Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021505.703ON61661629550.0
YIL150C (MCM10)5.703ON57159513091e-174
Suva_9.385.703ON56959812991e-173
Smik_9.195.703ON57259712941e-172
Skud_9.185.703ON57160212681e-168
NCAS0G002205.703ON59259512571e-166
KAFR0D022105.703ON58460012251e-161
TDEL0B021705.703ON56759711691e-153
ZYRO0G06578g5.703ON56960311591e-152
NDAI0F002805.703ON61060011461e-149
Kpol_1043.715.703ON58560211181e-145
TBLA0G010205.703ON59463110701e-138
CAGL0H06589g5.703ON58361410551e-136
TPHA0E002105.703ON5444979881e-126
KLTH0E01034g5.703ON5835989821e-125
SAKL0E14938g5.703ON5745989501e-120
Kwal_55.196915.703ON4664708721e-110
AFR287W5.703ON6114727964e-97
KLLA0A00572g5.703ON5775957516e-91
Kpol_1013.677.491ON698174751.8
SAKL0B03036g8.97ON47253724.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02150
         (616 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5....  1142   0.0  
YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}  MC...   508   e-174
Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON} Y...   504   e-173
Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON} Y...   503   e-172
Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON} Y...   493   e-168
NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}...   488   e-166
KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {O...   476   e-161
TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {O...   454   e-153
ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {...   451   e-152
NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}...   446   e-149
Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON} (1515...   435   e-145
TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.7...   416   e-138
CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} simila...   410   e-136
TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}...   385   e-126
KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp...   382   e-125
SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, ...   370   e-120
Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON...   340   e-110
AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic ho...   311   4e-97
KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp...   293   6e-91
Kpol_1013.67 s1013 (163823..165919) [2097 bp, 698 aa] {ON} (1638...    33   1.8  
SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {...    32   4.4  

>KNAG0L02150 Chr12 (386276..388126) [1851 bp, 616 aa] {ON} Anc_5.703
           YIL150C
          Length = 616

 Score = 1142 bits (2955), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 560/616 (90%), Positives = 560/616 (90%)

Query: 1   MELDPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQ 60
           MELDPRDVITADPYDNITSDEDEESKIQ                     AHVKPTDLNLQ
Sbjct: 1   MELDPRDVITADPYDNITSDEDEESKIQRELEEMERRKKDLEKRLKLKRAHVKPTDLNLQ 60

Query: 61  LDVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDG 120
           LDVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDG
Sbjct: 61  LDVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDG 120

Query: 121 KQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSD 180
           KQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSD
Sbjct: 121 KQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSD 180

Query: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240
           LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT
Sbjct: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240

Query: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ 300
           TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ
Sbjct: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ 300

Query: 301 TTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQ 360
           TTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQ
Sbjct: 301 TTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQ 360

Query: 361 MRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNS 420
           MRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNS
Sbjct: 361 MRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNS 420

Query: 421 RHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXX 480
           RHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQD         
Sbjct: 421 RHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDSKKSRQLDR 480

Query: 481 XXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540
                       ATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE
Sbjct: 481 KLKRLLSKDEDRATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540

Query: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTXX 600
           RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGT  
Sbjct: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGTPV 600

Query: 601 XXXXXXXXXXXXLEIV 616
                       LEIV
Sbjct: 601 DSQPVDNDDSDDLEIV 616

>YIL150C Chr9 complement(61013..62728) [1716 bp, 571 aa] {ON}
           MCM10Essential chromatin-associated protein involved in
           the initiation of DNA replication; required for the
           association of the MCM2-7 complex with replication
           origins
          Length = 571

 Score =  508 bits (1309), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 264/595 (44%), Positives = 370/595 (62%), Gaps = 40/595 (6%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+++  DPY+NITSDE++E  I                         KP D N +  +
Sbjct: 3   DPREILAVDPYNNITSDEEDEQAIARELEFMERKRQALVERLKRKQEFKKPQDPNFEA-I 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           +VP SP K  V               +   N +      +  N+NE R +QL       +
Sbjct: 62  EVPQSPTKNRVK--------------VGSHNATQQGTKFEGSNINEVRLSQLQQQPKPPA 107

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183
             +TT+YF+EKFQ +KK E  +I   E+M++ARVHTF   +K++     NELE FS+LW+
Sbjct: 108 --STTTYFMEKFQNAKKNEDKQIAKFESMMNARVHTFSTDEKKYVPIITNELESFSNLWV 165

Query: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243
            KRYIP+  L+ +L ++K+LRL KLFAK+RPPKFQEP+Y+NWA + +IS KS++KFT+S+
Sbjct: 166 KKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPEYANWATVGLISHKSDIKFTSSE 225

Query: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 226 KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 282

Query: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363
           IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKKCGSPINISLHKCCDYHREVQFRG 342

Query: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHG 423
            S+KR++LNGG+ALGAPTKV +QP L++ A G   ++  ++ +   KR   E        
Sbjct: 343 TSAKRIELNGGYALGAPTKVDSQPSLYK-AKG---ENGFNIIKGTRKRLSEE-------- 390

Query: 424 QGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXXXXX 483
                EE        FT+SN+AKAFFD++FQNPDML NLD KRRK+ +            
Sbjct: 391 -----EERLKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKIIETKKSTALSRELG 445

Query: 484 XXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSERGS 543
                       DK+  E   +KRTTE+AL TGLIQRLGFDPTHG+ + V+K   S  GS
Sbjct: 446 KIMRRRESSGLEDKSVGERQKMKRTTESALQTGLIQRLGFDPTHGKISQVLK--SSVSGS 503

Query: 544 GANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGT 598
               ++ L +K+ ++N+LL +K++K  L PS+ +   ++ HR EVW++ FG K T
Sbjct: 504 EPKNNL-LGKKKTVINDLLHYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSKET 557

>Suva_9.38 Chr9 complement(55663..57372) [1710 bp, 569 aa] {ON}
           YIL150C (REAL)
          Length = 569

 Score =  504 bits (1299), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 265/598 (44%), Positives = 374/598 (62%), Gaps = 48/598 (8%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+++  DPY+N+TSDE++E  I                         KP D N +  V
Sbjct: 3   DPREILAVDPYNNVTSDEEDEQAIAKELEFMERKKQALMERLKRKQDFKKPEDPNFEA-V 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           +VP SP K+S+         ++  +A+K+    +A       N+NE+  +Q      ++S
Sbjct: 62  EVPQSPAKKSIV--------KKSQDALKQAIRPVA------SNINESMLSQ----QSQES 103

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183
            + TT+YF++KFQ +K+ E  +I   E M++ARVHTF   +KE++    NELE FS+LW+
Sbjct: 104 PSNTTTYFMQKFQDAKRNEDKQIAKYEGMMNARVHTFGTDNKEYKPIITNELESFSNLWV 163

Query: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243
            KRYIP++ L+ +L ++K+LRLNKLFAK+RPPKFQEP Y+NWA + +IS KS++KFT+S+
Sbjct: 164 KKRYIPEEDLKRALHEIKILRLNKLFAKIRPPKFQEPDYANWATVGLISHKSDIKFTSSE 223

Query: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GD++A+LNPE+LPWRPSG   +   
Sbjct: 224 KPVKFFMFTITDFQHSLDVYIFGKKGVERYYNLRLGDVIAILNPEVLPWRPSG---RGNF 280

Query: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363
           IKSFNL+I+H FKCILEIG SRDLG+CP+  K +++ CGS IN      C+YHRE+Q R 
Sbjct: 281 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNKKTHKSCGSPINTNVHMCCDYHREVQFRG 340

Query: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWN-SRH 422
             +KR++LNGG+ALGAPTKV +QP L+R A G                   E  +N  R 
Sbjct: 341 TGAKRIELNGGYALGAPTKVDSQPSLYR-AKG-------------------ENQFNIVRS 380

Query: 423 GQGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXX 480
            + G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD+KRRK+ D         
Sbjct: 381 TRKGLSEEEERVKRNSHNFTNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDTKKSTALSR 440

