFASGTSSKSTKM 116

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAVFELS+ QLDLV+EALNER H+L  APHL KILPI+IPVY YW+VPYF+
Sbjct: 117 AHGGVRYLEKAVFELSRAQLDLVIEALNERGHMLETAPHLCKILPIMIPVYSYWQVPYFF 176

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AGCK+YD+FAG QNL+SSYLLS+   S +APMLD+ KLK GLVYHDG FNDSR+ +TLAI
Sbjct: 177 AGCKLYDWFAGKQNLRSSYLLSKTYASELAPMLDESKLKAGLVYHDGSFNDSRMNSTLAI 236

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           SA+E GATV NYV V QL+KD +T  + GA VEDQETG  + V AK+ VNATGPYSD IL
Sbjct: 237 SAIEHGATVLNYVKVTQLLKDSSTNKVEGAIVEDQETGKQYQVKAKVTVNATGPYSDLIL 296

Query: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353
           QMD N  GLP+ +P +  P N  I    AV  P MVVPS GVHI LPS+YCP  +GLLD 
Sbjct: 297 QMDKNKNGLPDPQPPQ--PANVSIATEVAVNKPNMVVPSAGVHIILPSYYCPKTVGLLDV 354

Query: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413
            T+DGRVMFFLPWQGKV+AGTTDIP+K VP++P+ TEADIQDIL+ELQHYI+FPVRREDV
Sbjct: 355 KTADGRVMFFLPWQGKVLAGTTDIPMKTVPQNPTATEADIQDILRELQHYIKFPVRREDV 414

Query: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473
           LSAWAGIRPLV DPR  + + GS  TEGLVR+H IFTS T L+T+AGGKWTTYREMAE+T
Sbjct: 415 LSAWAGIRPLVMDPRKRKDTGGS--TEGLVRNHLIFTSETGLITLAGGKWTTYREMAEQT 472

Query: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533
           +DEV+K G F  +KPC TRK KL G ++W  N  A L Q Y  L  ++++HL+NNYG RA
Sbjct: 473 IDEVVKEGGF-SVKPCITRKIKLAGGENWTPNLSALLAQHYK-LSQAMSQHLSNNYGTRA 530

Query: 534 PIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVRTALDF 592
           PIICE+F+ D+ ++LPV   G  +  V  +++ ++F YPFTI E  Y IR EY R A DF
Sbjct: 531 PIICELFKEDERNQLPVAFGGRENVTVLHHVNFDSFRYPFTIGEFLYSIRHEYSRKATDF 590

Query: 593 LLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           L+RR+R+AFLDA  AL AV+ TV ++GDEL WD+ +R  E  +   +IKTFGV
Sbjct: 591 LMRRTRYAFLDAANALTAVEGTVKVMGDELNWDSARRQREIEECTEFIKTFGV 643

>TBLA0E01750 Chr5 (427657..429654) [1998 bp, 665 aa] {ON} Anc_5.711
           YIL155C
          Length = 665

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/600 (61%), Positives = 448/600 (74%), Gaps = 15/600 (2%)

Query: 59  PDRAKVLQRLQDTK-FDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P R+++L  L+ TK FD               DAS RGL VAL+E  DFA+ TSSKSTK+
Sbjct: 68  PSRSELLSNLEKTKKFDVLIIGGGATGTGCAVDASTRGLNVALMEMNDFASATSSKSTKM 127

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKAVF+LSK QLDLV+EALNER H+L  APHL KILPI+IPVY YW+VPYFY
Sbjct: 128 AHGGVRYLEKAVFQLSKAQLDLVIEALNERKHMLQTAPHLCKILPIMIPVYNYWEVPYFY 187

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
           AGCKMYDFFAG+QNLKS+YLLS+ +   IAPMLD  KLK  LVYHDG FND+R+  +LA+
Sbjct: 188 AGCKMYDFFAGSQNLKSAYLLSKTSAGQIAPMLDVPKLKAALVYHDGSFNDARMNVSLAV 247

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E GATV NY+ VE+LIKD  TG I GA V D+ET   + V AK+VVN+TGP+SD IL
Sbjct: 248 TAIENGATVLNYMEVEKLIKDPKTGKIQGATVRDRETDKKYDVMAKVVVNSTGPFSDNIL 307

Query: 298 QMDANPQGLPE----------KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSE 347
           QMD N  G P+          K P       + IAV NPKMVVPS GVHI LPS+YCP +
Sbjct: 308 QMDRNKSGYPDIFDKANIDTSKLPSIDHDNLSRIAVDNPKMVVPSAGVHIILPSYYCPKD 367

