Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021405.702ON1608160878850.0
TDEL0B021905.702ON181015727875e-84
SAKL0E14916g5.702ON177916837795e-83
NCAS0A032005.702ON178816447403e-78
Smik_11.3585.702ON187814607199e-76
ZYRO0G06600g5.702ON182014187143e-75
CAGL0G02497g5.702ON178013826948e-73
Skud_11.3345.702ON188515546922e-72
Suva_11.3315.702ON189815546752e-70
AFR286W5.702ON175815956473e-67
Skud_9.195.702ON168013216303e-65
TBLA0E017305.702ON182014446197e-64
YKR095W (MLP1)5.702ON187515086133e-63
Ecym_40185.702ON176915105991e-61
KAFR0D022205.702ON16748555973e-61
Kwal_55.196975.702ON176015725615e-57
Suva_9.395.702ON168211795454e-55
YIL149C (MLP2)5.702ON167913535212e-52
KNAG0C065905.702ON165115924417e-43
KLTH0E01056g5.702ON17719234336e-42
NCAS0G002305.702ON173511084069e-39
KLLA0A00594g5.702ON174813073862e-36
Kpol_1043.705.702ON13215393541e-32
NDAI0F002905.702ON15544073451e-31
Smik_9.205.702ON16827993432e-31
NDAI0E050405.702ON19731152922e-25
TPHA0D046105.702ON11834582286e-18
KAFR0H002105.702ON14541122171e-16
Kpol_2001.755.702ON1006801010.005
TPHA0E002305.702ON128448970.018
AAL085C5.296ON833152940.034
KAFR0A016101.295ON1227106880.17
TPHA0B008304.238ON2536423870.26
KNAG0C039707.314ON1721119860.33
KAFR0F030204.46ON824210820.86
YDR356W (SPC110)5.414ON944279801.4
Kpol_1050.695.88ON1084201801.5
KLLA0F07997g7.101ON111969791.9
Kpol_1067.224.364ON722100792.0
NCAS0F025005.296ON831171782.3
Kpol_1028.897.488ON877253782.6
TPHA0F008304.113ON1192174773.1
TBLA0A036205.414ON970164773.3
Suva_2.3618.398ON43260763.9
NCAS0A013205.260ON73462755.7
Kwal_56.238258.259ON1396174756.1
Kpol_483.114.238ON2546106756.5
CAGL0D05258g7.186ON1170202747.0
KNAG0L011607.186ON1170168748.0
Skud_14.881.110ON1316416748.4
Skud_4.1964.238ON1792201739.6
SAKL0F02772g3.492ON773197739.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02140
         (1608 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...  3041   0.0  
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...   307   5e-84
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...   304   5e-83
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...   289   3e-78
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...   281   9e-76
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...   279   3e-75
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...   271   8e-73
Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR09...   271   2e-72
Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR09...   264   2e-70
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...   253   3e-67
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...   247   3e-65
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...   243   7e-64
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...   240   3e-63
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...   235   1e-61
KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {...   234   3e-61
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...   220   5e-57
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...   214   4e-55
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...   205   2e-52
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...   174   7e-43
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...   171   6e-42
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...   160   9e-39
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...   153   2e-36
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...   140   1e-32
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...   137   1e-31
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...   136   2e-31
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...   117   2e-25
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    92   6e-18
KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON...    88   1e-16
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    44   0.005
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    42   0.018
AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,...    41   0.034
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    39   0.17 
TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4....    38   0.26 
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...    38   0.33 
KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.4...    36   0.86 
YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110In...    35   1.4  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    35   1.5  
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    35   1.9  
Kpol_1067.22 s1067 complement(46246..48414) [2169 bp, 722 aa] {O...    35   2.0  
NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496...    35   2.3  
Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa] ...    35   2.6  
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    34   3.1  
TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.4...    34   3.3  
Suva_2.361 Chr2 complement(634656..635954) [1299 bp, 432 aa] {ON...    34   3.9  
NCAS0A01320 Chr1 (257101..259305) [2205 bp, 734 aa] {ON} Anc_5.260     33   5.7  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...    33   6.1  
Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON...    33   6.5  
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    33   7.0  
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    33   8.0  
Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250...    33   8.4  
Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W...    33   9.6  
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...    33   9.6  

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 3041 bits (7885), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1529/1608 (95%), Positives = 1529/1608 (95%)

Query: 1    MAGTDNSSPDNPDQQVISPGADSTVTMNQVGDGVHSPLQGNELREKLRQAEDXXXXXXXX 60
            MAGTDNSSPDNPDQQVISPGADSTVTMNQVGDGVHSPLQGNELREKLRQAED        
Sbjct: 1    MAGTDNSSPDNPDQQVISPGADSTVTMNQVGDGVHSPLQGNELREKLRQAEDSNRLLRER 60

Query: 61   XXXXXXXXXXKTGILDTVQSSVSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRL 120
                      KTGILDTVQSSVSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRL
Sbjct: 61   NELLSRSLEEKTGILDTVQSSVSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRL 120

Query: 121  SEQLKQGERYINATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALL 180
            SEQLKQGERYINATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALL
Sbjct: 121  SEQLKQGERYINATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALL 180

Query: 181  DSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGG 240
            DSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGG
Sbjct: 181  DSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGG 240

Query: 241  ETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGILGQGAPSIAHXXXXXXXXXXXNVS 300
            ETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGILGQGAPSIAH           NVS
Sbjct: 241  ETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGILGQGAPSIAHLRKLLLKERKENVS 300

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360
            LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK
Sbjct: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360

Query: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQR 420
            VDHLNQIFHKLRVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQR
Sbjct: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQR 420

Query: 421  IVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLEQSN 480
            IVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLEQSN
Sbjct: 421  IVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLEQSN 480

Query: 481  AQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKINVLN 540
            AQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKINVLN
Sbjct: 481  AQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKINVLN 540

Query: 541  KTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSA 600
            KTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSA
Sbjct: 541  KTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSA 600

Query: 601  QKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLET 660
            QKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLET
Sbjct: 601  QKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLET 660

Query: 661  RNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIK 720
            RNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIK
Sbjct: 661  RNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIK 720

Query: 721  WYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAAL 780
            WYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAAL
Sbjct: 721  WYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPVGTELKELQNELNGMKAAL 780

Query: 781  EVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQS 840
            EVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQS
Sbjct: 781  EVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQS 840

Query: 841  KGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTR 900
            KGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTR
Sbjct: 841  KGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTR 900

Query: 901  LNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELK 960
            LNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELK
Sbjct: 901  LNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELK 960

Query: 961  LANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRD 1020
            LANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRD
Sbjct: 961  LANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRD 1020

Query: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD 1080
            VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD
Sbjct: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD 1080

Query: 1081 ESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQM 1140
            ESIKSLNEDKRTLQ            AKKNSSAISEQEWQQKIETYQQESEKWKLMCQQM
Sbjct: 1081 ESIKSLNEDKRTLQEEVSRLRESEELAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQM 1140

Query: 1141 SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIE 1200
            SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIE
Sbjct: 1141 SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIE 1200

Query: 1201 LSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLI 1260
            LSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLI
Sbjct: 1201 LSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLI 1260