Query: 481 XXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540
                          DK+  E   +K+TTE+AL TGLIQRLGFDPTHG+ + V+K   S 
Sbjct: 441 ELGKIMRRKDSSGLEDKSEGEKQKMKQTTESALQTGLIQRLGFDPTHGKISKVLK---SS 497

Query: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGT 598
              G +    ++ K+ ++N+LL++K++K  L PS+ +   ++ HR EVW+  FG K T
Sbjct: 498 VPGGESMPNRINGKKTVINDLLQYKKEKVILAPSKNEWFKKRSHREEVWQRHFGSKET 555

>Smik_9.19 Chr9 complement(38635..40353) [1719 bp, 572 aa] {ON}
           YIL150C (REAL)
          Length = 572

 Score =  503 bits (1294), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 265/597 (44%), Positives = 372/597 (62%), Gaps = 46/597 (7%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+++  DPY+++TSDE++E  I                      A  KP D N +  +
Sbjct: 3   DPREILAVDPYNSVTSDEEDEQAIAKELEFMERKRQALMERLKRKQAFKKPNDPNFEA-I 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           +VP SP K        +R +     A+K+      +   +  N NE+  +Q+     +  
Sbjct: 62  EVPQSPTK--------SRVKSGSQNAVKQ------VTRLETSNANESNLSQIQ-KQPELP 106

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELEQFSDLWI 183
           +N TT+YF++KFQ +KK E  +I   E+M+ ARVHTF   +K+++    NELE FS+LW+
Sbjct: 107 IN-TTTYFMQKFQNAKKDEDRQIAKFESMMDARVHTFGTDNKKYKPIIANELEGFSNLWV 165

Query: 184 SKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSK 243
            KRYIP+  L+ SL ++K+LRL KLFAKVRPPKFQ P+Y+NWA + +IS KS++KFT+S+
Sbjct: 166 KKRYIPEDDLKRSLHEIKILRLGKLFAKVRPPKFQAPEYANWATVGLISHKSDIKFTSSE 225

Query: 244 NPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQTTS 303
            P KF  FT+T+FQ  LD+++FG  GV+RYYNLR GDI+A+LNPE+LPWRPSG   +   
Sbjct: 226 KPVKFFMFTITDFQHTLDVYIFGKKGVERYYNLRLGDIIAILNPEVLPWRPSG---RGNF 282

Query: 304 IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQ 363
           IKSFNL+I+H FKCILEIG SRDLG+CP+    +++KCGS IN++  + C+YHRE+Q R 
Sbjct: 283 IKSFNLRISHDFKCILEIGSSRDLGWCPIVNTKTHKKCGSPINISLHKCCDYHREVQFRG 342

Query: 364 NSSKRLDLNGGFALGAPTKVGTQPDLFR-EASGRFKQSARSLPRDQGKRFYTEPSWNSRH 422
            S+KR++LNGG+ALGAPTKV +QP L++ +   RF     ++ RD  K            
Sbjct: 343 TSAKRIELNGGYALGAPTKVNSQPSLYKAKGENRF-----NIIRDARK------------ 385

Query: 423 GQGGSSEENYGLK--GKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXX 480
              G SEE   +K     FT+SN+AKAFFD++FQNPDML NLD KRRK+ D         
Sbjct: 386 ---GLSEEEERMKKSSHNFTNSNSAKAFFDEKFQNPDMLANLDNKRRKITDTKKSKALNR 442

Query: 481 XXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSE 540
                          DK+  E   +K+TTE AL TGLIQRLGFDPTHG  + V+K   S 
Sbjct: 443 ELAKIMRRKESSGLEDKSDGEKQKMKQTTENALQTGLIQRLGFDPTHGEISKVLK---SS 499

Query: 541 RGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKG 597
              G +++  L+ K+ ++N+LL +K++K  L PS+ +   ++ HR EVW+  FG KG
Sbjct: 500 VPGGESKNNLLNGKKTVINDLLHYKKEKVILAPSKNEWFKKRNHREEVWQRHFGPKG 556

>Skud_9.18 Chr9 complement(38082..39797) [1716 bp, 571 aa] {ON}
           YIL150C (REAL)
          Length = 571

 Score =  493 bits (1268), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 262/602 (43%), Positives = 363/602 (60%), Gaps = 54/602 (8%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+ + ADPY+N+TSDED+E  I                         +  D N +  +
Sbjct: 3   DPREFLVADPYNNVTSDEDDEQTIAKELEFMERKKQALVERLKRKQEFKRAEDPNFEA-I 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQK------VNLNEARFAQLDG 117
           +VP SP K                     RN+  + NT ++       N+N+ + +QL  
Sbjct: 62  EVPQSPAK--------------------NRNIMKSQNTMKRDMRPAASNINDLKLSQLQQ 101

Query: 118 DDGKQSVNA-TTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDKEFQLEAVNELE 176
              KQ + + TT YF++KFQ +K+ E+ +    E M++ARVHTF    KE++    NELE
Sbjct: 102 ---KQELPSNTTGYFMQKFQNAKRNEEKQRAKYENMMNARVHTFGTDKKEYRATIANELE 158

Query: 177 QFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSE 236
           +FS++W+ KRYIP+  L+ +L ++K+LRL KLFAK+RPPKFQEP Y+NWAV+ +IS KS+
Sbjct: 159 EFSNIWVKKRYIPEDDLKRALHEIKILRLGKLFAKIRPPKFQEPDYANWAVVGLISHKSD 218

Query: 237 VKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSG 296
           VKFT+S  P KF  FT+T+FQ  LD+++FG   V+RYYNLR GD++A+LNPE+LPWRPSG
Sbjct: 219 VKFTSSDKPAKFFMFTITDFQHTLDVYIFGKKAVERYYNLRLGDVIAILNPEVLPWRPSG 278

Query: 297 GSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYH 356
              Q   IKSFNL+I+H FKCILEIG SRDLG+CP+  +  NE CGS IN+A  + C+YH
Sbjct: 279 ---QGNFIKSFNLRISHDFKCILEIGSSRDLGWCPIVNRKKNENCGSPINIALHKCCDYH 335

Query: 357 RELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEP 416
           RE+Q R  S+KR++LNGG+ALGAPTKV  QP L+R A G   ++  +L R   K    E 
Sbjct: 336 REVQFRGTSAKRIELNGGYALGAPTKVDAQPTLYR-AKG---ENNFNLVRSIRKTLSEE- 390

Query: 417 SWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXX 476
                       EE        F +SN+AKAFFD++FQNPDML NLD+KRRK+ D     
Sbjct: 391 ------------EERMKKNSHNFRNSNSAKAFFDEKFQNPDMLANLDSKRRKIIDSKKST 438

Query: 477 XXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKK 536
                              DK   E   +K+TTE+AL TGL+QRLGFDPTHG+ + V+K 
Sbjct: 439 ALSRELGKIMRRKGSSGLEDKCDEEKQKIKQTTESALQTGLLQRLGFDPTHGKISKVLK- 497

Query: 537 RDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK 596
             S    G   +  +  K+ ++++LL +K++K  L PS+ +   ++ HR EVW++ FG K
Sbjct: 498 --SSVPGGEPRNKVMGGKKTVIDDLLNYKKEKVILAPSKNEWFKKRSHREEVWQKHFGSK 555

Query: 597 GT 598
            T
Sbjct: 556 DT 557

>NCAS0G00220 Chr7 complement(31595..33373) [1779 bp, 592 aa] {ON}
           Anc_5.703 YIL150C
          Length = 592

 Score =  488 bits (1257), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 256/595 (43%), Positives = 373/595 (62%), Gaps = 35/595 (5%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+V+T DPYDN++SDE +E  I                         K  D N Q  +
Sbjct: 3   DPREVLTTDPYDNVSSDEQDEEAILRDLENVERKRQDLLNRIKEKQESKKLLDPNFQ-QL 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           QVP SP K++ + + VA K+      I   N             NE R  +  G    Q 
Sbjct: 62  QVPCSPVKKTETNVPVAMKKSTNEMEIPHENP------------NELRIREKSG----QL 105

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQ--GVDKEFQLEAVNELEQFSDL 181
            + TT+YF+EKFQ+SKK E+ +I+  E M++ARVHTFQ  G  +EF+   VNE+E++S++
Sbjct: 106 PSNTTTYFMEKFQKSKKEEEGKIQKMENMMNARVHTFQDQGGKQEFKPIQVNEIEEYSNI 165