Query: 348 MGLLDASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFP 407
           MG+LD  T+DGRVMFFLPWQ KV+AGTTDIP+K+VP +P  TEADI+DIL ELQHY +FP
Sbjct: 368 MGILDVKTADGRVMFFLPWQDKVLAGTTDIPMKKVPENPVATEADIEDILSELQHYCKFP 427

Query: 408 VRREDVLSAWAGIRPLVRDPR-VAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTY 466
           V+REDVLSAWAGIRPLVRDPR ++  S G   T+GLVRSHFIFTS   LVTIAGGKWTTY
Sbjct: 428 VKREDVLSAWAGIRPLVRDPRKLSPNSKGDDSTQGLVRSHFIFTSENNLVTIAGGKWTTY 487

Query: 467 REMAEETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLA 526
           R MAEET+DE IKVG+    KP  T+   L G ++W  N  A L Q+Y  +  SL+++L+
Sbjct: 488 RRMAEETIDEAIKVGQLPN-KPSVTKDLILSGGENWTPNTAALLSQKYH-IPSSLSKYLS 545

Query: 527 NNYGDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEY 585
            NYG RAPIICE+ + DK ++LPV L G   +++  N+D  A  YP+T+AE+KYCI  EY
Sbjct: 546 ENYGTRAPIICELLKKDKKNELPVTLAGKEHNEILGNVDFQALRYPYTVAEVKYCIDNEY 605

Query: 586 VRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
            RTALDFLLRR+RF FLDA+EA+NAV+ TV+++GDEL WD+EKR+ E  K+K YIKT GV
Sbjct: 606 SRTALDFLLRRTRFGFLDAKEAMNAVEGTVSIMGDELNWDSEKRSLEIKKSKEYIKTLGV 665

>Ecym_4010 Chr4 complement(24630..26564) [1935 bp, 644 aa] {ON}
           similar to Ashbya gossypii AFR295W
          Length = 644

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/592 (61%), Positives = 455/592 (76%), Gaps = 13/592 (2%)

Query: 59  PDRAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKL 117
           P RA++L++LQ T +FD               DA+ RGL VAL+E  D+A+GTSSKSTK+
Sbjct: 61  PSRAQLLEKLQKTDQFDVLVIGGGASGTGSALDAATRGLNVALLEMNDYASGTSSKSTKM 120

Query: 118 AHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFY 177
           AHGGVRYLEKA +ELSK QLDLV+EALNERAH+L+ APHL KILPI+IPVY++W+VPYFY
Sbjct: 121 AHGGVRYLEKAFWELSKAQLDLVIEALNERAHMLHTAPHLCKILPIMIPVYKWWQVPYFY 180

Query: 178 AGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAI 237
            G KMYDFFAG QNLKSSYLLS    S +APMLD  KLK GLVYHDG FNDSR+ +TLA+
Sbjct: 181 VGTKMYDFFAGKQNLKSSYLLSATGASQVAPMLDASKLKAGLVYHDGSFNDSRMNSTLAV 240

Query: 238 SAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKIL 297
           +A+E GAT+ NY+ V+QL+K+  TG + GA   D+ETG  ++V AK+VV+ATGP+SD+IL
Sbjct: 241 TAIENGATLLNYMEVKQLLKNPETGKVEGAIAVDRETGKQYSVKAKVVVSATGPFSDRIL 300

Query: 298 QMDANPQGLPEKEPEKATPENALI----AVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353
           QM+ +P+GLP+        E A I    AV +PKMVVPS GVHI LPSFYCP +MGLLDA
Sbjct: 301 QMENHPKGLPDDLSLSKANEGATITTKVAVADPKMVVPSSGVHIILPSFYCPKDMGLLDA 360

Query: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413
            TSDGRVMFFLPWQGKV+AGTTDIP+KQVP +P+ TEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 361 ETSDGRVMFFLPWQGKVLAGTTDIPMKQVPENPTATEADIQDILKELQHYIKFPVKREDV 420

Query: 414 LSAWAGIRPLVRDPRVAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEET 473
            SAWAGIRPLV+DPR       +  T+ LVRSHF+FTS + LVTI+GGKWTTYREMA+ET
Sbjct: 421 QSAWAGIRPLVKDPR-----KDNSDTQDLVRSHFLFTSDSGLVTISGGKWTTYREMAQET 475

