Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021705.709ON39639620250.0
NCAS0G002005.709ON4384088901e-116
TDEL0B021105.709ON3893338751e-115
KAFR0D021905.709ON4263188661e-113
Kwal_55.196615.709ON3713858601e-113
YIL153W (RRD1)5.709ON3933978611e-112
NDAI0F002405.709ON4643278581e-111
Suva_9.355.709ON3934038491e-110
KLTH0E00880g5.709ON3713898441e-110
SAKL0E15070g5.709ON3853928441e-110
Smik_9.165.709ON3933968401e-109
Skud_9.155.709ON4023318331e-108
ZYRO0B16478g5.709ON3913888071e-104
TPHA0D046505.709ON4214178081e-104
AFR293C5.709ON3653317971e-103
CAGL0H06655g5.709ON4243288001e-103
KLLA0A00462g5.709ON3533317791e-101
Kpol_2001.775.709ON4134087727e-99
TBLA0E016905.709ON4883527701e-97
Ecym_40125.709ON3953347463e-95
SAKL0H06622g8.674ON3553053854e-42
ZYRO0F07326g8.674ON3522983845e-42
CAGL0M02255g8.674ON3583093793e-41
TPHA0D012408.674ON3593063784e-41
Ecym_23998.674ON3512543767e-41
KAFR0H024408.674ON3532513751e-40
Kpol_1013.48.674ON3583003705e-40
KLTH0D11176g8.674ON3532983662e-39
Suva_16.1588.674ON3583063602e-38
NCAS0C016908.674ON3593053583e-38
ACR139C8.674ON3593243567e-38
NDAI0E024108.674ON3593123567e-38
YPL152W (RRD2)8.674ON3583143505e-37
Smik_6.3498.674ON3583153505e-37
KNAG0J016908.674ON3633033498e-37
Kwal_26.87838.674ON3553003462e-36
TDEL0A062008.674ON3553093401e-35
KLLA0F11187g8.674ON3603033402e-35
Skud_16.1308.674ON3583153383e-35
TBLA0C018608.674ON3563193146e-32
TBLA0D037701.499ON16651770.23
NCAS0F037803.523ON90733704.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02170
         (396 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   784   0.0  
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      347   e-116
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   341   e-115
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   338   e-113
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   335   e-113
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   336   e-112
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      335   e-111
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   331   e-110
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   329   e-110
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   329   e-110
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   328   e-109
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   325   e-108
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   315   e-104
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   315   e-104
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   311   e-103
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   312   e-103
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   304   e-101
Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   301   7e-99
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   301   1e-97
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   291   3e-95
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   152   4e-42
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   152   5e-42
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   150   3e-41
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   150   4e-41
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   149   7e-41
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   149   1e-40
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   147   5e-40
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   145   2e-39
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   143   2e-38
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   142   3e-38
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   141   7e-38
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   141   7e-38
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   139   5e-37
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   139   5e-37
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   139   8e-37
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   137   2e-36
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   135   1e-35
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   135   2e-35
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   134   3e-35
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   125   6e-32
TBLA0D03770 Chr4 complement(937698..938198) [501 bp, 166 aa] {ON...    34   0.23 
NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {O...    32   4.6  

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  784 bits (2025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/396 (96%), Positives = 382/396 (96%)

Query: 1   MIPGTLGTGERAQLPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR 60
           MIPGTLGTGERAQLPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR
Sbjct: 1   MIPGTLGTGERAQLPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR 60

Query: 61  GDTSGGISASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV 120
           GDTSGGISASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV
Sbjct: 61  GDTSGGISASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV 120

Query: 121 DCLAGGGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRL 180
           DCLAGGGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRL
Sbjct: 121 DCLAGGGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRL 180

Query: 181 WDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVI 240
           WDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVI
Sbjct: 181 WDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVI 240

Query: 241 PGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN 300
           PGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN
Sbjct: 241 PGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN 300

Query: 301 KFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTST 360
           KFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDS              DTST
Sbjct: 301 KFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGPGTTTLPALDTST 360

Query: 361 MASVPSRRPAMGPPAGRQVNKFIQHTTASHRDRLRR 396
           MASVPSRRPAMGPPAGRQVNKFIQHTTASHRDRLRR
Sbjct: 361 MASVPSRRPAMGPPAGRQVNKFIQHTTASHRDRLRR 396

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  347 bits (890), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 187/408 (45%), Positives = 255/408 (62%), Gaps = 29/408 (7%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTS---GGISAS-- 70
           LD++   F  P KRIFDSQTT  FQ S+AL R+RF ++KY+ M+    +   G +S+   
Sbjct: 33  LDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVTL 92

Query: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV-----DCLAG 125
           V  ++Q+L+ L  L+DETPPLVGPRRYGNLACRDWH K+++ LP L +++       ++G
Sbjct: 93  VNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVSG 152

Query: 126 GGA----CI-EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSR 179
             +    CI E  YY+ N+FGS  RLD+GTGHELSF+AF+AA+DM+     G+   ++  
Sbjct: 153 ESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDILL 212

Query: 180 LWDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGV 239
           L++ YY LVR+LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+  N   ++PRDV   +
Sbjct: 213 LFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWIRN-APMRPRDV-KDI 270

Query: 240 IPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVL 299
              +  A +N   + I F+  VK GPF E+SP+L DI + V++W K+QRGL +MY  EVL
Sbjct: 271 SLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEVL 330

Query: 300 NKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSA---DTEQE----TFDSXXXXXXXXXX 352
            KFPVVQHFWFG  F+PW +   G PLP+YE S    +TEQE     +            
Sbjct: 331 KKFPVVQHFWFGDGFYPWINQHTGKPLPIYEHSPEDDETEQEREIQQYAPHWHKENAHVR 390

Query: 353 XXXXDTSTMASVPSRRPAMGPPAGRQVNKFIQHTTA----SHRDRLRR 396
                 + M SV + R  M PP+ R +N      ++    S RD+ RR
Sbjct: 391 TAKPGITAMPSVTNTRTNMAPPSSRMMNSHDPTISSLLKRSTRDQARR 438

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  341 bits (875), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 225/333 (67%), Gaps = 17/333 (5%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGD----TSGGISASV 71
           +D+    F  P K IFDSQ  + FQ+SVA+ R+++H+EKY RM+ G        GI   V
Sbjct: 7   IDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEPSGIEV-V 65

Query: 72  ARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIE 131
            R++ +L RL  LVDETPP  GPRRYGNLACRDWHDK+D++L  L  QV          E
Sbjct: 66  NRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDYHKCIPE 125

Query: 132 AEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELS-----RLWDRYYR 186
             YYL NSFGS  RLDYGTGHELSFLA + ALDM+    G+   E S      L+D YY+
Sbjct: 126 LSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDML----GLWTSEFSGKDVLLLFDTYYK 181

Query: 187 LVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNP-VGVQPRDVLSGVIPGRDD 245
           LVR+LI+ Y LEPAGSHGVWGLDDHFH+ Y+ G+SQ++++P V + PRDV + V+  +D 
Sbjct: 182 LVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVKNKVL-VQDY 240

Query: 246 APANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVV 305
           A  N   +AI F+  VK GPF E+S ML DI S V +W K+Q GL +MY  EVL KFPVV
Sbjct: 241 ADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVEVLKKFPVV 300

Query: 306 QHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQE 338
           QHFWFG  F+PW S R+G  LP+YE +A++E++
Sbjct: 301 QHFWFGPGFYPWISDRNGQKLPIYE-NAESEKK 332

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  338 bits (866), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 212/318 (66%), Gaps = 9/318 (2%)

Query: 23  FRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG---DTSGGISASVAR-MLQIL 78
           F  P KRIFDSQTT  FQ SVA  R+++   KY+ ++RG     S  I+ ++ R +L +L
Sbjct: 17  FSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNITMTITRYILDLL 76

Query: 79  DRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPG-LTSQVD---CLAGGGACIEAEY 134
           D+    +DETPPL+ PRR+GNL+CR WHDK++S LPG L + +D    +       E  Y
Sbjct: 77  DKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGELKTIIDNFSTIENENMFNELNY 136