Query: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241
           W+ KRYIP+  L + L ++K+LRL+KLFAKVRPPKF EPQYSNWA L IIS K + KFTT
Sbjct: 166 WLKKRYIPQSELRKMLHNIKILRLSKLFAKVRPPKFSEPQYSNWAALGIISAKGDAKFTT 225

Query: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301
           +  P+K+++FT+T+FQ +LD+++FG  GV+RYYNLR GD++A+LNPE+ PWRPSG  Q  
Sbjct: 226 TDKPKKYLKFTMTDFQHKLDVYIFGKGGVERYYNLRVGDVIAILNPEVFPWRPSGKGQ-- 283

Query: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361
             IKSFNL+I H FKCILEIG S+DLG+C VT + +   C + IN++++  C+YH+E++ 
Sbjct: 284 -FIKSFNLRINHDFKCILEIGSSKDLGFCKVTSR-NGTLCNTPINMSKEDRCDYHQEIRF 341

Query: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421
           R N+SKR++LNG FALGAPTKV   P L+R+ +G  + S     R   + F    S+   
Sbjct: 342 RDNNSKRIELNGSFALGAPTKVENNPTLYRKKNGETRHS-----RKNRQNFSVSASF--- 393

Query: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXXX 481
              G  +++ + L+ + F+++N+AKAFFD++FQNPDML+NL++KRRK+QD          
Sbjct: 394 ---GSINKDQFDLRNRHFSNNNSAKAFFDEKFQNPDMLNNLNSKRRKIQDDKKWTRIDKE 450

Query: 482 XXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541
                         +++  E+  +KR TET L +G+IQRLGFDPTHG+ A+V++   S+ 
Sbjct: 451 LSKAIGNRASDDLGERSAMEVKQMKRATETTLQSGVIQRLGFDPTHGKIANVLRTTHSKE 510

Query: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK 596
                 +  +S K++ VN+LL +++    L P+  +L  R+  R  +W+E FG+K
Sbjct: 511 EKDTLSE-QMSGKKDKVNDLLHFRKSHVILAPTRNELIERRDRRERIWQENFGQK 564

>KAFR0D02210 Chr4 complement(441977..443731) [1755 bp, 584 aa] {ON}
           Anc_5.703 YIL150C
          Length = 584

 Score =  476 bits (1225), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 257/600 (42%), Positives = 370/600 (61%), Gaps = 42/600 (7%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR++   D Y NIT D+++  +I+                       ++  D N    V
Sbjct: 3   DPREIAPNDLYQNITPDKEDARRIELELEKIENVKRDLLERLHRKKIEIERRDPNF-TGV 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLA-LNTAQKVNLNEARFAQLDGDDGKQ 122
           QVP+SP K+             E + +++++  L  +N  ++ N N      L     KQ
Sbjct: 62  QVPASPVKK------------HELQLVEQKDQKLKNINRFEESNENPNELC-LQQRFQKQ 108

Query: 123 SV-----NATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNEL 175
           +      NA+T YF+EKF+ +K+ EK+ IE  E+M+ +RVHTF G++   E+Q   V+EL
Sbjct: 109 TARLNDSNASTEYFMEKFRDAKRKEKVHIEKHESMMKSRVHTFNGIEPKNEYQHVIVDEL 168

Query: 176 EQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKS 235
           EQ+S+LWI+KRY P   L+  L +VK+LRLNKLFAKVRPPKF+EPQYSNW V+ I+S KS
Sbjct: 169 EQYSNLWINKRYTPVSNLKSMLHEVKILRLNKLFAKVRPPKFEEPQYSNWVVVGIVSDKS 228

Query: 236 EVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPS 295
           ++KFT S  PQK+++FTLT+F+ ++D ++FG  GV+RYYNLR GDI+AVLNPEILPWRPS
Sbjct: 229 DIKFTASNKPQKYLKFTLTDFKHKVDTYIFGKEGVERYYNLRIGDIIAVLNPEILPWRPS 288

Query: 296 GGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEY 355
           G   +   IKSFNL+I+H +KCILEIGKSRDL  CP+  + ++++CG  IN   DR CEY
Sbjct: 289 G---KQNYIKSFNLRISHPYKCILEIGKSRDLARCPIVVRSTSKECGVPINKKVDRCCEY 345

Query: 356 HRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTE 415
           HRE+++R+  SKRLDL+G +ALGAPTK+ +QP L+R   G   Q+ +       + F   
Sbjct: 346 HREMEIRKGPSKRLDLSGQYALGAPTKLESQPALYR---GHTAQNVKI------QNFKLT 396

Query: 416 PSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXX 475
           PS++  +       + YG K KFF++ NAAKAFFDDEFQNPDM+ NLD KRRK+ +    
Sbjct: 397 PSYSQNNPHLI---DKYGEKSKFFSNRNAAKAFFDDEFQNPDMISNLDNKRRKIMEQRKS 453

Query: 476 XXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMK 535
                                K   E+  +K+TT+  L +GL Q++GFDPT G+ + ++K
Sbjct: 454 NVLNRELDRLLRKDQDLEG--KTREEVEKMKQTTQRTLQSGLFQKVGFDPTGGKISRILK 511

Query: 536 KRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGK 595
            ++    S   E   LSQK+  V++L+ +K++   L PS+  L ++K  R +VW+E FG+
Sbjct: 512 NKER---SKDGEPKFLSQKDRTVDDLMAFKKEYIILAPSKVDLLNKKNKREKVWQENFGQ 568

>TDEL0B02170 Chr2 complement(385955..387658) [1704 bp, 567 aa] {ON}
           Anc_5.703 YIL150C
          Length = 567

 Score =  454 bits (1169), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 248/597 (41%), Positives = 356/597 (59%), Gaps = 47/597 (7%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+V+  DP+  +TSDE+++ +++                       +K  D N    +
Sbjct: 3   DPREVVQTDPFGELTSDEEDQRELEDQIVEIERQKRDLVERLKSKR-QLKSKDPNFDA-I 60

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           QV SSP K+   +I V   R        KR L +        NLNE +      +   Q 
Sbjct: 61  QVESSPVKKPAESIKVEPSR-------TKRVLDIE-------NLNEKKV-----ESRSQI 101

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSDL 181
              TTSYF++ F+ SKK E+   + ++ +LS RVHTF+G+D   +F+  AV E+E++SDL
Sbjct: 102 PANTTSYFIDNFRNSKKEEQKSQQERQELLSKRVHTFRGIDGNHKFKAVAVEEVEEYSDL 161

Query: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241
           W+ +RYI +  L + L +VK+LRL+KLFAK++PPKF EPQYSNWA + IIS K +VKF++
Sbjct: 162 WVKQRYISQDDLRKVLHEVKILRLSKLFAKIKPPKFAEPQYSNWAPIGIISAKGQVKFSS 221

Query: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301
           S  P K+ +FTLT+FQ  LD++VFG  GV+RYYNLR GDIVA+LNPE+LPWRP   S++ 
Sbjct: 222 SGKPMKYFKFTLTDFQYNLDVYVFGKKGVERYYNLRVGDIVAILNPEVLPWRP---SEKG 278

Query: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361
             IKSFNL+I+H F CILEIG+SRD+ +C    K  N+ CG+ IN  +++ C++HRE+Q 
Sbjct: 279 NFIKSFNLRISHDFPCILEIGQSRDIDWCKSFNKSQNKACGTPINKTKEKCCDFHREIQF 338

Query: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421
           R N +KR++LNG FALGAPTKV + P L+RE S    ++ + LP    K           
Sbjct: 339 RSNHAKRIELNGSFALGAPTKVDSGPALYREKSAGAHRNFKVLPNHYQK----------- 387

Query: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXXX 481
                S  +N  L+G  F++ NAAKAFF+DEFQNPD+L+NLD+KRRK QD          
Sbjct: 388 -----SVGKNSDLRGIHFSNGNAAKAFFNDEFQNPDILNNLDSKRRKRQD-DKKSLILQQ 441