Query: 474 VDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRA 533
           +DEV+KVG F   KPC TRK KL+G+++W+ N  A L Q+Y  L   L+E+L+ NYG +A
Sbjct: 476 IDEVVKVGNFVNAKPCITRKIKLVGSENWDPNLPAILSQQYN-LPPVLSEYLSENYGTKA 534

Query: 534 PIICEMFEADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYVRTALDFL 593
             ICE+F++DK ++LPV L    +    N+D +AF YPFT+ ELKY IR EY R  LDFL
Sbjct: 535 AAICEIFQSDKRNQLPVSL--AAEKAAANVDYDAFRYPFTVGELKYNIRNEYARKPLDFL 592

Query: 594 LRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           +RR+R+AFLDA++A+ AV  TV ++GDELGWD+ KR  E+     +IKTFGV
Sbjct: 593 MRRTRYAFLDAKQAVAAVPGTVKIMGDELGWDSAKREMETKYAIEFIKTFGV 644

>NDAI0F00210 Chr6 complement(39658..41619) [1962 bp, 653 aa] {ON}
           Anc_5.711 YIL155C
          Length = 653

 Score =  743 bits (1919), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/598 (61%), Positives = 446/598 (74%), Gaps = 12/598 (2%)

Query: 59  PDRAKVLQRL--QDTKFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTK 116
           P R+++  +L  +D +FD               DA+ RGL VALVE+ DFA+GTSSKSTK
Sbjct: 57  PSRSQLWNQLTTKDHQFDLLIIGGGATGTGCALDAATRGLNVALVERDDFASGTSSKSTK 116

Query: 117 LAHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYF 176
           +AHGGVRYLEKA  + SK QLDLV+EALNERAHLL  APHL KILPI+IPVY YW++PYF
Sbjct: 117 MAHGGVRYLEKAFLQFSKSQLDLVIEALNERAHLLNTAPHLCKILPILIPVYNYWQLPYF 176

Query: 177 YAGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLA 236
           YAGCK YDFFAG QNLKSSYL+SR+N   IAPMLD   LK  LVYHDG FNDSRL +++A
Sbjct: 177 YAGCKFYDFFAGDQNLKSSYLISRKNAIEIAPMLDAANLKAALVYHDGSFNDSRLNSSIA 236

Query: 237 ISAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKI 296
           I+A+E GATV NYV V +L+KD  +  I G  V+D+ETG    V +K++VNATGPYSD I
Sbjct: 237 ITAIENGATVLNYVEVRKLLKDPNSNKIIGVTVQDKETGEISNVKSKVIVNATGPYSDTI 296

Query: 297 LQMDANPQGLPEK---EPEKATPEN--ALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLL 351
           LQMD N  GLP+    +P+   P +  + IAV NPKMVVPS GVHI LPS+YCP +MGLL
Sbjct: 297 LQMDKNLSGLPDLANIDPKMYDPNDISSKIAVSNPKMVVPSSGVHIILPSYYCPKQMGLL 356

Query: 352 DASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRE 411
           DA T+DGRVMFFLPWQGKVIAGTTDIP+ QVP  P   E DIQDIL+ELQHYI+FPVRRE
Sbjct: 357 DARTTDGRVMFFLPWQGKVIAGTTDIPMSQVPDTPVAKETDIQDILKELQHYIKFPVRRE 416

Query: 412 DVLSAWAGIRPLVRDPRVAEGSAGS--GQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREM 469
           DVLSAWAGIRPLVRDPR+    A    G T+GLVRSHF+FTS   L+TIAGGKWTTYREM
Sbjct: 417 DVLSAWAGIRPLVRDPRLIMDDATQKLGTTQGLVRSHFLFTSDNGLITIAGGKWTTYREM 476

Query: 470 AEETVDEVIKVGKFQGL-KPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANN 528
           AEET+DEV+K G F    KPC T+  KLIGA++W+ N  A L Q++  L   +A++L+ N
Sbjct: 477 AEETIDEVVKYGHFANFAKPCKTKDLKLIGAENWDPNLVALLSQKFN-LSSMMAKYLSEN 535

Query: 529 YGDRAPIICEMFEADKSSKLPVGLYGDGDDKV-KNMDANAFDYPFTIAELKYCIRFEYVR 587
           YG R+ IIC++FE ++ +KLPV L G  D  +  N+D N F YP TIAELKY +++EY R
Sbjct: 536 YGTRSTIICQLFEREEMNKLPVQLAGIEDKPILGNVDFNTFRYPITIAELKYAMKYEYAR 595