Query: 1261 ADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXX 1320
            ADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFER    
Sbjct: 1261 ADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFEREKKE 1320

Query: 1321 XXXXXXXXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQ 1380
                                  TLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQ
Sbjct: 1321 LMNNNANLEELRKPLEEEWERKTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQ 1380

Query: 1381 FQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKT 1440
            FQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKT
Sbjct: 1381 FQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKT 1440

Query: 1441 TLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGAXX 1500
            TLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGA  
Sbjct: 1441 TLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGATT 1500

Query: 1501 XXXXXXXXXXAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGA 1560
                      AKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGA
Sbjct: 1501 TTISQPTSTTAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGA 1560

Query: 1561 ASGTPFRFGFASNPPTPFQNTAENGTDAKRKSQTEASKEVEDNKRPKP 1608
            ASGTPFRFGFASNPPTPFQNTAENGTDAKRKSQTEASKEVEDNKRPKP
Sbjct: 1561 ASGTPFRFGFASNPPTPFQNTAENGTDAKRKSQTEASKEVEDNKRPKP 1608

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score =  307 bits (787), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 425/1572 (27%), Positives = 741/1572 (47%), Gaps = 249/1572 (15%)

Query: 162  LDQSLSEIKALRD-------SNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERE 214
            L +SL E+  L++       S   LL   + I+++L +K    K LSD+L++++ +F RE
Sbjct: 234  LQKSLQEVARLKNDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSRE 293

Query: 215  LATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEE-- 272
            ++ + KL  +  +Q+ S   EL    E     E ++  + Q ++  ++++  ++Q+EE  
Sbjct: 294  MSLKQKLLDLQDEQLQSFKEELRLTEEKHNSTEADNLQSTQQARFMDDLAQVRQQLEESN 353

Query: 273  -----LLGILGQGAPSIAHXXXXXXXXXXXNVS------------------------LKK 303
                 L  ++ +    +             NVS                        L++
Sbjct: 354  HERLRLQAVVNE----VMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQR 409

Query: 304  QMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDH 363
            Q+ESFV+ELE+++P +  L++++  ++++L      +   S  K R  REL S+  K+  
Sbjct: 410  QIESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQ 469

Query: 364  LNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYKDSQ 419
            L    H L  QRSDLA Q+QFLL      N S   L   E++FIK IIENEN     DSQ
Sbjct: 470  LEINTHTLIRQRSDLARQVQFLLFNGTLQNDSRGPLTADEVAFIKKIIENENPSNESDSQ 529

Query: 420  RIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQI 473
             I+++RL+ F +I  LQE+N +L+ T R+L D++E  E +++  +      T++ AK  I
Sbjct: 530  SIITERLVEFKDIATLQERNTELLKTARTLADRLEEEEKNSNIRIDSLERKTIDEAKEAI 589

Query: 474  SKLEQSNAQLESEVKN-------WEALM-------ETLKDGDSL-DSKINVTMVEQQKKI 518
              L++ N+++ES+V         ++A++       + L D D + DS+      E Q+ I
Sbjct: 590  ITLQERNSEIESKVSTIEKERDAYKAILSQTSQSFDNLGDADRMKDSQ------ENQELI 643

Query: 519  EELESKLTDVGESHVQKINVLNKTI-----DRNQSTINMLNEQIKNTVKSDMNA--KSEL 571
            + LE KL+ +     +   +LN+ I      + Q TI+   E+   T+  D     +S L
Sbjct: 644  KSLEDKLSTLTTETSKNNELLNQEIRNLYQSKTQLTISHEKERSSRTLAEDRLKLLQSTL 703

Query: 572  IACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSV----AANKCKSWENSF 627
               K EN  L ++    Q+ L +  +++ +    Y    ++LSV    AAN         
Sbjct: 704  EMTKNENAELIRRSHELQSILSKQEARNGETVNKYISCQSKLSVLEARAAN--------- 754

Query: 628  HLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKI 687
              L  EK+ ++    SL  +IQ+ S +   L     +L+   S +E   K S+ +  + I
Sbjct: 755  --LDAEKSLLQSSSDSLRREIQKISVERNSLNLMVTQLQTLQSERENLLKESQASHKAAI 812

Query: 688  TFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKL 747
              L  +   L  +++ K+ E+K   +    Q KW+Q+ IDE+S             +D  
Sbjct: 813  AQLEVQTSELKTEISSKDNEIKASEDAKRAQTKWFQEKIDEMS-------------SDAG 859

Query: 748  RLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTL- 806
            ++  E  L+ K   V     +L+ E+N +K  +E S+S+   YK   +          L 
Sbjct: 860  KIRDE--LATKTATVA----QLELEVNDLKKKIEESDSRIASYKTLNDAGNGETTQGQLR 913

Query: 807  -SFQNTISELQ---SKNEAL----SKQHETLQNQITETENQSKG------------IQLE 846
               + T+ EL+   S+NE      S   ETL+N   E E +++             +QLE
Sbjct: 914  KDLEKTMIELKHAYSQNEEFKQISSTAEETLKNLSNEFEERTEALKSNAEKYLAEKVQLE 973

Query: 847  HQTI------IDRLTSE-----------KTALEEKLNSLSHSEEKIAEMKGEYDAQIQKI 889
             Q +      ID L +E           K  + +KL SL  SE  + ++K EYD ++ ++
Sbjct: 974  -QCVSNLKKNIDFLNNEYALQKNRSEEEKNEILKKLVSLESSEHSLGQVKKEYDQKLYQL 1032

Query: 890  ESNLKIQSD----TRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEAR 945
            + +L+ Q+      + N+E  L  K  E++     I QL +E+    S+I  L    +  
Sbjct: 1033 QKDLEQQTAYANIAQKNYEEEL-QKHAEVSKI---ISQLRSEVQSGRSEIQQLKASEQQA 1088

Query: 946  KTLIK--ERDSLGQELKL------ANQRIESLAAQNSILYDTFSGMRHVDADAE----PN 993
            K +++  E+    Q+ +L        ++++++++QN +L+     +   + + E    P 
Sbjct: 1089 KEVLENGEKSWYNQKTELDAHIDDLKRQVDNISSQNKLLFSQVELLSKSEREFENKLLPG 1148

Query: 994  EDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDF 1053
                 L+I+LR ERD+ +++ T ++R+ KLL +    + ++LA    ++ +    + +  
Sbjct: 1149 SS--ELLISLRRERDILETKLTVSKREEKLLHQKQVALEDELAEARKKLFKLQENDSNHS 1206

Query: 1054 SLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSA 1113
             +   HE IM +L  +   +E N+ L  ++ +  E    LQ                +S 
Sbjct: 1207 DIAKQHEDIMEQLNQMNLLRESNVTLRNAVNAAQEKNSDLQSELNHLQSKILPL---NSE 1263

Query: 1114 ISE-----QEWQQKIETYQQESEKWKL----MCQQMSENTATEIQNLQQQLETFKADIQL 1164
            +SE     +E  Q+I     E+++WK     + ++  +    E + L++++   K +++ 
Sbjct: 1264 LSECRQSIEEKDQRIILLIDEADRWKERSHDILRRHEKIDPEEYRKLEEEISNLKKELEA 1323