Query: 482 XXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541
                        ++K + +   +  TTE  L +GLIQ LGFDPTHG   +V+K+   ++
Sbjct: 442 QLKRINSRHAAIEIEKGSKKYEEICETTEATLQSGLIQNLGFDPTHGEIGNVLKQAAKDK 501

Query: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKKGT 598
            +       L++K+  V+ LL++K++   L P++  L  RK+ R   W+E FG K  
Sbjct: 502 SNNGQ----LNKKQKEVSSLLKFKKEHVELKPAKEVLLQRKRDRERAWQENFGDKSV 554

>ZYRO0G06578g Chr7 complement(519877..521586) [1710 bp, 569 aa] {ON}
           similar to uniprot|P32354 Saccharomyces cerevisiae
           YIL150C MCM10 Essential chromatin-associated protein
           involved in the initiation of DNA replication required
           for the association of the MCM2-7 complex with
           replication origins
          Length = 569

 Score =  451 bits (1159), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 253/603 (41%), Positives = 366/603 (60%), Gaps = 59/603 (9%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+V+  D YD +TS+ +EE++I+                      + KP D NL   +
Sbjct: 3   DPREVLNNDLYDVLTSEGEEENEIEAQIAEIERQKKDLLQRLNVKKTNPKPLDPNLS-HI 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           QV SSP+K + S +    +++E    ++  NL+                 +L     +Q 
Sbjct: 62  QVESSPKKVTNSVLPPTVQQQEPRGEVRNENLN-----------------ELKAQSQEQI 104

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK--EFQLEAVNELEQFSDL 181
              TTS+F+EK+  SK+ +  E+ AQE +LS RVHTFQG  +  E++    NELE+FS+L
Sbjct: 105 PANTTSFFIEKYSTSKRKQDYEVRAQEDLLSNRVHTFQGARRQDEYKPIPTNELEEFSNL 164

Query: 182 WISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT 241
           WISKRYIPK+       ++K+LRL+KLFAKV+PPKF EP YSNWAV+ +IS K EVKFT+
Sbjct: 165 WISKRYIPKEEQRSIFANIKILRLSKLFAKVKPPKFNEPPYSNWAVIGLISNKGEVKFTS 224

Query: 242 SKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQT 301
           + +P+K+ +FTLTNFQ  +D ++FG  GV+RYYNLR GDI+A+LNP++LPWRPSG     
Sbjct: 225 AASPKKYFKFTLTNFQYSIDTYIFGKEGVERYYNLRVGDIIAILNPQVLPWRPSGTKAH- 283

Query: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361
             IKSFNL+I+HKF+CILEIG SRDLG+CP+  K  NE C + IN  ++  CEYHREL+ 
Sbjct: 284 --IKSFNLRISHKFECILEIGASRDLGWCPMFNKSKNEICRAPINKDKEDCCEYHRELKF 341

Query: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWN-- 419
           R  ++KR++L+G +ALGAPT++  QP L+R  S     S ++L            ++N  
Sbjct: 342 RSTNAKRVELSGTYALGAPTRIDAQPALYRGGS-----SQKNL------------NYNII 384

Query: 420 SRHGQGGSSEE--NYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXX 477
           +    GGS++E     +  + F++ NAAKAFFD+ FQNP+ L NL+ KRRKL+D      
Sbjct: 385 TNGADGGSNKEINPLDINARHFSNRNAAKAFFDERFQNPETLRNLENKRRKLRD------ 438

Query: 478 XXXXXXXXXXXXXXXATLD---KNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVM 534
                          + LD   K+  E+  +KRTTE+ + +G+++ LGFDPT G+ ASV 
Sbjct: 439 -NRKSNILNRELKKNSELDIKHKSAEEIDEIKRTTESTMGSGMMKNLGFDPTQGKIASVF 497

Query: 535 KKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFG 594
           K + S+     ++   L++K++ V  LL +K+D   L PS+  L  +K+ R  VW+E FG
Sbjct: 498 KHQRSD-----SDKKPLTEKDSSVASLLSFKKDNVKLKPSKEILIKQKRRRERVWKEHFG 552

Query: 595 KKG 597
             G
Sbjct: 553 SGG 555

>NDAI0F00280 Chr6 complement(58035..59867) [1833 bp, 610 aa] {ON}
           Anc_5.703 YIL150C
          Length = 610

 Score =  446 bits (1146), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 241/600 (40%), Positives = 355/600 (59%), Gaps = 25/600 (4%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+    DP+ +++  E+ E  +                         K  D N   +V
Sbjct: 3   DPRECSPEDPFADLSDKEENEDAVLEELEDLDRRKSDLLGRLKELKERQKRRDPNFD-EV 61

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           Q+P +P++++ +     +   +  +  ++       +  +  N NE +  + + +  K  
Sbjct: 62  QIPGTPEEKNTNIFTSEQTILQNRDRKEEEVEEEEFSGERLPNPNELKVREREENLEKLP 121

Query: 124 VNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK-------EFQLEAVNELE 176
            N TTSYF+EKFQ  KK E++E    E ML ARVH FQG++K       E+Q EA NE+E
Sbjct: 122 SN-TTSYFMEKFQHVKKKEEIENVRNEKMLKARVHMFQGLNKSSKIHKIEYQPEAANEVE 180

Query: 177 QFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSE 236
           ++S L I KRYIPK+ L +  +++K+LRLNKLFAKVRPPKF+EPQYSNW  L II++K  
Sbjct: 181 EYSMLRIQKRYIPKKELNDIFQNIKILRLNKLFAKVRPPKFEEPQYSNWVTLGIITQKGS 240

Query: 237 VKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSG 296
           +KFT+S  P+K+ +FT+++F+  +D+F+F    V+RYYNLR GDI+A+LNPE+LPWRPS 
Sbjct: 241 IKFTSSDKPKKYFKFTISDFKYNVDIFIFDKHAVERYYNLRIGDIIAILNPEVLPWRPS- 299

Query: 297 GSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNE-KCGSAINLARDRTCEY 355
            ++  T IKSFNL+I H + CI+E+GKS+DLG+CP+  K +    C + I+++++  C Y
Sbjct: 300 NNKNGTGIKSFNLRINHNYHCIIEVGKSKDLGFCPIPNKINESGTCHTPIDISKEDRCSY 359

Query: 356 HRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTE 415
           H+E++ R N SKR++LNG FALGAP KVG QP L+R  +   +          G RF   
Sbjct: 360 HQEIRFRNNGSKRIELNGSFALGAPVKVGAQPQLYRNNNVPVRGVY------HGNRFNVV 413

Query: 416 PSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKL-QDXXX 474
                R  +    EE    + ++F+S+N+AKAFFD++FQNPDML NLD KRRK+  D   
Sbjct: 414 KGSEIRKNESKLMEER---RRRYFSSNNSAKAFFDEKFQNPDMLTNLDTKRRKIADDKRS 470

Query: 475 XXXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVM 534
                              + +K   E A +K  TET L TG+IQRLGFDPTHG+ A V+
Sbjct: 471 NYLDQELSKAIENKSSNRLSGNKTKKEYAKMKSATETTLQTGVIQRLGFDPTHGKIAKVL 530

Query: 535 KKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFG 594
           +   + + SG  ++V  + K   V +LL +K+ K  L P++ +L  RK  R EVW++ FG
Sbjct: 531 Q---TGKDSGK-DNVHNTHKVEKVKDLLEFKKGKVVLAPAKEELIKRKNRREEVWQKHFG 586

>Kpol_1043.71 s1043 (151546..153303) [1758 bp, 585 aa] {ON}
           (151546..153303) [1758 nt, 586 aa]
          Length = 585

 Score =  435 bits (1118), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 243/602 (40%), Positives = 343/602 (56%), Gaps = 57/602 (9%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+    D Y N++SDE E+ +I                            D N    V
Sbjct: 3   DPREHAKEDLYSNLSSDEGEQDEISEQLKAIERQKQDLLERLKKKKERKSKLDPNF---V 59

Query: 64  QVPSSPQK-RSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQ 122
           QVPSSP+K R V     ++      E  ++    +AL T    N                
Sbjct: 60  QVPSSPKKSRVVELKPTSKPIDNNEEEEEENPNEVALMTKDDSNY--------------- 104