Query: 135 YLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVRRLIVD 194
           YL NSFGSK RLDYGTGHELSFLAF++ +DM+   + +T  +   +W  YY L R+LI+ 
Sbjct: 137 YLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRMLQDMTADDFLLIWQSYYNLTRKLILT 196

Query: 195 YNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPANFLVEA 254
           Y LEPAGSHGVWGLDDHFHLAY++G+SQ  ++   + P+D+L   +   +    N   +A
Sbjct: 197 YTLEPAGSHGVWGLDDHFHLAYIFGSSQLISDISHLAPKDILKKDVVA-EHKENNLYCQA 255

Query: 255 IGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGTAF 314
           I F+ +VK GPF E+SP+L DI   V SW K+ +GL +MYN EVLNKFPVVQHFWFG  F
Sbjct: 256 INFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVLNKFPVVQHFWFGDGF 315

Query: 315 FPWTSVRDGTPLPVYEQS 332
           FPW     G  LPV+E S
Sbjct: 316 FPWKDNNSGKDLPVFEHS 333

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  335 bits (860), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 183/385 (47%), Positives = 236/385 (61%), Gaps = 24/385 (6%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDT--SGGISASVAR 73
           +DV    F +P KRIFDS+ T  FQ SVA+ R++ H+ KY+ M+ G    S   + +V  
Sbjct: 6   IDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSETSNPNVIS 65

Query: 74  MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAE 133
           + +IL     LVDETP L GPRRYGNLACRDWHDK++  +     +        + +E  
Sbjct: 66  LRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPEKYYPSIVELA 125

Query: 134 YYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMS-QPRGITPVELSRLWDRYYRLVRRLI 192
           YYL N+FGS+ RLDYGTGHELSF + + ALDM+     G    +L  L++ YY LVR+LI
Sbjct: 126 YYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDLLYLFNEYYSLVRKLI 185

Query: 193 VDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNP-VGVQPRDVLSGVIPGRDDAPANFL 251
             Y+LEPAGSHGVWGLDDHFHL Y++GASQ+A++      PR++ S +I   + A +NF 
Sbjct: 186 TKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQSKMIVD-EYAGSNFY 244

Query: 252 VEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFG 311
            +AI F+  VK GPF E+SPML DI   V +W K+QRGL +MY AEVLNKFPVVQHFWFG
Sbjct: 245 CQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304

Query: 312 TAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTSTMASVPSRRPAM 371
           TA FPWTS   G  LP YE S +T+ +                   T    S+   R  M
Sbjct: 305 TALFPWTSTDGGDVLPTYEVSQETDTQA-------------QLPRMTQHQPSMTKLRHPM 351

Query: 372 GPPAGRQVNKFIQHTTASHRDRLRR 396
            PP  R V++FI H      DRL++
Sbjct: 352 NPPHLRNVSRFIAH------DRLKK 370

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  336 bits (861), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 182/397 (45%), Positives = 242/397 (60%), Gaps = 25/397 (6%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR--GDTSGGISASVAR 73
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  ++    D     +AS   
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIA 65

Query: 74  MLQ----ILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129
           M+     +LD+L  L+DETPPL GPRRYGNLACR+WH K+D  LP    ++         
Sbjct: 66  MVNGLMGVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEMLPSEYHEVV 125

Query: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189
            E +YYL NSFGS  RLDYGTGHELSF+A VAALDM+     +   ++  L+++YY ++R
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMFPHMRGADVFLLFNKYYTIMR 185

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR++L   +  R+   
Sbjct: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSL-VREYKD 244

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTSTMASVPSR 367
           FWFGT FFPW ++++GT LPV+E+  +   E  ++               TST     + 
Sbjct: 305 FWFGTGFFPWVNIQNGTDLPVFEEKEEESIEQANA--------GSPGREQTSTRFPTSTS 356

Query: 368 RPAMG-PPAGRQVNKFIQHTTASH-------RDRLRR 396
            P  G PP+G  +N  + H   SH       RDRLRR
Sbjct: 357 MPPPGVPPSGNNINYLLSHQNQSHRNQTSFSRDRLRR 393

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  335 bits (858), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 220/327 (67%), Gaps = 10/327 (3%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG-------DTSGGIS 68
           LD++   F  P KRIFDSQTT  FQ S+AL R+RF +++Y+ ++         D+     
Sbjct: 14  LDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSEI 73

Query: 69  ASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQ-VDCLAGGG 127
             V  ++ +L+ L  +V +TPPL GPRRYGNLACRDWH K++  LP L  + +       
Sbjct: 74  LMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIPSPDLQP 133

Query: 128 ACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRL 187
           + IE  YY+ NSFGS  RLDYGTGHELSF+AF+AALDM+     +T  +L  +++ YY L
Sbjct: 134 SIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPDLTGKDLLIMFNAYYSL 193

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAP 247
           VR LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+ NN   + P+++ +  +  +D + 
Sbjct: 194 VRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQWLNN-APLTPKEITNSRL-VKDYST 251

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            N   + I FV +VK GPF E+SP+L DI + VS+WRK+QRGL +MY  EVLNKFPVVQH
Sbjct: 252 KNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVLNKFPVVQH 311

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSAD 334
           FWFGT F+PW + +    LPVYE S +
Sbjct: 312 FWFGTGFYPWINFQTLRELPVYEHSPE 338

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  331 bits (849), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 186/403 (46%), Positives = 244/403 (60%), Gaps = 37/403 (9%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR--GDTSGGISAS--- 70
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M    D     +AS   
Sbjct: 6   VDWPHAAFSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIP 65

Query: 71  -VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129
            V  ++ +LDR   L+D+TPPL GPRRYGNLACR+WH K+D+ L     +V         
Sbjct: 66  MVNGLMAVLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAVV 125

Query: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189
            E +YYL NSFGS  RLDYGTGHELSF+A VAALD++     +   ++  L+ +YY ++R
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLFPHLRGTDVFLLFSKYYAIMR 185

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPRDVL   +  R+   
Sbjct: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSL-VREYQD 244

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTSTMASVPSR 367
           FWFGT FFPW +V++GT LPV+E+    E+E+ D                ++T     +R
Sbjct: 305 FWFGTGFFPWINVQNGTDLPVFEEK---EEESIDQANAT-----------SATPDRTSTR 350

Query: 368 RPA-------MGPPAGRQVNKFIQH-------TTASHRDRLRR 396
            PA       M PP+   VN  + H        T+S RDRLRR
Sbjct: 351 FPASTSMPPPMAPPSANNVNSLLSHQNHTHRNQTSSSRDRLRR 393

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 230/389 (59%), Gaps = 32/389 (8%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGISAS--VAR 73
           +D   A F +P KRIFDS+ +  FQ SVA+ R++ ++ KY+  M G      S +  V  
Sbjct: 6   IDASSATFTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRS 65

Query: 74  MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAE 133
             ++L  L  LVD TP L GPRRYGNLACR WHDKVD SL  L  +        + +E +
Sbjct: 66  FAELLKTLSELVDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPEPCHKSIVELQ 125

Query: 134 YYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSRLWDRYYRLVRRLI 192
           YYL N+FGS+ RLDYGTGHELSF A + ALDM+          ++  L+D+YY LVR+L+
Sbjct: 126 YYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVRKLV 185

Query: 193 VDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG-VQPRDVLSGVIPGRDDAPANFL 251
           + Y LEPAGSHGVWGLDDHFHL Y++GASQ+ +     + PR+V   +I   +    NF 
Sbjct: 186 LTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVD-EYTKTNFY 244

Query: 252 VEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFG 311
            +AI F+  VK GPF E+SPML DI   V +W K+QRGL +MY AEVLNKFPVVQHFWFG
Sbjct: 245 CQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFWFG 304

Query: 312 TAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTSTMASVP----SR 367
           T  FPWTS+ DG  LP YE S + + +                     T A  P    S 
Sbjct: 305 TGLFPWTSLGDGYALPTYEASQEAQGQVLQ-----------------HTTAPAPTNLNSA 347

Query: 368 RPAMGPPAGRQVNKFIQHTTASHRDRLRR 396
           R  M PP  R +N+       + +DR RR
Sbjct: 348 RRQMNPPNLRGINRL------TSQDRFRR 370