Query: 588 TALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           T LDFL+RR+RFA+LDA +AL AV  TV ++GDE GWD+++R  E      +I++FGV
Sbjct: 596 TPLDFLMRRTRFAYLDAYQALLAVKGTVKVMGDEFGWDSKRREQEIKNATLFIESFGV 653

>YIL155C Chr9 complement(51759..53708) [1950 bp, 649 aa] {ON}
           GUT2Mitochondrial glycerol-3-phosphate dehydrogenase;
           expression is repressed by both glucose and cAMP and
           derepressed by non-fermentable carbon sources in a
           Snf1p, Rsf1p, Hap2/3/4/5 complex dependent manner
          Length = 649

 Score =  738 bits (1904), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/599 (61%), Positives = 432/599 (72%), Gaps = 18/599 (3%)

Query: 61  RAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKLAH 119
           R  +L RL  T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 55  RRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIH 114

Query: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY Y G
Sbjct: 115 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTWQVPYIYMG 174

Query: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 175 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 234

Query: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299
           VE GATV NYV V++LIKD T+G + GA+  D ET     +NAK VVNATGPYSD ILQM
Sbjct: 235 VENGATVLNYVEVQKLIKDPTSGKVIGAEARDVETNELVRINAKCVVNATGPYSDAILQM 294

Query: 300 DANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTS 356
           D NP GLP+    +  K       IAV +PKMV+PS GVHI LPSFYCP +MGLLD  TS
Sbjct: 295 DRNPSGLPDSPLNDNSKIKSTFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTS 354

Query: 357 DGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSA 416
           DGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDVLSA
Sbjct: 355 DGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSA 414

Query: 417 WAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474
           WAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEETV
Sbjct: 415 WAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEETV 473

Query: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534
           D+V++VG F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R+ 
Sbjct: 474 DKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYGTRSS 532

Query: 535 IICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYV 586
           IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY +++EY 
Sbjct: 533 IICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQYEYC 590

Query: 587 RTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           RT LDFLLRR+RFAFLDA+EALNAV  TV ++GDE  W  +KR  E  KT  +IKTFGV
Sbjct: 591 RTPLDFLLRRTRFAFLDAKEALNAVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 649

>Skud_9.13 Chr9 complement(28747..30696) [1950 bp, 649 aa] {ON}
           YIL155C (REAL)
          Length = 649

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/603 (60%), Positives = 432/603 (71%), Gaps = 26/603 (4%)

Query: 61  RAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKLAH 119
           R  +L RL  T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 55  RRDLLDRLAKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIH 114

Query: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY Y G
Sbjct: 115 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYIYMG 174

Query: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 175 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 234

Query: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299
           VE GATV NYV V++LIKD  +G + GA+  D ET     +NAK VVNATGPYSD ILQM
Sbjct: 235 VENGATVLNYVEVQRLIKDPASGKVVGAEARDVETNELVKINAKCVVNATGPYSDAILQM 294

Query: 300 DANPQGLPEKEPEKATPENAL-------IAVRNPKMVVPSRGVHITLPSFYCPSEMGLLD 352
           D NP G    +P     +N+L       IAV +PKMV+PS GVHI LPSFYCP +MGLLD
Sbjct: 295 DRNPSG----QPNSPLNDNSLIKSTFNQIAVTDPKMVIPSIGVHIVLPSFYCPKDMGLLD 350

Query: 353 ASTSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRRED 412
             TSDGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+RED
Sbjct: 351 VRTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKRED 410

Query: 413 VLSAWAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMA 470
           VLSAWAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MA
Sbjct: 411 VLSAWAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNGLITIAGGKWTTYRQMA 469

Query: 471 EETVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYG 530
           EETVD+V++VG+F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG
Sbjct: 470 EETVDKVVEVGRFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYG 528

Query: 531 DRAPIICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIR 582
            R+ IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY ++
Sbjct: 529 TRSSIICEFFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQ 586

Query: 583 FEYVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKT 642
           +EY RT LDFLLRR+RFAFLDA+EALN+   TV ++GDE  W  +KR  E  KT  +IKT
Sbjct: 587 YEYCRTPLDFLLRRTRFAFLDAKEALNSAHATVKVMGDEFNWSEKKRQWELEKTINFIKT 646

Query: 643 FGV 645
           FGV
Sbjct: 647 FGV 649

>Smik_9.14 Chr9 complement(29383..31341) [1959 bp, 652 aa] {ON}
           YIL155C (REAL)
          Length = 652