Query: 123 SVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGV--DKEFQLEAVNELEQFSD 180
               TTSYF+EKF  SKK  + ++ A  +M+S+RVHTF G    KEF+   V+EL+Q+S+
Sbjct: 105 ---GTTSYFMEKFYNSKKDHERKVVAYSSMMSSRVHTFSGTGSKKEFKPTDVDELDQYSN 161

Query: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240
           LW+  RYIP   L   L D+K+LRL KLFAKVRPPKF EPQYSNW V  II+ K ++K+T
Sbjct: 162 LWLRSRYIPVDELNLMLLDIKILRLPKLFAKVRPPKFTEPQYSNWVVTGIITSKDDIKYT 221

Query: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRP---SGG 297
           +S  P K+ +FT+++FQ  LD+F+FG  GV++YYNLR GD+VA+LNPEILPWRP   SGG
Sbjct: 222 SSSKPTKYFKFTISDFQHNLDVFIFGVKGVEKYYNLRVGDVVAILNPEILPWRPSENSGG 281

Query: 298 SQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHR 357
           S  T  IKSFNL+I+HKF CILEIG SRDLG+CP+     N  C + IN +++  C+YHR
Sbjct: 282 SGST--IKSFNLRISHKFDCILEIGASRDLGWCPIPNASKNTLCKTPINKSKEDKCQYHR 339

Query: 358 ELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPS 417
           E+Q R+ +S R++L+G +ALGAPTKV  +P L++              R        + S
Sbjct: 340 EIQFRKTTSNRVELSGTYALGAPTKVDARPALYQN-------------RGTSNNSRVQKS 386

Query: 418 WN---SRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXX 474
           +N     H Q          +   F++ N+AKAFFD++FQNPD+L+NLD+KRRK++D   
Sbjct: 387 YNMVSDSHYQKRKDSNKLETRMHHFSTMNSAKAFFDEDFQNPDILNNLDSKRRKIKDSKM 446

Query: 475 XXXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVM 534
                              T+DK +     LK  T+  L TG++QRLGFDPT G+ +SV+
Sbjct: 447 ERNLVKALKN---------TVDKESKNFKNLKNATQATLQTGILQRLGFDPTGGKLSSVI 497

Query: 535 KKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFG 594
           +  +SE  +       + +KE  +++L+ +++D  NL PS+  L  R+  R+  W++ FG
Sbjct: 498 RNSNSE--TEVTNKYQMEKKE-ALDDLMTFRKDTVNLKPSKDDLIKRRIDRQRNWKKLFG 554

Query: 595 KK 596
           K+
Sbjct: 555 KQ 556

>TBLA0G01020 Chr7 (256107..257891) [1785 bp, 594 aa] {ON} Anc_5.703
           YIL150C
          Length = 594

 Score =  416 bits (1070), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 233/631 (36%), Positives = 345/631 (54%), Gaps = 57/631 (9%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNL---- 59
           DPR+V   D +DNI+ DEDEE ++Q                        +  D N     
Sbjct: 3   DPREVFENDLFDNISPDEDEELELQKQIELIERQKRDLQERLEYKRKVSRAVDPNFISTE 62

Query: 60  -------QLDVQVPSSPQKRSVSAIDVARKRRE-EAEAIKKRNLSLALNTAQKVNLNEAR 111
                  +  +QVP SP+K       + RK  +  A  + K+N  +  N  +    N+  
Sbjct: 63  GNVDATSESRIQVPGSPEK-------IKRKHTQLAATPVTKKNTGIQDNPNELKLKNQIE 115

Query: 112 FAQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTF---QGVDKEFQ 168
            A +           +T+YF+  F  SKK E  +I+  ET++SARVH+F     + KE Q
Sbjct: 116 PASVPA--------GSTAYFMNNFASSKKVEAQKIQDYETLMSARVHSFGNYTNLQKESQ 167

Query: 169 LEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVL 228
           +  V E E++S LWIS+RY+ ++ +++ L+D+K+LRLNKLFAK+RPPKF+ PQYSNW  +
Sbjct: 168 IINVEEKEKYSGLWISRRYLKEETIDQLLQDIKILRLNKLFAKIRPPKFESPQYSNWVAV 227

Query: 229 AIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPE 288
            +I++KS  K T+S  P+K+ +FT+ +FQQ + +FVF    + +YYNLR GDI+ +LNP 
Sbjct: 228 GVITEKSGFKLTSSNTPRKYFKFTIGDFQQNISIFVFNREAIAKYYNLRVGDIICILNPV 287

Query: 289 ILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEK-CGSAINL 347
           I PWRP   S++   IKSFNL I  K+ CI+EIGKSRDLG+C V  K    K CG+ IN 
Sbjct: 288 IAPWRP---SEENGYIKSFNLSIQTKYDCIIEIGKSRDLGWCNVPVKSKGGKPCGTPINK 344

Query: 348 ARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRD 407
            +D+ CE+HRE + R  ++KR++LNG FALGAPTK  T P L+++ +             
Sbjct: 345 TKDKCCEFHRETEFRNAAAKRIELNGSFALGAPTKADTNPSLYKKKTN------------ 392

Query: 408 QGKRFYTEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRR 467
                Y++  +N    +    E +  L    F S+N AKAFF+DEFQNPD++ NLD+KRR
Sbjct: 393 ---NIYSKNQFNVVRRRNARKEGDSKLHNSNFRSTNIAKAFFNDEFQNPDIISNLDSKRR 449

Query: 468 KLQDXXXXXXXXXXXXXXXXXXXXXA-TLD-KNTAEMAALKRTTETALHTGLIQRLGFDP 525
           KL+D                     +  L+ K+  ++  ++  TE  +  G+++ +G+DP
Sbjct: 450 KLKDAKRDSELIKELNKTLTKEDNVSKNLEGKSKEDVKEMRNITENIMQIGMLKNIGYDP 509

Query: 526 THGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHR 585
           THG+   +MKK      S   +    S + N VN+LL +K+DK NL P ++ L  +K+ R
Sbjct: 510 THGKMKYLMKK------SNGKDPSYTSNRSNAVNDLLHFKKDKVNLKPLKSDLLMKKRKR 563

Query: 586 REVWRETFGKKGTXXXXXXXXXXXXXXLEIV 616
            E+W E FG +                LEIV
Sbjct: 564 DEIWNEYFGDQSKSNRDIILSSGDDSDLEIV 594

>CAGL0H06589g Chr8 (649740..651491) [1752 bp, 583 aa] {ON} similar
           to uniprot|P32354 Saccharomyces cerevisiae YIL150c DNA43
          Length = 583

 Score =  410 bits (1055), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 253/614 (41%), Positives = 345/614 (56%), Gaps = 75/614 (12%)

Query: 4   DPRDVITADPYDNITSDEDE-ESKIQXXXXXXXXXXXX-----XXXXXXXXXAHVKPT-- 55
           DPR+V   DPY +++ D+ E ES IQ                            + P   
Sbjct: 8   DPREVKLLDPYTDLSEDDKEQESDIQRELEMIERKKQDLISRLKENKRKLLSKQLDPNMK 67

Query: 56  DLNLQLDVQVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTA---QKVNLNEARF 112
           ++N +  V+VP SP++ S+ A           E ++     +  N A   +K N NE   
Sbjct: 68  NINSRGRVEVPRSPKRESLPA----------QENLQHNVPQVTHNQAANNKKANPNEEDI 117

Query: 113 AQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGV-----DKEF 167
            + + D     V ATTSYF  KF+ SK  E   + A + M+SAR HTF G      +K  
Sbjct: 118 VRKELD-----VVATTSYFQNKFKNSKTDENRMVTAYQQMMSARTHTFNGSTSLSDNKTI 172

Query: 168 QLEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAV 227
           Q +   ELE +S+  I KRYIPK  +++ L  +K+LRLNKLFAKVRPP F EPQYSNW  
Sbjct: 173 QCD---ELEPYSNFHIKKRYIPKDEVDKLLHGIKILRLNKLFAKVRPPSFSEPQYSNWVA 229