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  329 bits (844), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 180/392 (45%), Positives = 232/392 (59%), Gaps = 27/392 (6%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM--RGDTSGGISASVAR 73
           +DV H  F +P K+IFD+Q T  FQ SV + R++ ++ KY+ ++  +   S   + +V R
Sbjct: 10  IDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPSTSNNDAVNR 69

Query: 74  MLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAE 133
             QI+D L   +DETPPL GPRR+GN ACR WH K+  SL  L             +E  
Sbjct: 70  FTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAFIPEKYHVCIVEIR 129

Query: 134 YYLRNSFGSKIRLDYGTGHELSFLAFVAALDMM----SQPRGITPVELSRLWDRYYRLVR 189
           YYL N+FGSK RLDYGTGHELSFLA V+A+DM+    S P G    ++  L++ YY LV+
Sbjct: 130 YYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSG---EDILFLFNGYYTLVK 186

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA---NNPVGVQPRDVLSGVIPGRDDA 246
           +LI  Y LEPAGSHGVWGLDDHFHLAY+ G+SQ A   +NP+  +P D+L       D A
Sbjct: 187 KLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPL--RPSDILDRHT-VEDYA 243

Query: 247 PANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306
             N   +AI F+  VK G F E+SPML DI   VS+W K+QRGL +MY+AEVLNKFPVVQ
Sbjct: 244 KTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAEVLNKFPVVQ 303

Query: 307 HFWFGTAFFPWTSVRDGTPLPVYE--QSADTEQETFDSXXXXXXXXXXXXXXDTSTMASV 364
           HFWFGT FFPW +V+ G  LP YE  Q  +    +  S               +ST    
Sbjct: 304 HFWFGTGFFPWVNVKSGAILPTYEANQEENPHFSSVTSISNMPTATKSVLPATSSTTMPP 363

Query: 365 PSRRPAMGPPAGRQVNKFIQHTTASHRDRLRR 396
           P+  P+   P G+  N          RDR +R
Sbjct: 364 PTILPSRNSPMGKFAN----------RDRFKR 385

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  328 bits (840), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/396 (45%), Positives = 240/396 (60%), Gaps = 23/396 (5%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR--GDTSGGISASVAR 73
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M    D      AS   
Sbjct: 6   VDWPHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIP 65

Query: 74  M----LQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129
           M    +Q+LD+L  L+DETPPL GPRRYGNLACR+WH K+D  LP    ++         
Sbjct: 66  MDNGLMQVLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVVV 125

Query: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189
            E +YYL NSFGS  RLDYGTGHELSF+A V ALD++     +   ++  L+++YY ++R
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMFPHLRGTDVFLLFNKYYTIMR 185

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR++L   +  R+   
Sbjct: 186 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSL-VREYKN 244

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTSTMASVPSR 367
           FWFGT FFPW ++++GT LPV+E+  +   E  ++               T   AS+ S 
Sbjct: 305 FWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANA------GPPGPEHTSTRFPASM-SM 357

Query: 368 RPAMGPPAGRQVNKFIQHTTASH-------RDRLRR 396
            P + P +G  +N  + H   S        RDRLRR
Sbjct: 358 PPPITPLSGSNINYLLSHQNHSQRNQPSSPRDRLRR 393

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  325 bits (833), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 215/331 (64%), Gaps = 9/331 (2%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR------GDTSGGISA 69
           +D  HA F  P KRIFD+QTT  FQ S+A+ RI++H+ KY  +M          +    A
Sbjct: 15  VDWLHATFSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIA 74

Query: 70  SVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129
            V  ++ +LD+L  L+DETPPL GPRRYGNLACR+WH K+D  L     ++         
Sbjct: 75  MVNGLMGVLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVVV 134

Query: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189
            E +YYL NSFGS  RLDYGTGHELSF+A VAALD++     +   ++  L+++YY ++R
Sbjct: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFPHLRGNDVFLLFNKYYTIMR 194

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVIPGRDDAP 247
           RLI+ Y LEPAGSHGVWGLDDHFHL Y+ G+SQ+   +    +QPR+VL   +   D   
Sbjct: 195 RLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLV-HDYKD 253

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            NF  + I F+  VK GPF E+SP+L DI   V  W K+ +GL +MY+ EVL KFPVVQH
Sbjct: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQE 338
           FWFGT FFPW ++++GT LPV+E+  D   E
Sbjct: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIE 344

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  315 bits (807), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/388 (44%), Positives = 229/388 (59%), Gaps = 23/388 (5%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM-RGDTSGGIS--ASVA 72
           L  E+  F  P KRIFDSQ T  FQ SVA+ R+++ I+KY +++ R +   G S  + V 
Sbjct: 4   LTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGPSRISVVN 63

Query: 73  RMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEA 132
             + +L+ +  LVD+TPPL GPRRYGNLACRDWH K+D  +P L  +V         +E 
Sbjct: 64  EFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPDRFHHCIVEL 123

Query: 133 EYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELS-----RLWDRYYRL 187
            +YL NSFGS  RLDYGTGHELSFLA V A+DM+    G+   E        + + YY +
Sbjct: 124 VHYLGNSFGSATRLDYGTGHELSFLAVVGAIDML----GLFTDEFQGEDFLLIMNAYYAV 179

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFAN-NPVGVQPRDVLSGVIPGRDDA 246
           VR+LI+ Y LEPAGSHGVWGLDDHFHLAY++G++Q+AN     ++PRD+L+  +  ++ A
Sbjct: 180 VRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHLV-QEYA 238

Query: 247 PANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306
             N   + IGF+  VK GPF E+S ML D+ + V +W K++ GL +MY  EVLNKFPVVQ
Sbjct: 239 HLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNKFPVVQ 298

Query: 307 HFWFGTAFFPWTSVRDGTPLPVYE---------QSADTEQETFDSXXXXXXXXXXXXXXD 357
           HFWFGT F+PW   + G  L +Y+          S   +   F S               
Sbjct: 299 HFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKYAAFVSSINSPVPHFPAPSTT 358

Query: 358 TSTMASVPSRRPAMGPPAGRQVNKFIQH 385
            ++ A  P  R  MGPP  R  N    H
Sbjct: 359 AASEARAPPARTRMGPPTARTTNSTAHH 386

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  315 bits (808), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 171/417 (41%), Positives = 228/417 (54%), Gaps = 40/417 (9%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGIS-----AS 70
           ++++   F  P KRI+DSQ+T TFQ S+A+ R+++++ KY+ M+       ++       
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAG----- 125
           V  M  +L  L   +D  PP  GPRRYGNLACR+WH  +DS +P L  +V   +      
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEK 126

Query: 126 ------GGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELS 178
                  G  IE  YYL NS GS  RLDYGTGHELSFLA +AA+DM+         V+L 
Sbjct: 127 GEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLL 186

Query: 179 RLWDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG-VQPRDVLS 237
            ++  YY LV++LIV Y LEPAGSHGVWGLDDHFHL+Y+ G+SQ + NP     P D+++
Sbjct: 187 HMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIIN 246

Query: 238 GVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAE 297
             I   +    NF    I F+  VK GPF E+SP+L DI + V+SW K+  GL +MY  E
Sbjct: 247 KKI-VTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVE 305

Query: 298 VLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXX-----XXXXX 352
           VLNKFPVVQHFWFG  F+PW +V+    L VY    + E   F+S               
Sbjct: 306 VLNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNKDR 365

Query: 353 XXXXDTSTMASVPS-------------RRPAMGPPAGRQVNKFIQHTTASHRDRLRR 396
               + S +  +P              RRP MGPP+   V   +Q       DR RR
Sbjct: 366 SVNQNPSQLNRIPQNRYTAIPVNNRDLRRPPMGPPSSHGVENILQFKPI---DRFRR 419

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  311 bits (797), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 161/331 (48%), Positives = 214/331 (64%), Gaps = 7/331 (2%)

Query: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDT--SGGISASV 71
           +   VE   F  P KRIFD+  T  FQ+S+ + R++ H+E+Y+++++G        + +V
Sbjct: 1   MEFSVEGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSSQNRAV 60

