Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021605.707ON2092099441e-131
KAFR0D022005.707ON1821191553e-12
NCAS0G002105.707ON2881531241e-07
ZYRO0B16434g5.707ON2371101195e-07
TPHA0E001805.707ON1651061113e-06
NDAI0F002705.707ON2981151073e-05
Suva_9.365.707ON224102930.001
TBLA0I016905.707ON320106900.004
Smik_9.175.707ON251102840.020
AGR078C8.270ON715123691.8
NOTE: 9 genes in the same pillar as KNAG0L02160 were not hit in these BLAST results
LIST: Kpol_1043.74 Skud_9.16 YIL152W KLTH0E00946g Kwal_55.19675 TDEL0B02130 KLLA0A00506g Cgla_YGOB_Anc_5.707 SAKL0E15026g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02160
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {O...   368   e-131
KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.70...    64   3e-12
NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707 ...    52   1e-07
ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa] ...    50   5e-07
TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707 ...    47   3e-06
NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707 ...    46   3e-05
Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)     40   0.001
TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON...    39   0.004
Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)     37   0.020
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    31   1.8  

>KNAG0L02160 Chr12 complement(388176..388805) [630 bp, 209 aa] {ON}
           Anc_5.707 YIL152W
          Length = 209

 Score =  368 bits (944), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 188/209 (89%), Positives = 188/209 (89%)

Query: 1   MSPRPVSLSRLQVLEGSRSGRTSGALRGKSINIASLVAXXXXXXXXXXXXXXXXXXXXXC 60
           MSPRPVSLSRLQVLEGSRSGRTSGALRGKSINIASLVA                     C
Sbjct: 1   MSPRPVSLSRLQVLEGSRSGRTSGALRGKSINIASLVAGSRHRHRHQSSGVSVSSVLLQC 60

Query: 61  KRRVAPKGYRPALHRTQTVPRQVVGKARPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQ 120
           KRRVAPKGYRPALHRTQTVPRQVVGKARPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQ
Sbjct: 61  KRRVAPKGYRPALHRTQTVPRQVVGKARPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQ 120

Query: 121 LVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHSNGPVHGFLLDQIASGGY 180
           LVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHSNGPVHGFLLDQIASGGY
Sbjct: 121 LVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHSNGPVHGFLLDQIASGGY 180

Query: 181 TVALYSKLAVRVTPDLYWCLQWKLVPAVH 209
           TVALYSKLAVRVTPDLYWCLQWKLVPAVH
Sbjct: 181 TVALYSKLAVRVTPDLYWCLQWKLVPAVH 209

>KAFR0D02200 Chr4 (441330..441878) [549 bp, 182 aa] {ON} Anc_5.707
           YIL152W
          Length = 182

 Score = 64.3 bits (155), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 62/119 (52%), Gaps = 7/119 (5%)

Query: 88  RPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHE 147
           RPHL+ + E         +L   LQ+SL  LN LV  + +++ YD L+ V    +LSS E
Sbjct: 69  RPHLNLLDEC----NKPVSLAISLQKSLWDLNALVTVSKNNKKYDLLIKVASARRLSSTE 124

Query: 148 -LMLETGHSSKRYVLHSNGPVHGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205
            L++ +   + RY+LH         +D     G  +AL SK++ R+   L WCL WKL+
Sbjct: 125 MLIIPSTDEAMRYILHKPLTFRTNSVDNFT--GAHLALNSKISFRLDDTLIWCLNWKLL 181

>NCAS0G00210 Chr7 (30686..31552) [867 bp, 288 aa] {ON} Anc_5.707
           YIL152W
          Length = 288

 Score = 52.4 bits (124), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 68/153 (44%), Gaps = 17/153 (11%)

Query: 66  PKGYRPALHRTQTVPRQVVGKARPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQLVLTT 125
           P+  RP L+    +P+++   +R     V     S       V  LQ+ L  L+ + + T
Sbjct: 141 PRSKRPYLN--YPLPKKL---SRTSTSDVSSRDNSNNEPKIFVTSLQKYLCDLDTM-MKT 194

Query: 126 GHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHS-----NGPVHGFLLDQIASGGY 180
                YD++  +    KLS  EL + T  S +  +LH+     N P+  F+ D   +   
Sbjct: 195 SKKFSYDSVWTINSITKLSDFELQVTTQMSPQLIILHNKTSINNIPILKFIHDVSINTKI 254

Query: 181 TV------ALYSKLAVRVTPDLYWCLQWKLVPA 207
            V      A+ SK  ++V+ D+ W + WK +P+
Sbjct: 255 QVTESLKLAINSKSFIKVSDDINWYIDWKFIPS 287

>ZYRO0B16434g Chr2 complement(1333310..1334023) [714 bp, 237 aa]
           {ON} weakly similar to uniprot|P40455 Saccharomyces
           cerevisiae YIL152W Hypothetical ORF
          Length = 237

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 97  ALGSQQGTPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSS 156
           A  + +    LV QL  +L   N +V T+  +++YD LV +   + LS  E+M+ +    
Sbjct: 133 ASSADKKKTNLVTQLICALNDFNLMVKTSQQNQNYDILVDIRHAIWLSPFEIMVISDDPR 192

Query: 157 -KRYVLHSNGPVHGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205
            KR +LHS+  +  F+     +    +A+ SK  + +  D+ W L+WK +
Sbjct: 193 VKRAILHSHKAIPKFV-----NSPSRLAICSKCCLTLYNDMNWYLKWKFL 237

>TPHA0E00180 Chr5 (19852..20349) [498 bp, 165 aa] {ON} Anc_5.707
           YIL152W
          Length = 165

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 14/106 (13%)