Query: 228 LAIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNP 287
           +  IS K +VK T +  P K+ +FTLT+F+  LD++VFG   V+RYYNLR GDI+AVLNP
Sbjct: 230 IGAISSKEDVKLTNAAKPVKYFKFTLTDFRHNLDVYVFGKKPVERYYNLRVGDIIAVLNP 289

Query: 288 EILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINL 347
           EILPWRPSG       IKSFNL+I H F CILEIG SRDLG+C +     ++ C S IN 
Sbjct: 290 EILPWRPSGC---VNGIKSFNLRIGHDFNCILEIGASRDLGWCQMVNHGQSKICNSPINT 346

Query: 348 ARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRD 407
             DR CE+HRELQMR  +SKR++L+G +ALGAPTKVGTQP ++               +D
Sbjct: 347 KTDRCCEFHRELQMRSTASKRIELSGSYALGAPTKVGTQPSIY---------------KD 391

Query: 408 QGKRFYTEPSWN---SRHGQGG---SSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHN 461
             K   T P+ +   S  G G      +E + ++   F++  AAKAFFDD FQ+P +L N
Sbjct: 392 NNKSRNTNPAKHKMFSITGHGSKKEQEKEKHEIEAHHFSNKRAAKAFFDDSFQDPSLLAN 451

Query: 462 LDAKRRKLQDXXXXXXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRL 521
           L++KRRK++                      A+  KN  +   +K  TE  L TG+IQRL
Sbjct: 452 LESKRRKIK------ASKMDRNLLKALNGEDASQSKNKQQ---VKEITEKTLQTGVIQRL 502

Query: 522 GFDPTHGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPS-ETQLAH 580
           GFDP+ G+ A V+   D  RG+   +D  +S+K  ++N+L+ +K+DK  L PS E QL  
Sbjct: 503 GFDPSGGQIAKVL---DKSRGTKT-DDPTISKKMGLINDLIHFKKDKIKLKPSREIQL-- 556

Query: 581 RKQHRRE-VWRETF 593
            K+HRRE +W++ F
Sbjct: 557 EKRHRREAIWKKHF 570

>TPHA0E00210 Chr5 complement(26313..27947) [1635 bp, 544 aa] {ON}
           Anc_5.703 YIL150C
          Length = 544

 Score =  385 bits (988), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 200/497 (40%), Positives = 299/497 (60%), Gaps = 40/497 (8%)

Query: 102 AQKVNLNEARF---AQLDGDDGKQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVH 158
            + VN NEA+    A L  +        TTSYF++ F ++KK E  +++  +  +S+RVH
Sbjct: 47  VEDVNPNEAKVVSNANLPAN--------TTSYFMQNFLKAKKEETKQVKEYQQKMSSRVH 98

Query: 159 TFQGVD--KEFQLEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPK 216
           +F G +  K++Q   V ELE++S   ISKRY+PK+ + + L ++K+LRLNKLFAK+RPPK
Sbjct: 99  SFAGANLSKKYQSIIVEELEEYSRFNISKRYLPKEEVSKCLHNIKILRLNKLFAKIRPPK 158

Query: 217 FQEPQYSNWAVLAIISKKSEVKFTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNL 276
           F EP Y+NWAV  II  K ++K T+SK P KF +FT+TNFQ  LD+F+FG AGV++YYNL
Sbjct: 159 FSEPDYANWAVTGIICSKEDIKLTSSKTPVKFFKFTITNFQHTLDIFIFGAAGVEKYYNL 218

Query: 277 REGDIVAVLNPEILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKF 336
           R GDI+ +LNPE+LPWRP     +  SIKSFNL+I+HKF CILEI +S+D+ +C    + 
Sbjct: 219 RVGDIIFILNPEVLPWRPEF---KGNSIKSFNLRISHKFDCILEIARSKDIAWCQQINRK 275

Query: 337 SNEKCGSAINLARDRTCEYHRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGR 396
           +  KC + IN ++   C+YH+E+Q R  ++KR++L+G +ALGAPT++ ++P L+R  +  
Sbjct: 276 TGAKCNTPINKSKQDVCDYHKEMQFRSANAKRVELSGTYALGAPTQIDSRPALYRSKNTS 335

Query: 397 FKQSARSLPRDQGKRFY----TEPSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDE 452
             +   +      +R+      +P  + RH                F+SSN+AKAFFD++
Sbjct: 336 NLKPGNNFNIVADRRYMKKKENDPINSKRHH---------------FSSSNSAKAFFDED 380

Query: 453 FQNPDMLHNLDAKRRKLQDXXXXXXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETA 512
           FQNPDML NL+ KRRK++D                        DK+  E+ +++ TT+  
Sbjct: 381 FQNPDMLVNLENKRRKIKDDKRDVMLQRALRESVGNSKLLLK-DKSNQEIQSMRNTTDAT 439

Query: 513 LHTGLIQRLGFDPTHGRAASVMKKRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLL 572
           L  G IQ+LGFDPT G+   V++K        + +     QK N +  L+ +K+   NL 
Sbjct: 440 LQNGFIQKLGFDPTGGQIKVVLEK----SADKSTQSKLQKQKSNAMENLVTFKKSSVNLK 495

Query: 573 PSETQLAHRKQHRREVW 589
           PS   L  +  HR + +
Sbjct: 496 PSREVLLEKLHHREQSF 512

>KLTH0E01034g Chr5 complement(97462..99128,99197..99281) [1752 bp,
           583 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 583

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/598 (36%), Positives = 335/598 (56%), Gaps = 50/598 (8%)

Query: 2   ELDPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQL 61
           E DPR+V+  D +D +TSDEDE++KI+                     +  K    +L+ 
Sbjct: 4   ETDPREVLQLDVHDIVTSDEDEDTKIKQQLDELERQQRDLRDRLEQKASRKKAQRQSLER 63

Query: 62  DVQVPSSPQKRSVSAIDVARKRREEAEAIKK-RNLSLALNTAQKVNLNEARFAQLDGDDG 120
            V+VP+SP++         RK +   ++ K  + ++LA N+    N +       +G   
Sbjct: 64  -VEVPASPKEE--------RKSKASPQSQKSSKGITLAANS----NNDSIEVPWKNGPSN 110

Query: 121 KQSVNATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQF 178
                 TTSYF+E F  ++K E+ +I+ + ++LS RVHTF+G+D  K  Q   V+E E +
Sbjct: 111 ------TTSYFVENFVNARKVEEQKIQHRSSLLSCRVHTFKGIDSLKGSQPVNVDEKELY 164

Query: 179 SDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVK 238
           S   IS+RY+    L+E +R++K+LRL KLF+KVRPPKF EP Y+NW  + IIS KSEVK
Sbjct: 165 SGFNISRRYMSTSELDEIMREIKVLRLPKLFSKVRPPKFTEPDYANWVAIGIISFKSEVK 224

Query: 239 FTTSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGS 298
            T+S  P K+ + TLT+F   LD+++F +  V++YYNLR GDI+A+LNP+ILPWRPS  +
Sbjct: 225 LTSSSKPSKYFKMTLTDFTHNLDIYIFNNKNVEKYYNLRVGDIIAILNPDILPWRPSQVN 284

Query: 299 QQTTS---IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEY 355
               S   +KSFNL I H F C+LEIG S+DLG+C +  K + + CG+ IN A    CEY
Sbjct: 285 NDEFSGPVVKSFNLSIRHNFDCVLEIGTSKDLGFCRIPNKATRKACGAPINRAATDRCEY 344

Query: 356 HRELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTE 415
           H++++ R  +++R++LNG  +L +P K G +  L+  +  +             ++    
Sbjct: 345 HQDVRFRHVNAQRVELNGSTSLRSPVKNGKKQALYGTSGVK-------------RKLQLL 391

Query: 416 PSWNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXX 475
           P  ++   Q G S+        FF++ N AKAFFDD +QNPDML+NL+ KRRKL+D    
Sbjct: 392 PDKHAPQAQDGESQNTL-----FFSNPNYAKAFFDDSYQNPDMLNNLENKRRKLKDSEKE 446