Query: 72  ARMLQILDRLDALVDETPPLVG-PRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACI 130
            R + IL+RLDAL+DETPP  G  RR+G+LACRDWHD++   L GL   +   A   +  
Sbjct: 61  VRFVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPEAARRSAA 120

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMS--QPRGITPVELSRLWDRYYRLV 188
           E  YYL ++FGS+ RLDYGTGHEL+FLA V ALDM+        T  ++  +W RYY LV
Sbjct: 121 ELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWARYYALV 180

Query: 189 RRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN-PVGVQPRDVLSGVIPGRDDAP 247
            RLI+ YNLEPAGSHGVWGLDDH HLAY+ GASQ+A +  V +QP D+L      R  + 
Sbjct: 181 HRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVARY-SE 239

Query: 248 ANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
            N    +I F+  VK G F ++SPML+DI   V +W K+  GL +MY  EVLNKFPVVQH
Sbjct: 240 TNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFPVVQH 299

Query: 308 FWFGTAFFPWTSVRDGTPLPVYEQSADTEQE 338
           FWFGT FFPW  +  G  LP YE  ++T ++
Sbjct: 300 FWFGTGFFPWVDMAHGMSLPNYEAPSETSEK 330

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  312 bits (800), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 162/328 (49%), Positives = 215/328 (65%), Gaps = 21/328 (6%)

Query: 22  VFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMM--RGDTSGGISASVARMLQILD 79
           +F +P KRI+DSQ    FQ S A+ R+   I KY  ++  R      +S  V  ++++LD
Sbjct: 1   MFSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVADLELSGVVGGVVKVLD 60

Query: 80  RLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLT---------SQVDCLAGGGACI 130
           RLD LV ETPP+ GPRRYGN+ACRDWH+K++  +PGL          S++ C+      +
Sbjct: 61  RLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLISSHFPSELQCV------V 114

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVRR 190
           E  YYL NSFGS  RLD+GTGHELSFLA VAALDM+         ++  ++DRYY LV R
Sbjct: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLGA--SFDGDQVLYIFDRYYSLVHR 172

Query: 191 LIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFAN-NPVGVQPRDVLSGVIPGRDDAPAN 249
           LI+ Y LEPAGSHGVWGLDDHFHLAY+ G+SQ+ N   + ++P D LS  +     +  N
Sbjct: 173 LILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPND-LSDPVLVEQYSRTN 231

Query: 250 FLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFW 309
              + + FV +VK G F E+SPML DI   V +W K+++GL++MY  EVLNKFPV+QHFW
Sbjct: 232 IFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFW 291

Query: 310 FGTAFFPWTSVRDGTPLPVYEQSADTEQ 337
           FGT F+PW   ++G PLP YE S D ++
Sbjct: 292 FGTGFYPWVDYKNGKPLPNYENSPDIDE 319

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  304 bits (779), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 210/331 (63%), Gaps = 7/331 (2%)

Query: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISA 69
           +  D E+A F  P+KRIFDSQ T  FQ SVA+ RI++H++KY+ + +G    DT    S 
Sbjct: 1   MDFDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDTIKE-SF 59

Query: 70  SVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGAC 129
               ++++L RL AL+DETPP     RYGNL+ RDW  K  + L     ++       + 
Sbjct: 60  FTNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPEKYNNSI 119

Query: 130 IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWDRYYRLVR 189
           IE  YY+ N+FGSK R+DYGTGHELSFLA +  LDM+ +   I    L   ++ YY +++
Sbjct: 120 IELSYYISNAFGSKERIDYGTGHELSFLAVIICLDML-KIETIKGPALLYCFNSYYDVIQ 178

Query: 190 RLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPAN 249
           +LI+ Y LEPAGSHGVWGLDDHFH +Y+ GA+Q  +    + P+D+ S       ++ +N
Sbjct: 179 KLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTSLIPKDI-SNTRLMEQNSSSN 237

Query: 250 FLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFW 309
              ++I F+  VK GPF  +SP+L +I   V +W K+Q+GL +MY  EVLNKFPVVQHFW
Sbjct: 238 LFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKFPVVQHFW 297

Query: 310 FGTAFFPWTSVRDGTPLPVYEQSADTEQETF 340
           FGTAFFPWTS  +   LP+Y+ + + +   F
Sbjct: 298 FGTAFFPWTSYGNNHSLPIYQPAENNDDADF 328

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  301 bits (772), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 166/408 (40%), Positives = 231/408 (56%), Gaps = 37/408 (9%)

Query: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG-----DTSGGISAS 70
           L+ E   F  P KRI+DSQ T+ FQ SVA+ R+++ I KY++++       ++      +
Sbjct: 8   LNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT 67

Query: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV---DCLAGGG 127
           V ++++++  L  LVDETPP  GPRR+GNL+CR+WH KVD +L  L  ++   D      
Sbjct: 68  VNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISS 127

Query: 128 AC----IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSRLWD 182
            C    +E  YYL NSFGS  RLDYGTGHELSF+A +A +DM+      I   +L  +++
Sbjct: 128 KCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFN 187

Query: 183 RYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVI 240
            YY+L+++LI+ Y LEPAGSHGVWGLDDHFH AY+ G++Q++  NNP  ++P D+++  +
Sbjct: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNP-PLKPMDIVNKDL 246

Query: 241 PGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN 300
              + A  N    AI F+  VK GPF E+SPML DI   V +W K++ GL +MY  EVLN
Sbjct: 247 VC-EYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLN 305

Query: 301 KFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSXXXXXXXXXXXXXXDTST 360
           KFPVVQHFWFGT  FPW        LP+YE  A  +  +  +              D S 
Sbjct: 306 KFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAK-KTTSIHTKSPSPSPLGISTRRDFSK 364

Query: 361 MAS-------------------VPSRRPAMGPPAGRQVNKFIQHTTAS 389
             S                    P R+  MGPP+   VN      + S
Sbjct: 365 FTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNSPS 412

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  301 bits (770), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 216/352 (61%), Gaps = 39/352 (11%)

Query: 20  HAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMR------------GDTSGGI 67
           + VF  P K+IFDSQ T  F  S+A  RI++ I KY ++++             DT  G+
Sbjct: 12  NCVFSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGV 71

Query: 68  SASVARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGG 127
           S       +I++ L  LV+ETPPL GPRRYGNL+CR WH +VD ++  L  +   ++   
Sbjct: 72  S-------KIINDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTK 124

Query: 128 -----ACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELSRLWD 182
                  +E  YY   S GS  RLDYGTGHELSFLAF+ ALDM++    I+  ++  +++
Sbjct: 125 FNKDQLFLELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTDISGTDILFIFN 184

Query: 183 RYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA-----------NNP---V 228
            YYRL+R+LI++Y LEPAGSHGVWGLDDHFHL Y++G+SQ+            + P    
Sbjct: 185 EYYRLIRKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKA 244

Query: 229 GVQPRDVLSGVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQR 288
            ++P D+L+  +  +  + +NF  ++I F+ +VK GPF E+SP+L DI   V +W+K++ 
Sbjct: 245 PIKPVDILNKNLIEKFKS-SNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRS 303

Query: 289 GLFRMYNAEVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETF 340
           GL +MY  EVLNKFPVVQHFWFGT F+PW +      LP YE + D    T+
Sbjct: 304 GLLKMYMVEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYELAPDDNNTTY 355

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  291 bits (746), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 205/334 (61%), Gaps = 19/334 (5%)

Query: 14  LPLDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGISA--SV 71
           + +++    F  P KRIFDS  T  FQ S+ + R++ H+E+Y+ ++       +S   SV
Sbjct: 1   MTVELRKTKFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPKVSTNGSV 60

Query: 72  ARMLQI-LDRLDALVDETPPLVG-PRRYGNLACRDWHDKVDSSLPGLTSQ---VDCLAGG 126
           +  + I LDR   L+DETPP    PRR+GN+ACRDWH KV   +  L  +   ++  A  
Sbjct: 61  SSFVSIFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAY 120

Query: 127 GACI-EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMM------SQPRGITPVELSR 179
             CI E  YYL N+FGS  RLDYGTGHELSFLA V A+DM+          G+T  +L  
Sbjct: 121 ENCIIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLY 180