Query: 1165 KTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSV- 1223
            K++EN DLNDRFTRLKKQAHEKLNASK    +L+ E++EL+     ++E L   +T  + 
Sbjct: 1324 KSKENTDLNDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLN 1383

Query: 1224 --------DSES--NAALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLKE- 1272
                    DSES  N  L  +L +  ++ K +E++L  +V SSE L + + +E+ +LKE 
Sbjct: 1384 LEKLLTERDSESANNEDLRHELDDALERCKEIEVKLGETVGSSEGLTSQLNEEINSLKEQ 1443

Query: 1273 ----------NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXX 1322
                      + ++GS   +  ++ +E +K  FE+EK   I++ T E  ++FE       
Sbjct: 1444 VRIFKEKENDSTLEGS---QGLSNVVESMKKAFEEEKIKFIQEKTEEYNKKFEEEKAKLS 1500

Query: 1323 XXXXXXXXXXXXX---------XXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKR 1373
                                         + QRI+EA+ENLKK IR+PTEE+I++V+ KR
Sbjct: 1501 SENGSPAEPVSAPDVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTEERIKKVLDKR 1560

Query: 1374 KAQLEEQFQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGR 1433
            K +LEE+FQ ++ E  N L+      K  +EL+K++  E + + +E     KKKAFEEG+
Sbjct: 1561 KTELEEEFQRRLKE--NNLQPEGGDAKEREELKKQLESEFEAKYKEILASTKKKAFEEGK 1618

Query: 1434 QQASMKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPL-------MVAG-PLTNE 1485
            QQA+MK+TLLERKI+KLE++L     P         + + + +       M  G P   E
Sbjct: 1619 QQAAMKSTLLERKISKLESQLNSSNNPTPEKAAATSVGLPTKIDESRTENMATGTPAFGE 1678

Query: 1486 PV--LDEKPNAFAGAXXXXXXXXXXXXAKDSANAFSFNAQKVPAQPAFS-------SRAQ 1536
             V  L +KP AF+              +    +A   N      +P FS         ++
Sbjct: 1679 KVLKLSDKP-AFS--------FQPSSKSNPFTSALPGNNNVFGMKPTFSFTPGSSQPESR 1729

Query: 1537 PAFSFGSFNKTS 1548
            P F    FN T+
Sbjct: 1730 PTFGSTGFNTTA 1741

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} similar
            to uniprot|Q02455 Saccharomyces cerevisiae YKR095W MLP1
            Myosin-like protein associated with the nuclear envelope
            connects the nuclear pore complex with the nuclear
            interior involved in the Tel1p pathway that controls
            telomere length involved in the retention of unspliced
            mRNAs in the nucleus
          Length = 1779

 Score =  304 bits (779), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 454/1683 (26%), Positives = 767/1683 (45%), Gaps = 251/1683 (14%)

Query: 71   KTGILDTVQSSVSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRLSEQLKQGERY 130
            K G L+  Q          ++ R+QV+EL     E+E Q F+S   R +   Q    E  
Sbjct: 148  KIGDLEASQDEAKQLLQNTKTLRKQVLEL-----ENEVQTFKSNDLRGKAEMQRLTQEMN 202

Query: 131  INATNGRLLES--TKKLLDF----QRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLE 184
            +  +N + LE     K  +F    QR + ++     +L+   SE++  R S+  L     
Sbjct: 203  LLKSNNQWLEKELASKSEEFGSYRQRVNSELQTALSELNSIRSELEIERSSSQTLKSRAN 262

Query: 185  RINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNG-GETP 243
             ++++L DK    K+L D  S ++ +F RE+  + +L  +L+KQ+ S  +EL +   ++ 
Sbjct: 263  DLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLEKQIESFKTELESARNKSV 322

Query: 244  AHAEPNDQFAKQSSQHEE--------EISNYK-----EQVEELL---GILGQGAPS---- 283
            ++++  D  A++    EE        EIS  K     E V+ELL   G  G G  S    
Sbjct: 323  SNSDHVD--AEREKIIEELIETKKKLEISESKAVKLEETVDELLSTDGERGAGNTSKVSL 380

Query: 284  -------------IAHXXXXXXXXXXXNVSLKKQMESFVIELEHRLPGLQILEKQNKEVQ 330
                         I                L+ Q+E+FV+ELEH++P L   +++ + ++
Sbjct: 381  DSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEHKVPVLNSFKERTEMLE 440

Query: 331  QKLHAATNKMIEESKAKIRTQRELSSSRQKV-DHLNQIFHKLRVQRSDLAHQIQFLL--- 386
            ++L      +   SK K   + EL+S + K+ D+  QI H L  QRSDLAHQ+Q LL   
Sbjct: 441  KELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQI-HSLVRQRSDLAHQVQHLLIQV 499

Query: 387  -TVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVST 445
               N S+  L P E +FIK II +      +D+QRI+S+RL+RF+++ ELQE+NM+L+++
Sbjct: 500  SVRNDSNGPLTPEETNFIKKIINSSESPVEQDAQRIISERLVRFESMVELQEKNMELLNS 559

Query: 446  VRSLVDKV------ESWEADNDSGLTLEAAKLQISKLEQSNAQLESEV----KNWEALME 495
            +R+L DK+         ++      T++ AK  I  L++ N  LES++    K  +A   
Sbjct: 560  IRNLADKLEAEEKESKSKSKEVESETVKEAKEAILTLQEYNKSLESQLEIIAKERDAFKI 619

Query: 496  TLKDGDSLDSKINVT------MVEQQKKIEELESKLTDVGESHVQKINVLNKTID---RN 546
               D  + +   NV       +V  ++KI+ELE+ L+ + E   + I +LN+ I    R 
Sbjct: 620  LASDKGTSNGPSNVNSSENRHLVLAEEKIKELENHLSSLTEESAKNIKLLNEEIHSLYRA 679

Query: 547  Q--STINMLNEQIKNTVKSDMNAKSELIA-----CKRENLSLTQQISTKQNELDELNSKS 599
            Q  +++N+  E+    +  D   +S+LI+      K EN  L ++  + Q  + + +SK+
Sbjct: 680  QADTSVNLEKERSSRILAED---RSKLISNTLEMTKMENDELRKRFHSLQENILKQDSKT 736

Query: 600  AQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLE 659
             Q         ++LS   ++  + ++   LL   +  ++++  SL ++       + QL+
Sbjct: 737  QQTIESLISCKSQLSALQSQLNNSQSERDLLRSIQENLKKENESLSEERNNMRILITQLQ 796

Query: 660  TRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQI 719
            T   E E  +       + +++    K   L  E       L  K +E+  +I   + Q 
Sbjct: 797  TLQTERESLL-------EETQKNFQGKTNKLETELSDTLEKLDAKSKEISDYISTKDSQE 849

Query: 720  KWYQQNIDELSEQNKNKSNKI-------------IE-LNDKL-----RLLSEKSLSNKPY 760
            KWYQ+  D L+E+  N   K+             +E LN+KL     R+ +  +L N   
Sbjct: 850  KWYQEKFDRLNEELNNSREKLSSKLTDIQHLELKVESLNNKLEESEARIQAFNAL-NYSE 908