Query: 476 XXXXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMK 535
                            +  +K+  E   +K  TE  L++GL++ +GFDP  G+   V+K
Sbjct: 447 RTLQNQLNSAIGKTGYQSFNNKSKEEQKQMKDATEQVLNSGLLRDIGFDPFRGKMREVLK 506

Query: 536 KRDSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETF 593
                   G N +  L+ K + V E++ +K+   +L PS+ +   R   R +VWRE F
Sbjct: 507 -------FGKNVNSGLNSKSSQVKEIMSFKKSNVSLAPSKAEQKKRLLRREQVWREHF 557

>SAKL0E14938g Chr5 (1242645..1242714,1242780..1244434) [1725 bp, 574
           aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
           required for the association of the MCM2-7 complex with
           replication origins
          Length = 574

 Score =  370 bits (950), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/598 (37%), Positives = 322/598 (53%), Gaps = 52/598 (8%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR+    D +D ++ DED++  +                         K  D N    V
Sbjct: 3   DPREPREIDIFDELSCDEDDD--LHKRLDELEREKKDLKQRLQDISQRKKKIDPNFS-GV 59

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
           +VP SP K    A+    + +++ E+                NLNE +  +      K S
Sbjct: 60  EVPRSPSKSKHVAVKETSRSKDDRESC----------FPAHENLNELQVQK------KAS 103

Query: 124 VNA-TTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSD 180
           +++ +T YF + F  SKK +++E   +  ML+ RVHTF G D  +E+   AVNE E+FS 
Sbjct: 104 LSSISTPYFAQNFSSSKKAQEVESRRKMEMLNCRVHTFDGPDFVREYSPIAVNEEEEFSG 163

Query: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240
            WISKRYI  +   + LR+ K+LRL KLFAKVRPP F EPQYSNW  + IIS KS VK T
Sbjct: 164 KWISKRYITAEQARKILRETKVLRLPKLFAKVRPPTFTEPQYSNWVTIGIISAKSSVKMT 223

Query: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSGGSQQ 300
           T   P ++   TLT+F+  +++++FG+  V++YYNL+ GDI+AVLNPEI PWRPS    +
Sbjct: 224 TGTKPSRYFTLTLTDFKHTINIYLFGNKNVEKYYNLKVGDIIAVLNPEIWPWRPSKVEHE 283

Query: 301 TTS---IKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHR 357
            +S   IKSFNL I H F  ILEIG SRD G+C +  K   + CG+ IN + +  C YH+
Sbjct: 284 QSSQAVIKSFNLCIKHNFNSILEIGTSRDFGFCSIYNKLQGKTCGTPINKSVEDRCYYHQ 343

Query: 358 ELQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPS 417
           E+Q RQ ++KRL+LNG  +L +PTK G +  L+    G+ K     L  D+       P 
Sbjct: 344 EVQFRQVNAKRLELNGNKSLRSPTKNGVKHILY----GKNKSGKYDLLPDR-----YAPQ 394

Query: 418 WNSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXX 477
             S+  Q             +F++ NAA+AFFDD++QNPD L+NLD+KRRKL+       
Sbjct: 395 TQSKDSQNVL----------YFSNPNAARAFFDDDYQNPDFLNNLDSKRRKLEVGKKEKL 444

Query: 478 XXXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKR 537
                             ++ + +   ++R T+ AL +GLI+++GFDPT GR +SV+K  
Sbjct: 445 LQKQLQQVIGKSNSNLFKNETSTKQDEIRRATKNALESGLIKKIGFDPTSGRMSSVLK-- 502

Query: 538 DSERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGK 595
                 G  E      K + V E+L+ K++K  L PS+  L  + + R EVW   F K
Sbjct: 503 --NNSKGLKEQA----KNSAVEEILQIKKEKIELKPSKEALRQKFKKREEVWNHHFKK 554

>Kwal_55.19691 s55 complement(80960..82360) [1401 bp, 466 aa] {ON}
           YIL150C (DNA43) - (putative) involved in DNA replication
           [contig 159] FULL
          Length = 466

 Score =  340 bits (872), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 184/470 (39%), Positives = 264/470 (56%), Gaps = 30/470 (6%)

Query: 132 LEKFQQSKKTEKLEIEAQETMLSARVHTFQGVD--KEFQLEAVNELEQFSDLWISKRYIP 189
           +E F  S+K E+  I+ +  ML +RVHTF+G+   K  +  AV E E  S LW+S+RYI 
Sbjct: 1   MENFANSRKAEESRIKHRGEMLDSRVHTFRGLKATKSRKPIAVEEKEPASGLWVSRRYIA 60

Query: 190 KQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKNPQKFI 249
              L E L+D+K+LRL KLF+KVRPPKF EP Y+NW  + I+  KS VK T+S  P K+ 
Sbjct: 61  SDELAEILKDIKILRLPKLFSKVRPPKFTEPDYANWVAVGILCHKSVVKMTSSSKPTKYF 120

Query: 250 RFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPS--GGSQ-QTTSIKS 306
           + T+T+F   LD++VF +  V++YYNLR GDI+A+LN +ILPWRPS  G  +    S+KS
Sbjct: 121 KMTITDFTHSLDVYVFNNPNVEKYYNLRVGDIIAILNADILPWRPSQVGNDEFSGASVKS 180

Query: 307 FNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQMRQNSS 366
           FNL I   + C+LEIG SRDLG+C +  K   + CG+ IN A    C+YH+E++ RQ ++
Sbjct: 181 FNLSIRGNYDCVLEIGTSRDLGFCQIYNKAKGKVCGAPINRAAVDRCDYHQEIRFRQVNA 240

Query: 367 KRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSRHGQGG 426
           +R++LNG  +L +P K G +  L+   S   K+    LP          P    R  Q  
Sbjct: 241 QRVELNGSMSLRSPVKNGKKQALY--GSSGVKRKLNLLPDKHA------PQQQDRESQNT 292

Query: 427 SSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXXXXXXXX 486
                      +F++ N AKAFFDD +QNPD+L NLD+KRRK++D               
Sbjct: 293 L----------YFSNPNYAKAFFDDTYQNPDLLENLDSKRRKMRDTESERQLQVQLSRAL 342

Query: 487 XXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSERGSGAN 546
                    +K   E   +K+ TE  +H+GL++ +GFDPT G+   V+K        G N
Sbjct: 343 GKDGQQRFSEKTKQEQKQMKQATEQTIHSGLLKNIGFDPTKGKMRDVLK-------VGKN 395

Query: 547 EDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETFGKK 596
              +   K   V E++  ++   +L PS+     R   R +VW+E F  K
Sbjct: 396 SKNSTDTKSIQVREIIETRKTNVSLAPSKADQKKRLLRREQVWKEHFETK 445

>AFR287W Chr6 (956955..958790) [1836 bp, 611 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL150C (MCM10)
          Length = 611

 Score =  311 bits (796), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 169/472 (35%), Positives = 261/472 (55%), Gaps = 30/472 (6%)

Query: 127 TTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQGVDK--EFQLEAVNELEQFSDLWIS 184
           TTSYF EKF +++ +    +  ++ +L  RV+TF   D   E+   AV+E+E +S++ I+
Sbjct: 134 TTSYFAEKFARARDSSASTMRRKQELLKRRVYTFSDRDTAIEYTTFAVDEVETYSNMRIN 193

Query: 185 KRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTTSKN 244
           KRY+P++ L+  L D+K+LRL KLFAKVRPPKF EP Y+NW  L  IS KS+VK T+ + 
Sbjct: 194 KRYVPEEDLKRILHDIKVLRLPKLFAKVRPPKFSEPDYANWVTLGAISYKSDVKSTSQEK 253

Query: 245 PQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRPSG---GSQQT 301
           P K+    +T+F   + + VFG   V++YY LR GD++A+LNPEI PW+ S    G    
Sbjct: 254 PAKYFTIRITDFHYDVQITVFGQKNVEKYYKLRVGDVIAILNPEIYPWKESAKTTGETAR 313

Query: 302 TSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRELQM 361
           T+ +SF L I H   CILEIG S++LG+CP   K     CG+ IN  +++ C YH+E  +
Sbjct: 314 TTGRSFGLSIKHNMNCILEIGHSKELGFCPAMNKTKGAPCGAPINKLKEQVCSYHQETHL 373