Query: 180 LWDRYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVG--VQPRDVLS 237
           LW++YY +V +LI+ Y LEPAGSHGVWGLDDH HLAY+ GASQ+++      +Q  D+L 
Sbjct: 181 LWNKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILD 240

Query: 238 -GVIPGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNA 296
              +   +D   N    +I FV  VK GPF ++SPML DI   V +W K   GL +MY  
Sbjct: 241 MKSLYQYEDT--NLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQV 298

Query: 297 EVLNKFPVVQHFWFGTAFFPWTSVRDGTPLPVYE 330
           EVLNKFPVVQHFWFGT FFPW  ++ G  LP YE
Sbjct: 299 EVLNKFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  152 bits (385), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/305 (33%), Positives = 160/305 (52%), Gaps = 32/305 (10%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           PQKR+        + ES     +   I K    ++G  +      IS+S+  +  +LD++
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRENTQYVEPISSSIDELCSLLDKV 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGL---------TSQVDCLAGGGACI 130
           + +V   P +      R+G +  RD++D + S    +         T QVD LA      
Sbjct: 63  NKVVSSHPVIQDANTSRFGKVEFRDFYDDLSSRSSEMISSLSDKLSTPQVDELAA----- 117

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALD---MMSQPRGITPVELSRLWDRYYRL 187
               Y R S+G++ R+DYG+GHEL+F+ F+  L+        +  T V L R++ +Y  +
Sbjct: 118 ----YFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVL-RVFIKYLDV 172

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAP 247
           +R L   Y LEPAGSHGVWGLDD+  L +L+GA Q A +   ++P+ + +       +  
Sbjct: 173 MRTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHK-HLKPKSIHNKEFVEMFEKR 231

Query: 248 ANFLVEAIGFVKSVKHG-PFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306
             +    IGF+ SVK       +SPML+DI SGV +W K+  G+ +MY AEVL K P++Q
Sbjct: 232 YLYF-GCIGFINSVKTSISLRWHSPMLDDI-SGVKTWSKVAEGMVKMYKAEVLGKLPIMQ 289

Query: 307 HFWFG 311
           HF+FG
Sbjct: 290 HFYFG 294

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  152 bits (384), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/298 (32%), Positives = 160/298 (53%), Gaps = 16/298 (5%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+  ++    + +S  +  +   +      +RG  +      IS  +   +Q+L ++
Sbjct: 3   PEKRLTTNKDMKIWMDSTTMDSLVEFVTILADSVRGRENTAYKEPISKDMEPTMQLLKKV 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRNS 139
           + L+D+ P +      R+G +  RD++D + +    L +            E   YL  S
Sbjct: 63  NDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELVATTYPSLNKDQVEELAVYLYES 122

Query: 140 FGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVDYN 196
           +G+K R+DYG+GHEL+F+ F+  L    +    R    + L +++  Y R++R L   Y 
Sbjct: 123 WGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVL-KVFVEYLRIMRILETKYW 181

Query: 197 LEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLS-GVIPGRDDAPANFLVEAI 255
           LEPAGSHGVWGLDD+  L +L+GA Q A +P  ++P+ + +  V+    D    F    I
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAHQLATHP-HLRPKSIHNEEVVEMFMDKYIYF--GCI 238

Query: 256 GFVKSVKH-GPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGT 312
            F+ SVK       +SPML+DI SGV +W K+  G+ +MY AEVL+K P++QHF+FG 
Sbjct: 239 AFINSVKSTASLRWHSPMLDDI-SGVKTWAKVAEGMIKMYKAEVLSKLPIMQHFYFGN 295

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  150 bits (379), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 158/309 (51%), Gaps = 40/309 (12%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDRL 81
           P KRI   +    ++ES     I   IE   + + G      S  +S SV   + +L  +
Sbjct: 3   PSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFENDQVSEPVSDSVQSTIAVLTEI 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKV--------DSSLPGLTS-QVDCLAGGGACI 130
           D L+   P +      R+G +  RD++D V         S  P LTS Q++ L+      
Sbjct: 63  DKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLLSSHFPALTSEQIEQLS------ 116

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL------DMMSQPRGITPVELSRLWDRY 184
               YL+ S+G+K R+DYG+GHEL+F+ F+  L      D+    R +  V    L+  Y
Sbjct: 117 ---IYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLV----LFIEY 169

Query: 185 YRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRD 244
            +++R +   Y LEPAGSHGVWGLDD+  L +L+GA Q A +   ++P+ + +  +    
Sbjct: 170 LKIMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHK-HLKPKSIHNEELVEM- 227

Query: 245 DAPANFLVEAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKF 302
            A        I F+ SVK      W +SPML+DI SGV  W K+  G+ +MY AEVL K 
Sbjct: 228 FADKYLYFGCIAFINSVKTSTSLRW-HSPMLDDI-SGVKKWSKVAEGMIKMYKAEVLGKL 285

Query: 303 PVVQHFWFG 311
           P++QHF+F 
Sbjct: 286 PIMQHFYFS 294

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  150 bits (378), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 100/306 (32%), Positives = 162/306 (52%), Gaps = 26/306 (8%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDRL 81
           PQKR+  +     +  S   A +   +++  + + G    D +  IS  V  M+++L ++
Sbjct: 3   PQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQPVESMMKLLHKV 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAG-GGACIEAEY-YLR 137
            +++ + P +      R+G +  RD++D + S    L  +  C      + IE  Y Y+ 
Sbjct: 63  QSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLLKE--CFPSLTDSQIEQLYVYVD 120

Query: 138 NSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVD 194
            S+G+K R+DYG+GHEL+F+ F+  L    +    R  T + L +++ +Y +L+R L + 
Sbjct: 121 ESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVL-KVFIQYLKLMRVLELQ 179

Query: 195 YNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPANF 250
           Y LEPAGSHGVWGLDD+  L +L+GA Q + +    P  +   D++         A    
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGAYQLSTHKHLKPSSIHNDDLIEMF------ADKYL 233

Query: 251 LVEAIGFVKSVKHGPFWE-NSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFW 309
               I F+ SVK       +SPML+DI SGV  W K+  G+F+MY AEV+ K P++QHF+
Sbjct: 234 YFGCIEFINSVKTTTTLRWHSPMLDDI-SGVKKWSKVAEGMFKMYEAEVIKKLPIMQHFY 292

Query: 310 FGTAFF 315
           F   F 
Sbjct: 293 FNDMFL 298

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  149 bits (376), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 90/254 (35%), Positives = 140/254 (55%), Gaps = 8/254 (3%)

Query: 67  ISASVARMLQILDRLDALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLA 124
           IS+ +  +  +LD +  +VD+ P +   G  R+G +  RD++D+V  +   L S +    
Sbjct: 48  ISSQIENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELISSLSSEL 107

Query: 125 GGGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQPRGITPVELS-RLWDR 183
                 E   Y   S+G + R+DYG+GHEL+F+ F+  L   S       V L  +++ +
Sbjct: 108 TDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLKVFIK 167

Query: 184 YYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGR 243
           Y  ++R L   Y LEPAGSHGVWGLDD+  L +L+GA Q   +   ++P+ + +  I   
Sbjct: 168 YLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHK-HLKPKSIHNPEIVEV 226

Query: 244 DDAPANFLVEAIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKF 302
            +    +  E + F+  VK       +SPML+DI SGV +W K+  G+ +MY AEVL K 
Sbjct: 227 FEKRYMYF-ECVAFINKVKTTASLRWHSPMLDDI-SGVRTWSKVAEGMVKMYKAEVLGKL 284

Query: 303 PVVQHFWFGTAFFP 316
           P++QHF+F T F P
Sbjct: 285 PIMQHFFFST-FLP 297

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  149 bits (375), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 143/251 (56%), Gaps = 11/251 (4%)

Query: 67  ISASVARMLQILDRLDALVDETPPLVGP-RRYGNLACRDWHDKVDSSLPGLTSQVDCLAG 125
           ISA V+  L +LD + ++VDE P L     R+G    R ++  V S+   L S+      
Sbjct: 50  ISAEVSSTLALLDSVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLT 109