Query: 761  PVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNE 820
             V ++ + L+ EL   +  L  + SQ   YK   + ++        + + + +E   K E
Sbjct: 909  SVESQTETLRQELEKTRIKLADAYSQVEQYKSMADSSEESATAIKDALEQSKAEYTEKIE 968

Query: 821  ALSKQHETLQNQITETENQSKGI--QLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEM 878
             L+K+ +  ++Q+   ++Q   +  +L HQ    +  S+ +     L  L   + ++  M
Sbjct: 969  TLTKERDMFKDQVPILKDQISNLNNELNHQK--SQFESQISDYTRNLEDLKAKQSELDNM 1026

Query: 879  KGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYA---VQIEQLNTEIAKLNSDI 935
            K EY+ +I KI+ +L  Q+       +A  + E+EL  +A    +I  L  E  K  S+ 
Sbjct: 1027 KAEYEQKISKIQEDLNQQTSY---ANTAQKNYEQELQKHADVSKKISLLRAEAQKYKSET 1083

Query: 936  AALTEPAE-ARKTL-------IKERDSLGQELKLANQRIESLAAQNSILYDTFS----GM 983
              L   AE A+K L        K+      EL+LA+QRIE L AQ+ ILYD       G 
Sbjct: 1084 ETLRNAAENAKKALEQSELSWEKQSSDYEDELRLAHQRIEDLNAQSKILYDQIDFLSKGK 1143

Query: 984  RHVDADAEP-NEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEI 1042
                 D  P + + RNL+ +LR E+D+ +++   + R+ K+L++ LK I   L  +  E+
Sbjct: 1144 PTSSEDLMPISTETRNLLTSLRREKDILETKLEVSTREEKVLRQKLKLIESDLEGSRIEL 1203

Query: 1043 DEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXX 1102
             +       + +     E+IM +L  L   +E N+ L    +   E  R L+        
Sbjct: 1204 SKLQRAASGNSATLKDQEEIMTQLNQLNLLRESNITLRNEAQKNGERSRELKAELDALYG 1263

Query: 1103 XXXXAKKNSSAI--SEQEWQQKIETYQQESEKWKLMCQQMSENT----ATEIQNLQQQLE 1156
                 +   + +  S +E   +I    +E+E+WK   Q +          E Q L  ++ 
Sbjct: 1264 KVQPLESKVTLLQNSVREKDLQISLKNEEAERWKQRSQDILHKYERIDPEEHQKLADKVS 1323

Query: 1157 TFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQ---- 1212
              + +I+ K+ EN++L+ RF RLK+QAHEKLNA+K    +L  +L++LK   + L+    
Sbjct: 1324 ELQQEIKSKSDENEELDTRFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLG 1383

Query: 1213 ---EKLNNQETNSVDSESNAAL---ILQLKEENKQAKSLELE--LRHSVDSSEKLIADMT 1264
               E++ N E+   D E N +     LQ + EN QAK LE E  L     SS  L  ++ 
Sbjct: 1384 SQKEEVKNLESKITDIEKNKSSEKNDLQEQLENSQAKLLETENKLEQVTSSSALLEKELN 1443

Query: 1265 KELTTL---------------KENPIQGSVN---VEDYTHRLEQLKSEFEDEKRVLIEKT 1306
            + + +L                E+P  GS +   VE+ +  +E LK EFE+EK  +I   
Sbjct: 1444 ERIESLMNKIKLLEEDLEKAKTESPNDGSQSSELVENTSKIVENLKIEFEEEKAKMISDK 1503

Query: 1307 TSELTERFERXXXXXXXXXXXXXXXXXXXXX----------------XXXXXTLQRIEEA 1350
             SEL E+FE                                           T QRI E+
Sbjct: 1504 ESELREQFEEEKASILEAKEQELREQLATQKLDPPVNIDEIKKKWEEEYEQKTSQRIRES 1563

Query: 1351 KENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL---------KLSELSNKT 1401
             E LKK IRLPTEEKI +++ K++ +LE +F+  V ++A  +           +E+  K 
Sbjct: 1564 NEQLKKRIRLPTEEKINKIVEKKRLELEAEFEANVQKKAEEIAKSKSASNSNSTEVLEKH 1623

Query: 1402 ADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPL 1461
              +LE  +++E++ + +ED   +KK+AFEEG+QQASMK+T LE+KIAKLE +++      
Sbjct: 1624 KQDLEN-LKQEMQKKFDEDIAQIKKRAFEEGKQQASMKSTFLEKKIAKLETQIKAHD--- 1679

Query: 1462 KSANGLNKINIDSPLMVAGPLTNE-----PVLDEKPNAFAGAXXXXXXXXXXXXAKDSAN 1516
             SA  +N  +  +P   +GP T +     P+L+ +     G                   
Sbjct: 1680 -SAIPINDNSSATP-AESGPTTQDVKQLTPILNNQAAILPG------------------- 1718

Query: 1517 AFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGTPFRFGFASNPP- 1575
                  + +P  PA        F+FG                G  +   F+  F S PP 
Sbjct: 1719 ------KPLPFNPAH-------FAFGM-------------PFGQTTSNSFQNPFNSQPPE 1752

Query: 1576 -TP 1577
             TP
Sbjct: 1753 QTP 1755

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score =  289 bits (740), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 431/1644 (26%), Positives = 741/1644 (45%), Gaps = 287/1644 (17%)

Query: 154  QVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFER 213
            ++  +R K+    +    ++  N AL      ++  L +K++  + L++  ++++ + ++
Sbjct: 227  EIQTLRKKISTLENNCSIIKSENDALKKENRIVSSNLHEKSSKVQELTNLYNTEKEESQK 286

Query: 214  ELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPND---------------QFAKQSSQ 258
            EL+ + ++  VL+ QV  L  +      T      ND               +   Q ++
Sbjct: 287  ELSLKQEMIDVLQTQVQKLQDDYTRILNTKQPIVQNDEERNLEVEELKQKLIETETQLNK 346

Query: 259  HEEEISNYKEQVEELLGILGQGAPSIAHXXXXXXXXXXXNVSLKKQMESFVIELEHRLPG 318
              EE  N   Q E    +  Q    +                L+ Q+E F++ELE ++P 
Sbjct: 347  ELEERRNITMQTES-STLSNQQQEDLDTIKKELIQERYQKEKLQNQVEIFIVELEKKVPT 405

Query: 319  LQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDL 378
            +   +++   ++++L  AT  +    + K +   EL + RQ    +      L  QR+DL
Sbjct: 406  INSFKQRTDMLEKELTDATLLLENLRREKNQVTNELDALRQNFKSVKWETKSLTKQRNDL 465

Query: 379  AHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPE 434
            AHQ+Q++L      N S+  L   E+ FI+ I++NE+ +   DSQ+++S+RL+ F NI E
Sbjct: 466  AHQLQYILIHTSVQNDSNGPLSAEEVRFIQDILDNESNEESSDSQQVISERLVTFQNIVE 525

Query: 435  LQEQNMKLVSTVRSLVDKVESWEADNDSG------LTLEAAKLQISKLEQSNAQLESEVK 488
            LQ++N+ L+ +VR L  K+E  E    S         ++ AK  I  L+  N +LE ++K
Sbjct: 526  LQQKNIDLLKSVRELARKLELQEEHQQSTSQVVEQQAIDEAKEAIISLQSYNTKLEDKIK 585