Query: 108 VQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHSNGPV 167
           V  L+ S+ + N L+     S  YD +  +    KLS +E ++ T   SK  +LHSN   
Sbjct: 59  VSDLRLSINKFNMLL--KASSNKYDEIHDINSIEKLSQNEFIVTTI-DSKTLILHSNEK- 114

Query: 168 HGFLLDQIASGGYT-----VALYSKLAVRVTPDLYWCLQWKLVPAV 208
                + + S  YT     VA+ SK  + +  DL W L WK    +
Sbjct: 115 -----NVVNSNNYTLKYQQVAINSKYYLSLYNDLNWYLDWKFYDKI 155

>NDAI0F00270 Chr6 (55368..56264) [897 bp, 298 aa] {ON} Anc_5.707
           YIL152W
          Length = 298

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 55/115 (47%), Gaps = 14/115 (12%)

Query: 101 QQGTPT-LVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRY 159
           +Q  P+ L+Q LQ+SL  L+  + T  +   YD L+ VT    LS HE+ +   +S K Y
Sbjct: 188 EQNKPSALLQSLQKSLCDLDTSLKTLSY-HSYDTLLTVTSFEMLSDHEIKI---NSVKNY 243

Query: 160 VLHSNGPVHGFLLDQIASG---------GYTVALYSKLAVRVTPDLYWCLQWKLV 205
                  V   L  +I+            Y +AL SK+ + + P++ W L WK +
Sbjct: 244 TAGFTTDVTMLLHSKISLNVPLPNNLHKDYKLALDSKVYLELAPNVKWYLVWKFI 298

>Suva_9.36 Chr9 (51248..51922) [675 bp, 224 aa] {ON} YIL152W (REAL)
          Length = 224

 Score = 40.4 bits (93), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/102 (25%), Positives = 56/102 (54%), Gaps = 6/102 (5%)

Query: 107 LVQQLQRSLGRLNQLVLTTGHSRHYDALV-GVTGCLKLSSHELMLETGHSSKRYVLHSNG 165
           LV QL  S+  L+ +V T  H   +D ++  ++    LS +EL+++  H+    +LHS  
Sbjct: 126 LVSQLHSSVKDLDTIVQT--HKPRFDTIIHDLSHTTILSPNELLIKL-HTEDTIILHSRT 182

Query: 166 PVHG--FLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205
           P+    +L +++++ G ++ + S+  + +  ++ W L WK +
Sbjct: 183 PIINAEWLRNKVSNAGASLVIDSRSFLILCSNIKWYLHWKFI 224

>TBLA0I01690 Chr9 complement(376667..377629) [963 bp, 320 aa] {ON}
           Anc_5.707 YIL152W
          Length = 320

 Score = 39.3 bits (90), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 12/106 (11%)

Query: 104 TPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHELMLETGHSSKRYVLHS 163
           TP LV  L   L  LN  + ++ + + +D +  ++   KLS  EL++ T  +S   +LHS
Sbjct: 223 TP-LVNGLHTILSNLNTRIHSSRNLK-FDKIFQISKLTKLSDTELLVITNTNSS-LLLHS 279

Query: 164 NGPVHGFLLDQIASGGYT----VALYSKLAVRVTPDLYWCLQWKLV 205
           +  +      Q     YT    VA  S   +++T DL W L+WK +
Sbjct: 280 DSTI-----GQSEFNNYTLKEKVATNSISILKITEDLNWYLKWKFI 320

>Smik_9.17 Chr9 (34116..34871) [756 bp, 251 aa] {ON} YIL152W (REAL)
          Length = 251

 Score = 37.0 bits (84), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 55/102 (53%), Gaps = 6/102 (5%)

Query: 107 LVQQLQRSLGRLNQLVLTTGHSRHYDALV-GVTGCLKLSSHELMLETGHSSKRYVLHSNG 165
           LV QL  S+  L+ ++ T  H   +D ++  ++    LSS+EL+++     +  +LHS  
Sbjct: 153 LVSQLHSSVKDLDAIIQT--HKPKFDTIIHDLSRTTILSSNELLIKLP-MEETIILHSRT 209

Query: 166 PV--HGFLLDQIASGGYTVALYSKLAVRVTPDLYWCLQWKLV 205
           P     +L +++++ G ++ + S+  + +  ++ W L WK +
Sbjct: 210 PTINEEWLHNKVSNPGASLVIDSRSFLILCNNIKWYLHWKFI 251

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 31.2 bits (69), Expect = 1.8,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 54/123 (43%), Gaps = 34/123 (27%)

Query: 88  RPHLDSVIEALGSQQGTPTLVQQLQRSLGRLNQLVLTTGHSRHYDALVGVTGCLKLSSHE 147
           RP LD  +E       +P+   +LQ+S+G+L++     G+SR +  +        +SS E
Sbjct: 550 RPDLDEEVEC------SPSRESELQQSMGKLSEETPVDGYSRIFTLVQ-----YDVSSKE 598

Query: 148 LMLET-----------------GHSSKRYVLHSNGPVHGFLLDQIASGGYTVALYSKLAV 190
           L  ++                 G SS+  +L  +G V  +L+      GY+ A   K + 
Sbjct: 599 LTRQSIPPPTNRAIIASIKFVPGESSRFLMLTEDGQVRRYLV------GYSGATDVKNSA 652

Query: 191 RVT 193
           R+T
Sbjct: 653 RIT 655

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 17,325,903
Number of extensions: 575024
Number of successful extensions: 1279
Number of sequences better than 10.0: 11
Number of HSP's gapped: 1283
Number of HSP's successfully gapped: 11
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 63 (28.9 bits)