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/599 (60%), Positives = 429/599 (71%), Gaps = 18/599 (3%)

Query: 61  RAKVLQRLQDT-KFDXXXXXXXXXXXXXXXDASLRGLKVALVEKADFAAGTSSKSTKLAH 119
           R  +L+RL  T +FD               DA+ RGL VALVEK DFA+GTSSKSTK+ H
Sbjct: 58  RRDLLERLGKTHQFDVLIIGGGATGTGCALDAATRGLNVALVEKGDFASGTSSKSTKMIH 117

Query: 120 GGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYFYAG 179
           GGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y   +VPY Y G
Sbjct: 118 GGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYSTLQVPYIYMG 177

Query: 180 CKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLAISA 239
           CK YDFFAG+QNLK SYLLS+      APML    LK  LVYHDG FNDSRL ATLAI+A
Sbjct: 178 CKFYDFFAGSQNLKKSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLAITA 237

Query: 240 VERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQM 299
           VE GATV NYV V++LIKD  +G + GA+  D ET     + AK VVNATGPYSD ILQM
Sbjct: 238 VENGATVLNYVEVQKLIKDPASGKVIGAEARDVETNELIRIKAKCVVNATGPYSDAILQM 297

Query: 300 DANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDASTS 356
           D NP G P+    +  KA      IAV +PKMV+PS GVHI LPSFYCP +MGLLD  TS
Sbjct: 298 DRNPSGQPDSPLNDNSKAKSAFNQIAVMDPKMVIPSIGVHIVLPSFYCPKDMGLLDVRTS 357

Query: 357 DGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDVLSA 416
           DGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDVLSA
Sbjct: 358 DGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDVLSA 417

Query: 417 WAGIRPLVRDPRV--AEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEETV 474
           WAG+RPLVRDPR   A+G  GS  T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEET+
Sbjct: 418 WAGVRPLVRDPRTIPADGKKGSA-TQGVVRSHFLFTSDNDLITIAGGKWTTYRQMAEETI 476

Query: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534
           D+V++VG F  L PC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R+ 
Sbjct: 477 DKVVEVGGFHNLTPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVQNYGTRSS 535

Query: 535 IICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFEYV 586
           IICE F+    +KLP+ L        Y   ++ + N D   F YPFTI ELKY +++EY 
Sbjct: 536 IICEYFKESMENKLPLSLADKENNVIYSSEENNLVNFD--TFRYPFTIGELKYSMQYEYC 593

Query: 587 RTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFGV 645
           RT LDFLLRR+RFAFLDA+EALN+V  TV ++GDE  W  +KR  E  KT  +IKTFGV
Sbjct: 594 RTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSEKKRQWELEKTVNFIKTFGV 652

>Suva_9.32 Chr9 complement(46397..48013) [1617 bp, 538 aa] {ON}
           YIL155C (REAL)
          Length = 538

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/541 (61%), Positives = 394/541 (72%), Gaps = 15/541 (2%)

Query: 117 LAHGGVRYLEKAVFELSKPQLDLVVEALNERAHLLYAAPHLTKILPIIIPVYEYWKVPYF 176
           + HGGVRYLEKA +E SK QLDLV+EALNER HL+  APHL  +LPI+IP+Y  W+VPY 
Sbjct: 1   MIHGGVRYLEKAFWEFSKAQLDLVIEALNERKHLINTAPHLCTVLPILIPIYNTWQVPYI 60

Query: 177 YAGCKMYDFFAGAQNLKSSYLLSRENLSHIAPMLDQKKLKMGLVYHDGIFNDSRLCATLA 236
           YAGCK YDFFAG QNLKSSYLLS+      APML    LK  LVYHDG FNDSRL ATLA
Sbjct: 61  YAGCKFYDFFAGKQNLKSSYLLSKSATVEKAPMLTTDNLKASLVYHDGSFNDSRLNATLA 120

Query: 237 ISAVERGATVANYVSVEQLIKDKTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKI 296
           I+AVE GATV NYV V++LIKD  +G + GA+  D ET     +NAK VVNATGPYSD I
Sbjct: 121 ITAVENGATVLNYVEVQKLIKDPASGKVVGAEARDVETNELVRINAKCVVNATGPYSDAI 180