Query: 489  NWEALMETLKDGDSLDSKINVTMV----EQQKKIEELESKLTDVGESHVQKINVLNKTID 544
                 ++  K     D+K+    +    E    I+ELE++L    E   +    LN  ID
Sbjct: 586  TLNDELDCYKSLPKPDTKVETEHLRLNEENTDLIKELETRLATSREESNKTFASLNNEID 645

Query: 545  ---RNQSTI----------------------NML------NEQIKN--------TVKSDM 565
               RN S                        N L      NEQ++         T+K D 
Sbjct: 646  DIRRNHSQTVKECQNERASRELAEQRLKLIQNSLSLSKVENEQLQKRLEILQDITLKQDQ 705

Query: 566  NAKSELIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWEN 625
              +  L    +E +S    +S  QNEL+ + S              +L+++    KS ++
Sbjct: 706  RTQETL----KEYVSCKVALSNSQNELNYIQS--------------QLNISKTNEKSLKD 747

Query: 626  SFHLLTEEKTQMEQKQRSLFDKIQQESKKLL-QLETRNKELEVKISGKELHRKRSEETLS 684
               ++++E+ ++               K+L+ QL++   E E   +  +L  +   +T+ 
Sbjct: 748  DITIVSKERNEL---------------KELVSQLQSLQTEREQIFNSTKLDSQTRLDTVE 792

Query: 685  SKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK-------NKS 737
             ++  +SE+       L  K+ E+K+       +I+WYQ  ID + E+          K+
Sbjct: 793  RELYDISEK-------LKNKDREIKELESNRLSEIEWYQNKIDAIKEKRDAYQDELLEKT 845

Query: 738  NKIIELNDKL------------RLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSES 785
            N+I ELN ++            R+ + K L+N    VGT+++ LQNEL   K+ + +SE+
Sbjct: 846  NEIGELNYEIKKLQKDLQASESRVTAYKVLNNSD-NVGTKMETLQNELE--KSKINLSEA 902

Query: 786  QATL--YKDTLERNQNFYNNSTLSFQNTISE-----------LQSKNEALSKQHETLQNQ 832
             A L  YK +    + F  N    +QNT+ E           LQ   + L      L  Q
Sbjct: 903  YAELDQYKQSASEKEEFLEN----YQNTVEETKKEFIRKIETLQKDRDELLDTKSILSEQ 958

Query: 833  ITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESN 892
            IT+  N     +L+HQ        EK+ + +KLN L      I E+  +Y+ ++  ++++
Sbjct: 959  ITDLNN-----ELDHQNKAH--LEEKSEISKKLNELLAQNHNIEEVSNQYELKLSTLQND 1011

Query: 893  LKIQSD----TRLNFESALTSKEKELTSYAVQI-EQLNTEIAKLNSDIAALTEPAEA--- 944
            L+ Q+      + N+E  L  K  EL     Q+ E  +T   K++S  A  T   E    
Sbjct: 1012 LEQQASYANIAQNNYEQEL-QKHAELAKTISQLREDAHTYRKKMDSMQANATTNEELLRK 1070

Query: 945  -RKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVD------ADAEPNEDLR 997
              K   ++R S   ++    +RIE L++QN +L+D    +   +      + A PNED  
Sbjct: 1071 NEKLWEEQRKSYEDQIHALKKRIEDLSSQNKLLFDQVDLLSKSENSYNQQSSATPNED-- 1128

Query: 998  NLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTV 1057
             LV++LR +RD+ Q++ +  + + K L+  L  +  +L  T  ++ E    + ++  ++V
Sbjct: 1129 -LVLSLRSDRDILQTRLSVTEEEGKALRLKLSSVNTELTNTRAKLTE-IRQQYENTKISV 1186

Query: 1058 -THEKIMRELEGLTNTKEENLYL-------DESIKSLNEDKRTLQXXXXXXXXXXXXAKK 1109
              H+ IM +L  L   +E N+ L        E  K L ED  TL+             K+
Sbjct: 1187 EEHDNIMNQLNQLNLLRESNITLRNEANDSREKAKQLQEDLETLREKVLPLEAEQNRLKE 1246

Query: 1110 NSSAISEQEWQQKIETYQQESEKWKLMCQQM----SENTATEIQNLQQQLETFKADIQLK 1165
                I E E  Q++  Y++E  +WK   Q +     +    E + L+ ++ T K ++  K
Sbjct: 1247 ---VIKENE--QQLNAYKEECNRWKQRSQDILTKHKKIDPVEHEKLEAEIATLKQNLADK 1301

Query: 1166 TQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETN---- 1221
             +EN++LNDRF R+KKQAHE+LN+SKAT  +L  ++ +L+  N  +Q  L  +  N    
Sbjct: 1302 KKENEELNDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQSLLETERGNIQNT 1361

Query: 1222 -------SVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL-------IADMTKEL 1267
                   +  SE   AL  QL+E    +K  E +   SV SS+++       I  +  EL
Sbjct: 1362 EEKFRQMNKQSEDVTALRSQLEEALLSSKEFENKFNASVKSSDEISSHLNDVIDSLNNEL 1421

Query: 1268 TTLKE--NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXX 1325
            T LKE  N         D ++ +E++K  FE+EK   ++  T+E  E+            
Sbjct: 1422 THLKESKNNEATVTGQPDLSNVVEEMKKSFEEEKIKFVQDQTTEFKEKLAEEVKRIEAQA 1481

Query: 1326 XXX-----------XXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRK 1374
                                         L+RIE+A+ENLK+ IRLPTEEKI  VI K+K
Sbjct: 1482 TDTQNKNVTPLQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKK 1541

Query: 1375 AQLEEQFQTKVAEQANLLKLSELSNKT-ADELEKEVREEIKTRLEEDFELLKKKAFEEGR 1433
             +LE+++  KV ++A  L LS   NKT  ++L+ ++++E++  ++++ +  K KAFEEG+
Sbjct: 1542 NELEKEYDEKVNQRAKEL-LSSEENKTFIEDLKNDIKKELERNIDQELKNAKAKAFEEGK 1600

Query: 1434 QQASMKTTLLERKIAKLEARLQGGTGPLKSANG--------------------------L 1467
            QQA MKTT LE+KI+KLE++LQG     ++ N                           L
Sbjct: 1601 QQAMMKTTFLEKKISKLESQLQGSNAANENKNDVEVLLKTPSDENNVPSKQEETLSKPQL 1660

Query: 1468 NKINIDSPLMVAGPLTNEPVLDEKPNAFAGAXXXXXXXXXXXXAKDSANAFSF------N 1521
            +KI I +PL+  G  T        P++                  DS+N F+       N
Sbjct: 1661 SKIQIANPLLSTGGTTLALNQSRAPSSLQNGS-------------DSSNPFTSPFQQTKN 1707

Query: 1522 AQKVPA--QPAFSSR--AQPAFSFGSFNKTSFSDLSHKNSVGAAS---GTPFRFGFASNP 1574
               +PA  QPAF  R  ++P  S  + ++ S S+ + ++ +  +S    TP     +S  
Sbjct: 1708 DANIPAVTQPAFLLREPSEPNMSVSTISRQSTSETNTESELPVSSEGLATP-----SSKR 1762