Query: 362 RQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSWNSR 421
           R  ++KR++LNG  +L APT+ G Q            Q+        G +    P   + 
Sbjct: 374 RSVNAKRVELNGNISLRAPTRDGIQ------------QAGYMTRNSHGTKIGLLPDVYAP 421

Query: 422 HGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXXXXX 481
              G  +E+ +    + F S+NA +A+FD ++ NPD+L NL++KRRK+Q           
Sbjct: 422 RAPG--AEQKF---REHFASANAHRAYFDSDYHNPDVLQNLESKRRKIQLSKKDQQINKQ 476

Query: 482 XXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRDSER 541
                           +   +   ++ T+  + TG+++ +GFDPT GR A+V+ + D   
Sbjct: 477 LSLVLGKNHTQVKDRVSEESLQQREKATKNVMKTGILRHIGFDPTGGRMAAVLYQGD--- 533

Query: 542 GSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETF 593
             G  + V    +E  ++E+L  K+   +L PS+     R Q R EV+   F
Sbjct: 534 -HGPADTV----REPSISEILANKKRNIDLKPSKEARRKRIQQRNEVYNSIF 580

>KLLA0A00572g Chr1 complement(51265..52910,52994..53081) [1734 bp,
           577 aa] {ON} similar to uniprot|P32354 Saccharomyces
           cerevisiae YIL150C MCM10 Essential chromatin-associated
           protein involved in the initiation of DNA replication
          Length = 577

 Score =  293 bits (751), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 193/595 (32%), Positives = 304/595 (51%), Gaps = 49/595 (8%)

Query: 4   DPRDVITADPYDNITSDEDEESKIQXXXXXXXXXXXXXXXXXXXXXAHVKPTDLNLQLDV 63
           DPR++   DPY+ ++ DE E  +++                           D N    +
Sbjct: 7   DPREITAFDPYEELSDDESEIERVKRRIVEIDTEKRDLTNRLLELEKKRNLKDPNFD-SI 65

Query: 64  QVPSSPQKRSVSAIDVARKRREEAEAIKKRNLSLALNTAQKVNLNEARFAQLDGDDGKQS 123
            VP SP+K      D A K  E+ + I           A   ++ EA F  ++ D  ++ 
Sbjct: 66  DVPESPKKS-----DNATKGIEDIKHI-----------APVADIEEATF-NVNEDYVREK 108

Query: 124 VN--ATTSYFLEKFQQSKKTEKLEIEAQETMLSARVHTFQG-VDKEFQLEAVNELEQFSD 180
           V    TTSYF EK +     E   I+ ++ +L+ RV+TF G +  E++   V+E +  S 
Sbjct: 109 VKKLGTTSYFTEKLRSINTNEHEAIKRKKELLAHRVYTFNGDMFDEYEPITVDEKDDLSG 168

Query: 181 LWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFT 240
           L I +RY+P   L +  +++K+LRL KLF+KVR PKF EP Y NW VL IISKK+E + T
Sbjct: 169 LVIDRRYVPLAVLRKHTKNIKVLRLPKLFSKVRAPKFSEPDYPNWLVLGIISKKTEPRMT 228

Query: 241 TSKNPQKFIRFTLTNFQQQLDLFVFGDAGVKRYYNLREGDIVAVLNPEILPWRP--SGGS 298
            S  P KF   T+++FQ +L++  FG + V++YY LR GD++A+LNPEI+P +   +G S
Sbjct: 229 NSVKPVKFFSLTISDFQFELNVIFFGKSIVEKYYKLRLGDLIAILNPEIMPSKKLEAGAS 288

Query: 299 QQTTSIKSFNLKIAHKFKCILEIGKSRDLGYCPVTKKFSNEKCGSAINLARDRTCEYHRE 358
               S  +F+LK++     ILE+G S++ G C    K   + CG+ IN   D  C YH+E
Sbjct: 289 ---PSYATFSLKVSKDTNNILELGHSKEFGLCQFYMKNKGKLCGAPINKLHDNYCAYHKE 345

Query: 359 LQMRQNSSKRLDLNGGFALGAPTKVGTQPDLFREASGRFKQSARSLPRDQGKRFYTEPSW 418
            +MRQNSS+R++++   A+ AP   G Q  + +      K S R   ++  K F  EP+ 
Sbjct: 346 AKMRQNSSRRVEISSSVAMRAPVVKGYQQTIVKSQHNNGKTSIR-YQQNPDKPFVREPA- 403

Query: 419 NSRHGQGGSSEENYGLKGKFFTSSNAAKAFFDDEFQNPDMLHNLDAKRRKLQDXXXXXXX 478
                   ++E N  L    F+S+NA+ AFFDD+++NPD+L NLD KRRK+Q+       
Sbjct: 404 --------AAETNRFL----FSSANASTAFFDDDYENPDILANLDNKRRKIQELRNNRNL 451

Query: 479 XXXXXXXXXXXXXXATLDKNTAEMAALKRTTETALHTGLIQRLGFDPTHGRAASVMKKRD 538
                             ++     A K  T +    GL  ++G+DPT G+A+  M +  
Sbjct: 452 EKKLKGLSDKLLSKK---EDRVNQEAKKTATLSMFQHGLANQIGYDPTKGKASLEMLEYS 508

Query: 539 SERGSGANEDVALSQKENMVNELLRWKRDKCNLLPSETQLAHRKQHRREVWRETF 593
           +E  +  N+      K+  + ++   K+D  +L PS+ QL  + + R  ++ E  
Sbjct: 509 TENKAPKND------KQLAITDICNIKKDNVSLKPSKKQLKEKIEKRNAIFNEIM 557

>Kpol_1013.67 s1013 (163823..165919) [2097 bp, 698 aa] {ON}
           (163823..165919) [2097 nt, 699 aa]
          Length = 698

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 66/174 (37%), Gaps = 28/174 (16%)

Query: 164 DKEFQLEAVNELEQFSDLWISKRYIPKQYLEESLRDVKLLRLNKLFAKVRPPKFQEPQYS 223
           + ++++  +NE  +FS  + SK  +P      ++ D  LL   K  A+ R P        
Sbjct: 175 NSQWRISKINENYEFSSTYPSKLIVPN-----NISDTVLLHAGKYRAQARIP-------- 221

Query: 224 NWAVLAIISKKSEVKFTTSKNPQKFI---------RFTLTNFQQQLDLFVFGDAGVKRYY 274
              VLA   KK+    T S  P   I         R  LT F+    L V  D   + + 
Sbjct: 222 ---VLAYYYKKTNCVITRSSQPLPGITKQRSVQDERVVLTEFECS-SLLVLDDIDNRDHV 277

Query: 275 NLREGDIVAVLNP--EILPWRPSGGSQQTTSIKSFNLKIAHKFKCILEIGKSRD 326
           + R  +I+    P    +     GG  ++    +FNL    KF  I  I    D
Sbjct: 278 SPRMKNIIVDARPTANAMAQTALGGGTESMEYYNFNLTCQKKFLGIDNIHVMHD 331

>SAKL0B03036g Chr2 complement(282513..283931) [1419 bp, 472 aa] {ON}
           similar to uniprot|P43589 Saccharomyces cerevisiae
           YFR005C SAD1 Conserved zinc-finger domain protein
           involved in pre-mRNA splicing required for assembly of
           U4 snRNA into the U4/U6 particle
          Length = 472

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 2/53 (3%)

Query: 204 RLNKLFAKVRPPKFQEPQYSNWAVLAIISKKSEVKFTT--SKNPQKFIRFTLT 254
           RL+ +  K+  PK  +P  S   +L  IS  S+ KF+T  SK+P+ FI + LT
Sbjct: 199 RLSIIVRKMWSPKLFKPHISPHELLQYISLISKQKFSTKESKDPRNFILWLLT 251

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,189,394
Number of extensions: 2424602
Number of successful extensions: 7719
Number of sequences better than 10.0: 48
Number of HSP's gapped: 7894
Number of HSP's successfully gapped: 48
Length of query: 616
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 500
Effective length of database: 40,180,143
Effective search space: 20090071500
Effective search space used: 20090071500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)