Query: 126 GGACIEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWD 182
                +   Y   S+G++ R+DYG+GHEL+F+ F+  L   D+    R  T + +  ++ 
Sbjct: 110 TNQIEQLSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRLERDSTNIVI-LVFV 168

Query: 183 RYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSG-VIP 241
           +Y +++RRL   Y LEPAGSHGVWGLDD+  L +L+GA Q +N+   ++P+ + +  ++ 
Sbjct: 169 KYLKIMRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSNHK-HLKPKSIHNDEIVD 227

Query: 242 GRDDAPANFLVEAIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN 300
              D    F    I F+ SVK       +SPML+DI SGV  W K+  G+ +MY AEVL+
Sbjct: 228 MFKDKYLYF--GCIAFINSVKTTASLRWHSPMLDDI-SGVKKWSKVSEGMIKMYVAEVLS 284

Query: 301 KFPVVQHFWFG 311
           K PV+QHF+F 
Sbjct: 285 KLPVMQHFYFS 295

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  147 bits (370), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 95/300 (31%), Positives = 157/300 (52%), Gaps = 22/300 (7%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+   +    + +S     +   IEK  + + G  +      I+  +   + +L  +
Sbjct: 3   PEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHENKQYQEPITPQIESFMGLLKSV 62

Query: 82  DALVDETPPLVGPR--RYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRNS 139
           + ++D+ P +   +  R+G +  RD++D++ S    L S            +   YL  S
Sbjct: 63  NNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLISNAYPSLTEDQLDQLYVYLDES 122

Query: 140 FGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVDYN 196
           +G+K R+DYG+GHEL+FL  +  L    +  + +  T + L +++  Y R++R L   Y 
Sbjct: 123 WGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVL-KIFIEYLRVMRILETKYW 181

Query: 197 LEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPANFLV 252
           LEPAGSHGVWGLDD+  L +L+GA Q A +    P+ +   +++        D    F  
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLATHKHLKPLSIHNEELVEMF----QDKYLYF-- 235

Query: 253 EAIGFVKSVKHGPFWE-NSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFG 311
             + F+ SVK       +SPML+DI SGV  W K+  G+ +MY AEVL+K P++QHF+FG
Sbjct: 236 SCVAFINSVKTSTSLRFHSPMLDDI-SGVKKWSKVAEGMIKMYRAEVLSKLPIMQHFYFG 294

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  145 bits (366), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/298 (31%), Positives = 151/298 (50%), Gaps = 14/298 (4%)

Query: 25  QPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDR 80
           +PQKR+        +  S     +   +      ++G    +      +S+    Q+L+ 
Sbjct: 2   KPQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLENNEYQKPTGSSIESCCQLLEE 61

Query: 81  LDALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRN 138
           + +L ++ P        R+G +  R ++D + S   GL  +      G  C E   Y   
Sbjct: 62  VASLAEQYPVKQDAETSRFGKVEFRYFYDDLKSKSQGLIQRAFDALDGTQCEELSVYFAE 121

Query: 139 SFGSKIRLDYGTGHELSFLAFVAALD---MMSQPRGITPVELSRLWDRYYRLVRRLIVDY 195
           S+G + R+DYG+GHEL+FL F+  L    +  +P     + L +L+ +Y  ++R L   Y
Sbjct: 122 SWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVL-KLFIKYLGVMRTLETKY 180

Query: 196 NLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPANFLVEAI 255
            LEPAGSHGVWGLDD+  L +L+GA Q + +   ++P+ + +  +              I
Sbjct: 181 WLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK-HLKPKSIHNSEVV-EMFGKRYLYFGCI 238

Query: 256 GFVKSVKH-GPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGT 312
            F+  VK       +SPML+DI SGV +W K+  G+ +MY AEVLNK P++QHF+FG+
Sbjct: 239 DFINKVKTTASLRWHSPMLDDI-SGVKTWAKVAEGMIKMYKAEVLNKLPIMQHFFFGS 295

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  143 bits (360), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/306 (30%), Positives = 158/306 (51%), Gaps = 25/306 (8%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+  ++    +++S   A     +    + + G  +      +S  + RML +L R+
Sbjct: 3   PEKRLLTAEDMKLWEKSQTRADFTKFVIDLAKSVEGHENSQYKEPVSEQITRMLSLLSRV 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRNS 139
             ++++ P +  V   R+G +  RD++D+V  +   L      L       +   YL  S
Sbjct: 63  RDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLLKSEFSLLTDEQLEQLSIYLDES 122

Query: 140 FGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVDYN 196
           +G+K R+DYG+GHEL+F+  +  L    + +     T + L +++  Y  ++R L   Y 
Sbjct: 123 WGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLIL-KVFIEYLDIMRVLETKYW 181

Query: 197 LEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPANFLV 252
           LEPAGSHGVWGLDD+  L +L+GA Q   +    P+ +   +++         +      
Sbjct: 182 LEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNSELVEMF------SDRYLYF 235

Query: 253 EAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWF 310
             I F+  VK      W +SPML+DI SGV +W K+  G+ +MY AEVL+K P++QHF+F
Sbjct: 236 GCIAFINKVKSSASLRW-HSPMLDDI-SGVKTWSKVAEGMIKMYEAEVLSKLPIMQHFYF 293

Query: 311 GTAFFP 316
            + F P
Sbjct: 294 -SEFLP 298

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  142 bits (358), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/305 (31%), Positives = 151/305 (49%), Gaps = 32/305 (10%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGI----SASVARMLQILDRL 81
           P+KRI        ++ S     +   I      + G  +  I    S S+A +  +LD +
Sbjct: 3   PEKRILTENDMEVWKNSATRKDLLNFISTLAESVEGHENSQIVEPISPSIASLSSLLDEV 62

Query: 82  DALVDETPPLVGPR--RYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRNS 139
           + LVD+ P +   +  R+G +  RD++D+++     L              +   YL  S
Sbjct: 63  NKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLIKTRFSTLSDEQLEQLSIYLDES 122

Query: 140 FGSKIRLDYGTGHELSFLAFVAAL------DMMSQPRGITPVELSRLWDRYYRLVRRLIV 193
           +G+K R+DYG+GHEL+F+ F+  L      D+      +  V    ++ +Y  ++R L  
Sbjct: 123 WGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLV----VFLKYLNIMRVLET 178

Query: 194 DYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPAN 249
            Y LEPAGSHGVWGLDD+  L +L+GA Q   +    P+ +   +++             
Sbjct: 179 KYWLEPAGSHGVWGLDDYHFLPFLFGAFQLVPHKHLKPMSIHNEELVELF-------KDK 231

Query: 250 FL-VEAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQ 306
           FL    I F+ SVK      W +SPML+DI SGV  W K+  G+ +MY AEVL K P++Q
Sbjct: 232 FLYFGCISFINSVKTTTSLRW-HSPMLDDI-SGVKKWSKVAEGMIKMYTAEVLGKLPIMQ 289

Query: 307 HFWFG 311
           HF+F 
Sbjct: 290 HFYFS 294

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  141 bits (356), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 104/324 (32%), Positives = 165/324 (50%), Gaps = 23/324 (7%)

Query: 27  QKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDRLD 82
           QKR+        ++ S     +   +    + +RG    + +  +S ++  +  +L+ + 
Sbjct: 12  QKRLLTGSDLDKWKASKTFEELLRFVSSLAQSVRGRENSEHAEPVSPAIEALEALLEEMQ 71

Query: 83  ALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRNSF 140
            +    P L      R+G +  RD+H +V +    L  QVD         E   YL N++
Sbjct: 72  GIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTDEQAQELAVYLGNAW 131

Query: 141 GSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVDYNL 197
           G   R+DYG+GHEL+F+ F+  L    ++S+      V   R++ +Y  ++R L   Y L
Sbjct: 132 GDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTNAV--LRVFVKYMDVMRVLETKYWL 189

Query: 198 EPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLS-GVIPGRDDAPANFLVEAIG 256
           EPAGSHGVWGLDD+  L +L+GA Q A +   ++P+ + +  V+   ++    F    I 
Sbjct: 190 EPAGSHGVWGLDDYHFLPFLFGAFQLATHK-HLKPKSIHNPEVVELFENRYLYF--GCIA 246