Query: 1575 PTPFQNTAENGTDA---KRKSQTE 1595
            P   ++T E   DA   K+KS+TE
Sbjct: 1763 PAQ-EDTEEEKLDAETPKKKSKTE 1785

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score =  281 bits (719), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 386/1460 (26%), Positives = 686/1460 (46%), Gaps = 188/1460 (12%)

Query: 152  DRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDF 211
            D+ +  IR +L+   S+ +  +  N  L    + +++ L +K    K+LSD LSS++ +F
Sbjct: 233  DKIILEIRNELNHLRSDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKSLSDCLSSEKQEF 292

Query: 212  ERELATRDKLNAVLKKQVNSLHSELGN--GGETP----AHAEPNDQFAKQSSQHEEEISN 265
              E+  + +L  +L+ Q+N++  EL +  G ET      H    +   K+    +EE++ 
Sbjct: 293  STEINLKQRLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQ 352

Query: 266  YKEQVEELLGILGQG-----------APSIAHXXXXXXXXXXXNVSLKKQMESFVIELEH 314
             K +   L  I+G+            +                   L+ Q+ESF++ELEH
Sbjct: 353  CKSECIRLSSIIGETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEH 412

Query: 315  RLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQ 374
            ++P +   +++   ++ +L+ A   +   S  K    RELS+  +K+         L  Q
Sbjct: 413  KVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQ 472

Query: 375  RSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTIIENENWDAYK-DSQRIVSDRLLRF 429
            R DL  Q+Q+LL  NS    S   L   E+ FI+ I++N++  A + DSQ+IV++RL+ F
Sbjct: 473  RLDLCRQVQYLLITNSVSKDSKGPLRKEEIMFIQNILQNDSDTATETDSQKIVTERLVEF 532

Query: 430  DNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQL 483
             +I ELQE+N +L+  VR+L D++ES E ++   L      T+  AK  I  L+    QL
Sbjct: 533  RSIIELQEKNTELLKIVRNLADRLESNENESKQSLQKIESETINEAKEAILTLKAEKEQL 592

Query: 484  ESEVKNWEALMETLK------DGDSLDSKI---NVTMVEQQKKIEELESKLTDVGESHVQ 534
            ES+V+  E   E  K      +   L+S I   N T    + +I++L+S ++ +     +
Sbjct: 593  ESKVEELEKECENSKALLSNEETSHLNSTIQQLNETKRNLECQIQDLQSNISQITRESTE 652

Query: 535  KINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKR-ENLSLTQQISTKQNE-- 591
             +++LNK I       ++ + +   ++K      S ++A +R + LS T  ++  +N+  
Sbjct: 653  NMSLLNKEIQ------DLYDSKSDISIKLGKEKSSRILAEERFKLLSNTLDLTKAENDQL 706

Query: 592  ---LDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEE---KTQMEQKQRSLF 645
                D L S   +++   Q  + E     +K    E   + L EE   K   EQ  +   
Sbjct: 707  RKRFDCLQSTILKQDSKTQETLNEYISCKSKLNICETELYNLKEEQKLKIDSEQNLKQEM 766

Query: 646  DKIQQESKKL----LQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDL 701
             K+  E   L     QL+T  KE E  +         + ++  +KI  L   +  L  + 
Sbjct: 767  QKLSSEKTGLRIMVTQLQTLQKERENLLD-------ETRKSYQNKIDELEHAHNELKGEA 819

Query: 702  AFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK-------NKSNKIIELNDKLRLLSEKS 754
            + K++ +KQ  E +   I+WYQ  I+ L + N+       +K  +I +L  K++ L ++ 
Sbjct: 820  SHKDQRIKQLEEDNNSSIEWYQNKIEVLKKDNESIICSMNDKQAEIEKLQHKVKSLEKEI 879

Query: 755  LSNK----PYPV--GT-ELKELQNELNGMKAALEVSESQATLYKDTLERN-------QNF 800
              NK     Y V  GT     L+ EL   K +L  + SQ   YK+  E N        + 
Sbjct: 880  DENKIRLHTYNVIDGTINDDSLRKELEKSKISLTDAYSQIQEYKELYETNAKSLKQMHSK 939

Query: 801  YNNSTLSFQNTISELQSKNEALSKQHETLQNQITETEN----QSKGIQLEHQTIIDRLTS 856
            +  S+  F N I  L ++  +L ++   L+ QI    N    Q+KG++            
Sbjct: 940  FEESSKDFSNRIKNLTNEKSSLEEKISLLKEQIFNLNNELDLQNKGMK-----------E 988

Query: 857  EKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS----DTRLNFESAL----- 907
            EK    +K++ L ++ +++  +K EY++++ KI+ +L  Q+      + N+E  L     
Sbjct: 989  EKAEFRKKISILQNNNKEVEAVKSEYESKLSKIQKDLDQQTIYANTAQNNYEQELQKHAD 1048

Query: 908  TSK-----EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLA 962
             SK      ++L +Y VQ+  L     +L S +       E  ++   +R +L ++L+ +
Sbjct: 1049 VSKTISELREQLHTYRVQVNTLTLSRNQLESTLK------ENERSWTSQRKALIEQLESS 1102

Query: 963  NQRIESLAAQNSILYDTFSGMRHVDADAEPNED---LRNLVINLRIERDMHQSQETTAQR 1019
            N RIE L +QN +LYD        D       D   L +++++LR ERD+  ++ T A+R
Sbjct: 1103 NSRIEDLTSQNKLLYDQIELYTTADKGVTDTNDKPALNSILLSLRRERDILDTKVTVAER 1162

Query: 1020 DVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYL 1079
            D K+L++ +  +  +L     ++D     E+   ++   HE IM +L  L   +E N+ L
Sbjct: 1163 DAKMLRQKISLMDIELQEARTKLDNSRLEEEKRPTIIQQHEDIMEKLNQLNLLRESNITL 1222

Query: 1080 DESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAI--SEQEWQQKIETYQQESEKWKLMC 1137
               +++ NE+KR LQ             +   +A+  S QE +Q++   ++E  +WK   
Sbjct: 1223 RNELENNNEEKRVLQSELDKLKQDIAPIESELAALKYSMQEKEQELRLTKEEVHRWKKRS 1282

Query: 1138 QQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKAT 1193
            Q + E     ++++ + L+ ++++ K  +  KT++  +  +RF RL++QA E+L  SK +
Sbjct: 1283 QDILEKHRQMSSSDYEKLEHEIDSLKVKLDEKTRQGAEAEERFNRLRRQAQERLKTSKLS 1342

Query: 1194 SDSLAIELSELKTVNDALQ----------EKLNNQETNSVDSESNAALILQLKEENKQAK 1243
             D+L  ++++LK     L+          E+L N +    +++ +A   LQ   EN  +K
Sbjct: 1343 LDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAEQDNNQLDAIKRLQQDAEN-SSK 1401

Query: 1244 SLELELRHSVDSSEKLIADMTKELTTLKE-----NPIQGSVNVE------DYTHRLEQLK 1292
              + +L       +  I  + +E+ TL+E       IQ  +  E      D +  +E +K
Sbjct: 1402 EFKTKLEEKATFYDSTIKKLNEEIITLREEIEKQRRIQQQLQSEPANEQNDLSKIVESMK 1461