Query: 297 LQMDANPQGLPE---KEPEKATPENALIAVRNPKMVVPSRGVHITLPSFYCPSEMGLLDA 353
           LQMD N  G P     +  K       +AV +P+MV+PS GVHI LPSFYCP ++GLLD 
Sbjct: 181 LQMDRNASGQPNSPLNDNSKIKSAFNQVAVMDPEMVIPSIGVHIVLPSFYCPKDIGLLDV 240

Query: 354 STSDGRVMFFLPWQGKVIAGTTDIPLKQVPRDPSPTEADIQDILQELQHYIQFPVRREDV 413
            TSDGRVMFFLPWQGKV+AGTTDIPLKQVP +P PTEADIQDIL+ELQHYI+FPV+REDV
Sbjct: 241 RTSDGRVMFFLPWQGKVLAGTTDIPLKQVPENPMPTEADIQDILKELQHYIEFPVKREDV 300

Query: 414 LSAWAGIRPLVRDPR-VAEGSAGSGQTEGLVRSHFIFTSPTQLVTIAGGKWTTYREMAEE 472
           LSAWAG+RPLVRDPR +  G      T+G+VRSHF+FTS   L+TIAGGKWTTYR+MAEE
Sbjct: 301 LSAWAGVRPLVRDPRSIPAGGKKGSATQGVVRSHFLFTSDNGLITIAGGKWTTYRQMAEE 360

Query: 473 TVDEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDR 532
           T+D+V++VG F  LKPC TR  KL GA+ W  N+ A L Q Y  L   ++ +L  NYG R
Sbjct: 361 TIDKVVEVGGFHNLKPCHTRDIKLAGAEEWTQNYVALLAQNYH-LSSKMSNYLVENYGTR 419

Query: 533 APIICEMFEADKSSKLPVGL--------YGDGDDKVKNMDANAFDYPFTIAELKYCIRFE 584
           + IICE F+    +KLP+ L        Y + ++ + N D   F YPFTI ELKY +++E
Sbjct: 420 SSIICEFFKDSMENKLPLSLADKENNTIYSNEENNLVNFD--TFRYPFTIGELKYSMQYE 477

Query: 585 YVRTALDFLLRRSRFAFLDAREALNAVDPTVNLIGDELGWDAEKRAAESAKTKAYIKTFG 644
           Y RT LDFLLRR+RFAFLDA+EALN+V  TV ++GDE  W  +KR  E  KT  +IKTFG
Sbjct: 478 YCRTPLDFLLRRTRFAFLDAKEALNSVHATVKVMGDEFNWSDKKRQWELEKTVNFIKTFG 537

Query: 645 V 645
           V
Sbjct: 538 V 538

>TBLA0A09290 Chr1 (2292903..2295359) [2457 bp, 818 aa] {ON}
           Anc_5.671 YKR079C
          Length = 818

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 47/115 (40%), Gaps = 27/115 (23%)

Query: 475 DEVIKVGKFQGLKPCTTRKTKLIGAQHWNLNFQAYLQQRYAPLEDSLAEHLANNYGDRAP 534
           D+++KV  FQ LKP T                +AYLQ  Y P +   A+HL         
Sbjct: 124 DDILKVKAFQVLKPSTESSIS-----------EAYLQNDYCPFKRQEAKHLKE------- 165

Query: 535 IICEMFEADKSSKLPVGLYGDGDDKVKNMDANAFDYPFTIAELKYC--IRFEYVR 587
           I+ +MF  D    +P   Y   +D   N++       F I  +  C  I+F  +R
Sbjct: 166 IVSKMFPKD----IPSDDYDSSNDPTINVE---LPKDFKIPNITTCYEIQFNNIR 213

>TBLA0D01530 Chr4 complement(382006..383367) [1362 bp, 453 aa] {ON}
           Anc_5.546 YML015C
          Length = 453

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 29/60 (48%), Gaps = 9/60 (15%)

Query: 245 TVANYVSVEQLIKD--KTTGVITGAKVEDQETGGTFTVNAKIVVNATGPYSDKILQMDAN 302
           T+ANY+S++Q+I             K+++  TGGT         N    Y +KI QM+ N
Sbjct: 21  TIANYISIKQMINQILSEDNEYVNWKLKNLRTGGTMN-------NYINEYKEKINQMNEN 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,871,442
Number of extensions: 2654231
Number of successful extensions: 6207
Number of sequences better than 10.0: 22
Number of HSP's gapped: 6271
Number of HSP's successfully gapped: 22
Length of query: 645
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 529
Effective length of database: 40,180,143
Effective search space: 21255295647
Effective search space used: 21255295647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)