Query: 257 FVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGTAFF 315
           F+  VK       +SPML+DI SGV SW K+  G+ +MY AEVL K P++QHF+F + F 
Sbjct: 247 FINRVKTTASLRWHSPMLDDI-SGVRSWTKVSEGMVKMYKAEVLGKLPIMQHFFF-SRFL 304

Query: 316 PWTSVRDGT--PLPVYEQSADTEQ 337
           P   V DG   P    E+ AD  +
Sbjct: 305 P---VPDGVSPPRTSEEELADCSE 325

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  141 bits (356), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 157/312 (50%), Gaps = 46/312 (14%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDRL 81
           P+KR+        ++ S     +   I      ++G      S  IS ++  + QIL  +
Sbjct: 3   PEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCENSQISEPISPAINTLEQILVSI 62

Query: 82  DALVDETPPLVGPR--RYGNLACRDWHDKVDS--------SLPGLT-SQVDCLAGGGACI 130
           D ++D+ P L      R+G    R ++D+++         + P LT  Q++ L       
Sbjct: 63  DKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLIHENFPSLTHEQLEQLT------ 116

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL---DMMS---QPRGITPVELSRLWDRY 184
               YL  S+G+K R+DYG+GHEL+F+ F+  L   D++      R +  +    ++ +Y
Sbjct: 117 ---IYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLI----IFIKY 169

Query: 185 YRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVI 240
             ++R L   Y LEPAGSHGVWGLDD+  L +L+GA Q A +    P+ +   +++    
Sbjct: 170 LDIMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLATHKHLKPLSIHNEELVEMF- 228

Query: 241 PGRDDAPANFLVEAIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVL 299
                A        I F+ SVK       +SPML+DI SGV  W K+  G+ +MYNAEVL
Sbjct: 229 -----AKKYLYFGCIAFINSVKTTASLRWHSPMLDDI-SGVKRWSKVAEGMVKMYNAEVL 282

Query: 300 NKFPVVQHFWFG 311
           +K P++QHF+F 
Sbjct: 283 SKLPIMQHFYFS 294

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  139 bits (350), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 158/314 (50%), Gaps = 41/314 (13%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+        ++ES   A     I      ++G  +      IS S+  M+ +L ++
Sbjct: 3   PEKRLLTPDDMKLWEESPTRAHFTKFIIDLAESVKGHENSQYKEPISESINSMMNLLSQI 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVD--------SSLPGLT-SQVDCLAGGGACI 130
             +  + P +      R+G +  RD++D+V         S  P LT  Q++ L+      
Sbjct: 63  KDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKILRSEFPSLTDEQLEQLS------ 116

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRL 187
               YL  S+G+K R+DYG+GHEL+F+  +  L    + +     T + L +++  Y ++
Sbjct: 117 ---IYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVL-KVFIEYLKI 172

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGR 243
           +R L   Y LEPAGSHGVWGLDD+  L +L+GA Q   +    P+ +   +++       
Sbjct: 173 MRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMF---- 228

Query: 244 DDAPANFLVEAIGFVKSVKHGPFWE-NSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKF 302
             A        I F+  VK       +SPML+DI SGV +W K+  G+ +MY AEVL+K 
Sbjct: 229 --AHRYLYFGCIAFINKVKSSASLRWHSPMLDDI-SGVKTWSKVAEGMIKMYKAEVLSKL 285

Query: 303 PVVQHFWFGTAFFP 316
           P++QHF+F + F P
Sbjct: 286 PIMQHFYF-SEFLP 298

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  139 bits (350), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 162/315 (51%), Gaps = 43/315 (13%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+  S     ++ES   A     I      ++G  +      +S  ++RM+ +L  +
Sbjct: 3   PEKRLLTSGDMKLWEESQTRANFTKFIIDLAESVKGHENSQYEEPVSEPISRMMNLLSYI 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVD--------SSLPGLT-SQVDCLAGGGACI 130
             ++ + P +      R+G +  RD++D+V         S  P LT  Q++ L+      
Sbjct: 63  RDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFLRSEFPSLTDEQLEQLS------ 116

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRL 187
               YL  S+G+K R+DYG+GHEL+F+  +  L    + +     T + L +++  Y ++
Sbjct: 117 ---IYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLIL-KVFIEYLKI 172

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGR 243
           +R L   Y LEPAGSHGVWGLDD+  L +L+GA Q  ++    P+ +   +++       
Sbjct: 173 MRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTSHKHLKPISIHNNELVEMF---- 228

Query: 244 DDAPANFLVEAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNK 301
             A        I F+  VK      W +SPML+DI SGV +W K+  G+ +MY AEVL+K
Sbjct: 229 --ANRYLYFGCIDFINKVKSSASLRW-HSPMLDDI-SGVKTWSKVAEGMIKMYEAEVLSK 284

Query: 302 FPVVQHFWFGTAFFP 316
            P++QHF+F + F P
Sbjct: 285 LPIMQHFYF-SDFLP 298

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  139 bits (349), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 95/303 (31%), Positives = 154/303 (50%), Gaps = 28/303 (9%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P KR+   +    ++ S   A +   IE+    +RG  +      ISASV  ++ +L ++
Sbjct: 6   PCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRENEQYDLPISASVEALMGLLQQV 65

Query: 82  DALVDETPPL---VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRN 138
             +++  P         R+G +  RD++D++ +    L +            + + YL  
Sbjct: 66  RGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQNQVRQLQTYLEE 125

Query: 139 SFGSKIRLDYGTGHELSFLAFVAAL------DMMSQPRGITPVELSRLWDRYYRLVRRLI 192
           S+G K R+DYG+GHEL+F+ F+  L      D+    R    +   + +  Y +++R L 
Sbjct: 126 SWGDKRRIDYGSGHELNFMCFLYGLTAYKVFDLGGTDRANLVL---KPFIEYLKIMRVLE 182

Query: 193 VDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPA 248
            +Y LEPAGSHGVWGLDD+  L +L+GA Q + +    P+ +   +V+         A  
Sbjct: 183 TEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHKHLKPLSIHNEEVVELF------ADK 236

Query: 249 NFLVEAIGFVKSVKHGPFWE-NSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
                 I F+ SVK       +SPML+DI SGV  W K+  G+ +MY AEVL+K P++QH
Sbjct: 237 YLYFGCIHFINSVKTTATLRWHSPMLDDI-SGVKKWSKVAEGMVKMYQAEVLSKLPIMQH 295

Query: 308 FWF 310
           F+F
Sbjct: 296 FYF 298

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  137 bits (346), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 157/300 (52%), Gaps = 18/300 (6%)

Query: 25  QPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDR 80
           +PQKR+  SQ   T+ +     ++   I +    ++G  +      I AS+ +   +LD 
Sbjct: 2   KPQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLENNQYQEPIGASIDKCCSLLDE 61

Query: 81  LDALVDETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTS-QVDCLAGGGACIEAEYYLR 137
           + ++  + P        R+G +  R ++D +      L S + D L+   A  E   Y  
Sbjct: 62  VFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQDQA-EELVAYFV 120

Query: 138 NSFGSKIRLDYGTGHELSFLAFVAALD---MMSQPRGITPVELSRLWDRYYRLVRRLIVD 194
            S+G + R+DYG+GHEL+F+ F+  L    +  + R    + L +++  Y  L+R L   
Sbjct: 121 ESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVL-KVFIHYLELMRVLETT 179

Query: 195 YNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLSGVIPGRDDAPANFL-VE 253
           Y LEPAGSHGVWGLDD+  L +L+GASQ A +   ++P+ + +  +   D   + +L   
Sbjct: 180 YWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHK-HLKPKSIHNNELV--DMFASRYLYFG 236

Query: 254 AIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHFWFGT 312
            I F+  VK       +SPML+DI SG  SW K+  G+ +MY  EVL K P++QHF FG+
Sbjct: 237 CIDFINRVKTTASLRWHSPMLDDI-SGAKSWSKVAEGMIKMYRKEVLAKLPIMQHFLFGS 295

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  135 bits (340), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 94/309 (30%), Positives = 150/309 (48%), Gaps = 28/309 (9%)