Query: 1293 SEFEDEKRVLIEKTTSELTER-FERXXXXXXXXXXXXXXXXXXXXXXXXXXTLQRIEEAK 1351
              FE++K   I + T E+ E+  E                            + RI EA+
Sbjct: 1462 KTFEEDKINFIREKTKEVNEKILEAQERLNQPSNINIDELKIKWKAEHEEEVVNRIREAE 1521

Query: 1352 ENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL------------------- 1392
            E LKK IRLPTEEKI ++I +++  LE++F  KV E+  LL                   
Sbjct: 1522 EALKKRIRLPTEEKISKIIERKREDLEKEFDEKVEERIKLLSQSGQMDVTFQKQFEIRIQ 1581

Query: 1393 ------------KLSELSNKTA------DELEKEVREEIKTRLEEDFELLKKKAFEEGRQ 1434
                        KL ELS+  +      D+L  E+  +++  L+ + + +KKK+FEEG+Q
Sbjct: 1582 EKQKELEDKYNEKLKELSHSNSISIDERDQLRAEIETKMRKELDNELQHIKKKSFEEGKQ 1641

Query: 1435 QASMKTTLLERKIAKLEARL 1454
            QA MKTTLLERK+AK+E++L
Sbjct: 1642 QAMMKTTLLERKLAKMESQL 1661

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] {ON}
            some similarities with uniprot|Q02455 Saccharomyces
            cerevisiae YKR095W MLP1 Myosin-like protein associated
            with the nuclear envelope, connects the nuclear pore
            complex with the nuclear interior; involved in the Tel1p
            pathway that controls telomere length; involved in the
            retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score =  279 bits (714), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 376/1418 (26%), Positives = 676/1418 (47%), Gaps = 148/1418 (10%)

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360
            L++Q+ESF++ELE+++P +   +++   ++++L+     +   S  K + +RE  +  +K
Sbjct: 417  LQRQVESFIVELEYKIPVINSFKERTSMLEKELNDVALLLDHTSNEKEKREREFEALSKK 476

Query: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTIIENENWDAYK 416
            V       H L  QR+DLAHQ+QFLL   S    S  +L   E+SFIK I+ N++ ++  
Sbjct: 477  VKDSESSIHTLTRQRTDLAHQVQFLLMNISVQVDSGGLLSAEEVSFIKRIVNNDDPNSES 536

Query: 417  DSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAK 470
            DSQR++S+RL+ F+NI  LQE+NM+L+ TVR L +K+ES E D +  +      T++ AK
Sbjct: 537  DSQRVISERLVEFNNIATLQEKNMELLKTVRKLAEKLESEEKDVNKKIQTFENDTIKEAK 596

Query: 471  LQISKLEQSNAQLESEV----KNWEALMETL-KDGDSLDSKINVTMVE-------QQKKI 518
              I  L+  NA LES+V    K  +A      ++G   +  ++    +        ++K+
Sbjct: 597  EAIVSLQDYNANLESKVEILTKECDAFKAICSRNGSDQNGSLSANGTQGNRNGSSDEEKL 656

Query: 519  EELESKLTDVGESHVQKINVLNKTI-----DRNQSTINMLNEQIKNTVKSDMNAKSELIA 573
              LE++LT +     Q   +LN  I      + Q +I +  E+   T+  +   + +LI 
Sbjct: 657  RTLEARLTSLTVESSQNNKMLNNEIHELYRSKTQISIELEKERSSKTLTEE---RLKLIQ 713

Query: 574  -----CKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFH 628
                  + EN  L ++    Q+  D  +S++A+   +     ++L+V   K  + E    
Sbjct: 714  HTLELTRNENQQLVKRSQNLQSIFDRQDSRTAETVNELIACNSKLAVLETKVANLETEKE 773

Query: 629  LL-TEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKI 687
            LL + E+T  E      + K+ +E   L  + +   +L+   S +E   K  + T    +
Sbjct: 774  LLQSSERTSREN-----YLKLSEERNSLRIMVS---QLQTLQSEREKFLKEIQTTYKENL 825

Query: 688  TFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNID-------ELSEQNKNKSNKI 740
              L +E       L  K +E +        QI+WYQ  +D        L ++ + K+  +
Sbjct: 826  DSLEQEKADARARLDAKTKEAEDMENSKRTQIQWYQDKLDSVVAESQHLKQELQTKTFLV 885

Query: 741  IELNDKLRLL------SEKSLSNKPYPVGTELK-----ELQNELNGMKAALEVSESQATL 789
             +L  ++R L      SE  + +     G+E++      L+ EL   K  L  + ++   
Sbjct: 886  TDLESEVRKLEKQVEESEARIQSYQVLSGSEVETSPESSLRKELEKTKINLSDTYAEIDQ 945

Query: 790  YKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQT 849
            YK+ L   +   +  T  + +   ELQ + E L  +   LQ+ + +       ++   Q 
Sbjct: 946  YKNLLSTTEESLSQLTQDYASGKQELQLQVETLQNEKSQLQDVVAKLNESVTKLEESLQD 1005

Query: 850  IIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSD----TRLNFES 905
                  +EK  L++K+ +L    +   ++K EYDAQI K++ +L+ Q+      + N+E 
Sbjct: 1006 ANKAAENEKNTLQKKIATLETESKGSHQLKEEYDAQILKLQRDLEQQASFANRAQRNYEE 1065

Query: 906  AL---TSKEKELTSYAVQIEQLNTEIAKL-NSDIAALTEPAEARKTLIKERDSLGQELKL 961
             L   ++  K ++    Q ++    I +L NS+        +  K+   +++   ++L+ 
Sbjct: 1066 ELQKDSNVSKTISELREQSQKDRIAITRLKNSEEQVRQVLEQNEKSWSAQKEEYERQLET 1125

Query: 962  ANQRIESLAAQNSILYDTFSGMRHVDADAEPNE--DLRNLVINLRIERDMHQSQETTAQR 1019
            + Q +E L+ QNS+LYD        ++D    E  ++R ++ NLR ERD+  ++ T +QR
Sbjct: 1126 SRQHLEDLSTQNSLLYDQIELFSKDNSDGVNGETAEVREILTNLRRERDILGTKLTVSQR 1185

Query: 1020 DVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYL 1079
            + + L+ +L  +  +L  T  ++ +          L   HEKI+ +L  L   +E N+ L
Sbjct: 1186 EEQTLRGSLASVENELDTTKRQLSQFQKEITTHSELIGQHEKIIEQLNQLNLLRESNITL 1245

Query: 1080 DESIKSLNEDKRTLQXXXXXXXXXX--XXAKKNSSAISEQEWQQKIETYQQESEKWKLMC 1137
              + +  N+  R LQ              ++ N+   S  E  Q++  Y++E+ +WK   
Sbjct: 1246 RNAAEEENKKNRELQEELNQLRERILPLESELNTLHTSVLEKDQQLNLYKEEANRWKERS 1305

Query: 1138 QQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKAT 1193
            Q++          + + L++++   +  +    +EN +L+DRF RLKKQAHEKLN+SK  
Sbjct: 1306 QEILHKHDRIDPEDHKELKEKVSILETKLDETNKENKELDDRFNRLKKQAHEKLNSSKIA 1365