Query: 24  RQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGGISASVARMLQILDRLDA 83
           + P+KR+        +Q     + +   + +    ++G  +   S  +   +Q ++ L  
Sbjct: 2   KLPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLENSQYSQPIGGSIQSVEALIE 61

Query: 84  LVD---ETPPL--VGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLRN 138
            VD   E  P+   GP R+G    RD +D +      L  +           +   Y   
Sbjct: 62  CVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLIKEKFGSLTDEQVAQLSVYFNE 121

Query: 139 SFGSKIRLDYGTGHELSFLAFVAAL------DMMSQPRGITPVELSRLWDRYYRLVRRLI 192
           S+G K R+DYG+GHEL+FL F+  L      D+    R +  +    ++ +Y + +R + 
Sbjct: 122 SWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLI----VFMKYLKTMRVIE 177

Query: 193 VDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPA 248
             Y LEPAGSHGVWGLDD+  L +L+GASQ + +    P  +   +V+         +  
Sbjct: 178 TVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRHLKPKSIHNPEVVEMF------SEK 231

Query: 249 NFLVEAIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQH 307
                 I F+ SVK       +SPML+DI SGV  W K+ +G+ +MY+AEVL K P++QH
Sbjct: 232 YLYFGCIDFINSVKTTASLRWHSPMLDDI-SGVKEWAKVYQGMVKMYDAEVLCKLPIMQH 290

Query: 308 FWFGTAFFP 316
           F+F + F P
Sbjct: 291 FYF-SEFLP 298

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  135 bits (340), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 96/303 (31%), Positives = 152/303 (50%), Gaps = 29/303 (9%)

Query: 28  KRIFDSQTTATFQESVALARIRFHIEKYMRMMRG----DTSGGISASVARMLQILDRLDA 83
           KR+ +      +  S     +   I      +RG    D +  IS +V R+  +L ++  
Sbjct: 4   KRLINEHDMELWNNSKTFEDVIGFINTLALSVRGRENNDYTQPISDNVQRVSNLLSKVTE 63

Query: 84  LV--DETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQVDCLAG-----GGACIEAEYYL 136
           ++   E        R+G +  RD++D +      L S++    G      G   +   Y 
Sbjct: 64  IIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKI--FEGIEKPDTGKLDDICTYF 121

Query: 137 RNSFGSKIRLDYGTGHELSFLAFVAAL------DMMSQPRGITPVELSRLWDRYYRLVRR 190
            NS+G + R+DYG+GHEL+F+ F+  L      D+ +    I  +    L+ +Y  ++R 
Sbjct: 122 INSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLM----LFIKYLGIMRS 177

Query: 191 LIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANNPVGVQPRDVLS-GVIPGRDDAPAN 249
           L + Y LEPAGSHGVWGLDD+  L +L+GA Q + +   ++P+ + +  V+    D    
Sbjct: 178 LELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSTHK-HLKPKSIHNPEVVEMFQDRYLY 236

Query: 250 FLVEAIGFVKSVK-HGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHF 308
           F    I F+  VK       +SPML+DI SGV  W K+  G+ +MY AEVL K P++QHF
Sbjct: 237 F--GCIAFINKVKTTASLRWHSPMLDDI-SGVKRWSKVAEGMVKMYKAEVLQKLPIMQHF 293

Query: 309 WFG 311
           +FG
Sbjct: 294 YFG 296

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  134 bits (338), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 159/315 (50%), Gaps = 43/315 (13%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRGDTSGG----ISASVARMLQILDRL 81
           P+KR+  +     ++ES   A     I +    ++G  +      IS  +  M+ +L ++
Sbjct: 3   PEKRLLTAGDMKLWEESQTRADFTKFIIELAESVKGHENYQFKEPISEQIISMMNLLSQI 62

Query: 82  DALVDETPPL--VGPRRYGNLACRDWHDKVD--------SSLPGLT-SQVDCLAGGGACI 130
             ++ + P +      R+G +  RD++D+V         S  P LT  Q++ L+      
Sbjct: 63  KDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQLEQLS------ 116

Query: 131 EAEYYLRNSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRL 187
               YL  S+G+K R+DYG+GHEL+F+  +  L    + +     T + L +++  Y ++
Sbjct: 117 ---IYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLIL-KVFIEYLQI 172

Query: 188 VRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGR 243
           +R L   Y LEPAGSHGVWGLDD+  L +L+GA Q   +    P+ +   +++       
Sbjct: 173 MRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLTTHKHLKPISIHNNELVEMF---- 228

Query: 244 DDAPANFLVEAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNK 301
             A        I F+  VK      W +SPML+DI SGV +W K+  G+ +MY  EVL+K
Sbjct: 229 --AHRYLYFGCIAFINKVKSSASLRW-HSPMLDDI-SGVKTWSKVAEGMIKMYKVEVLSK 284

Query: 302 FPVVQHFWFGTAFFP 316
            P++QHF+F   F P
Sbjct: 285 LPIMQHFYF-CEFLP 298

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  125 bits (314), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 154/319 (48%), Gaps = 30/319 (9%)

Query: 26  PQKRIFDSQTTATFQESVALARIRFHIEKYMRMM----RGDTSGGISASVARMLQILDRL 81
           P+KR+  SQ    +  S     +   IE     +        S  +S S+     +L  +
Sbjct: 2   PEKRLLSSQDLTIWINSKTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFSLLQDI 61

Query: 82  DALVDETPPLVG----PRRYGNLACRDWHDKVDSSLPGLTSQVDCLAGGGACIEAEYYLR 137
             +++  P          R+G +  + ++D ++ +   L              E   YL 
Sbjct: 62  RDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLIKSHFNGLDPNQIQELSIYLV 121

Query: 138 NSFGSKIRLDYGTGHELSFLAFVAAL---DMMSQPRGITPVELSRLWDRYYRLVRRLIVD 194
            S+G++ R+DYG+GHEL+F+ F+  L   ++ +     T + L +++  Y  ++R +   
Sbjct: 122 ESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVL-KIFMEYINIMRIIETK 180

Query: 195 YNLEPAGSHGVWGLDDHFHLAYLWGASQFANN----PVGVQPRDVLSGVIPGRDDAPANF 250
           Y LEPAGSHGVWGLDD+  L +L+GA Q + +    P+ +   +++        D    F
Sbjct: 181 YWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKHLKPISIHNEEMVEMF----KDKYMYF 236

Query: 251 LVEAIGFVKSVKHGPF--WENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLNKFPVVQHF 308
               I F+ S+K      W +SPML+DI SGV  W K+  G+ +MY+AEVL K P++QHF
Sbjct: 237 --GCIDFINSIKTTATLRW-HSPMLDDI-SGVKKWSKVSEGMIKMYSAEVLGKLPIMQHF 292

Query: 309 WFGTAFFPWTSVRDGTPLP 327
           +F + F P      G  LP
Sbjct: 293 YF-SDFLP---CPQGVSLP 307

>TBLA0D03770 Chr4 complement(937698..938198) [501 bp, 166 aa] {ON}
           Anc_1.499 YJR055W
          Length = 166

 Score = 34.3 bits (77), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 26/51 (50%)

Query: 34  QTTATFQESVALARIRFHIEKYMRMMRGDTSGGISASVARMLQILDRLDAL 84
           QTT T QE +    ++FH+ K  R++  D S   S   +R    +D L+ L
Sbjct: 93  QTTPTIQELLQYNTVKFHLAKVYRILNSDPSNEESTPESRKQLAIDYLNLL 143

>NCAS0F03780 Chr6 complement(760976..763699) [2724 bp, 907 aa] {ON}
           Anc_3.523 YER033C
          Length = 907

 Score = 31.6 bits (70), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 88  TPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV 120
           TPPL  P R  +L   D +  +D+ +PGLTS +
Sbjct: 666 TPPLPPPARSQSLKYHDLNSNLDAEVPGLTSNL 698

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.429 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,869,391
Number of extensions: 1620566
Number of successful extensions: 3138
Number of sequences better than 10.0: 42
Number of HSP's gapped: 3072
Number of HSP's successfully gapped: 42
Length of query: 396
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 284
Effective length of database: 40,638,807
Effective search space: 11541421188
Effective search space used: 11541421188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)