Query: 1194 SDSLAIELSELKTVNDALQEKLNNQE-----------TNSVDSESNAALILQLKEENKQA 1242
              +L+ +L+EL+     L+ K   +E            +  D+E+  ++  +L +  + +
Sbjct: 1366 QTTLSNQLNELREAKSELEGKFEAEERKVHELQERLNAHGNDTETVESVQKELSDALEHS 1425

Query: 1243 KSLELELRHSVDSSEKL-------IADMTKELTTLKENP---IQGSVNVEDYTHRLEQLK 1292
            + LE  L  ++  +E++       I  +  EL +LKE      +G ++ ED ++ +E ++
Sbjct: 1426 RELEQNLSATLQQNEEITKKLNDEIDSLKLELHSLKEQSAATAKGEIS-EDLSNVVESMR 1484

Query: 1293 SEFEDEK------RVLIEKTTSELTERFERXXXXXXXXXXXXXXXXXXXXXXXXXXTLQR 1346
              FE+EK      +    K   E     +                            L+R
Sbjct: 1485 RSFEEEKINFLKEKTEELKKLEEEKHTLQVNGNEPQQQPVNYEEIKRQWESEQEESILKR 1544

Query: 1347 IEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADELE 1406
            I EA+ENLKK IRLPTEE+I++V+ K+KA LEE ++ K+ E  + L+ S+ +N    +L+
Sbjct: 1545 IAEAEENLKKRIRLPTEERIKQVVEKKKAALEELYKKKLEESKSSLESSDGNN---SDLK 1601

Query: 1407 KEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGT-GPLKSA- 1464
            K++ ++++ + E + + +KKKAFEEG+QQA+MK+TLLERKI+KLE++L G    P KS+ 
Sbjct: 1602 KQLEKDLQEKFEAEVQAVKKKAFEEGKQQAAMKSTLLERKISKLESQLHGKVDSPDKSSS 1661

Query: 1465 --NGLNKINIDSPL---------MVAGPL-TNEPVLDEKP-------NAFAGAXXXXXXX 1505
              + + K N+ S +          V  PL + E VL   P       ++F+G        
Sbjct: 1662 ETSSVPKPNLPSKIDEKSVTTNQSVPNPLVSGEKVLKLDPSKPTFNFSSFSGGNPFTSSP 1721

Query: 1506 XXXXXAKDSANAF------SFNAQKVPAQPAFSSRAQ--PAFSFGSFNKTSFSDLSHKNS 1557
                    SA  F      S N+ K       SS  +  PA  F SF +T  S    ++S
Sbjct: 1722 QNNDTMGTSAFGFKPTFTLSNNSNKSSGTKIDSSSTENKPANPFSSFTETGASSPERESS 1781

Query: 1558 VGAASGTPFRFGFASNPPTPFQNTAEN-----GTDAKR 1590
              A + TP          TP +  AE+     G+++K+
Sbjct: 1782 NTAMTPTP-----GEGASTPSKRAAEDDDNEVGSESKK 1814

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score =  271 bits (694), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 378/1382 (27%), Positives = 658/1382 (47%), Gaps = 158/1382 (11%)

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360
            L+ Q+ESFVIELEH++P +   +++   ++++L      +   +K       EL S ++K
Sbjct: 412  LQNQVESFVIELEHKIPVINSFQERTSVLEKELTDTALLLEHATKENELKTNELQSLKKK 471

Query: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLT----VNSSDTVLPPSELSFIKTIIENENWDAYK 416
            +   N     L  QR+DLAHQ+Q+LL     +N +D +L   E+ FIK ++ N+N  +  
Sbjct: 472  ISDDNSQLEILLRQRTDLAHQLQYLLINISIINDNDHLLNEDEIKFIKNLVSNDNMASTN 531

Query: 417  DSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWE----------ADNDSGLTL 466
            DSQ+++S+ L++F +I +LQE+NM+LV TVR+L  ++E  E           D D+ +  
Sbjct: 532  DSQKVISEHLIKFKDIQQLQEKNMELVKTVRTLAQQLEENEEKKKSTSNNTVDEDNEIFA 591

Query: 467  EAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELES--- 523
            EA K  I  LE+ N  LE  ++      +  K   S D + N        K  EL+S   
Sbjct: 592  EA-KEAILTLEKVNENLEKNLQIVTKERDAFKLLVSEDRERNFKSSNSVHKYHELKSYNE 650

Query: 524  -----------KLTDVGESH----VQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAK 568
                       +LT+   +H     +++N+L+K I +       LN QI+       +AK
Sbjct: 651  TVVKDLENRLTQLTNDSNAHSKALTEELNLLHKEISQ-------LNVQIEKY----RSAK 699

Query: 569  SELIACKRENLSLTQ---QISTKQNELDELNSKSA-------QKERDYQLKIAELSVAAN 618
            S       E L +TQ   ++ +K+NE  +L  +S+       Q++++ Q   +    A +
Sbjct: 700  S----LAEERLKITQNSMELLSKENE--QLRIRSSRLEDSLLQQDKETQKTFSSYVEAIS 753

Query: 619  KCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKR 678
            K  S E S   L  E T ++ ++ SL  ++   +++  +L     +L+   S +E   +R
Sbjct: 754  KNSSLETSVRNLETEVTLLKDREISLKSELSNTTEEKTKLRIMVTQLQSLQSERETLLER 813

Query: 679  SEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSN 738
             +     +I+ ++  N+ L   L+ +  E+ +  ++   Q +WYQ+ IDE S+Q +    
Sbjct: 814  VQSDFKKRISEVNYINEKLDKQLSERVHEIDKIEKERNAQYEWYQKKIDEASQQQQQIQG 873

Query: 739  KIIELNDKLRLLS------EKSLSNKPYPVGTELKELQN-----ELNGMKAALEVSESQA 787
            ++   ND+L  L       EK L      + T     QN     E N +   LE ++ + 
Sbjct: 874  QLQTKNDELERLHLQNKTLEKELEGAQIRIHTYETINQNNSENQEENDVIKELEKTKIEL 933

Query: 788  TLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEH 847
                  LE  +N   NS  + +   +   +K+       +TL  + TE E + + ++ + 
Sbjct: 934  ADAYSQLEEFKNLSQNSEDALKELNASFNAKDRDYRDAIKTLTEEKTEIEGRFEILKQQL 993

Query: 848  QTIIDRLT-------SEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTR 900
            + I + LT       SE+  L + +  L  + + I E+K  ++ ++QK+E++L+ Q+   
Sbjct: 994  ENIKNELTVQSEEAESERKRLTQTIAELQGAAQPIEEVKKMFEEKLQKLENDLEEQT--- 1050

Query: 901  LNFESALTSKEKELTSYA---VQIEQLNTEIAKLNSDIAALT--------EPAEARKTLI 949
            +   +A  + E+EL  +A     I +L  +  +L +D  +LT        + ++  K L 
Sbjct: 1051 VYANNAQKNYEQELQRHADVSKTISELREQNQRLKNDTKSLTAELQSLQDQMSQNEKHLK 1110

Query: 950  KERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINLR 1004
             ERD    ++ LA QRI+ +  QN +LY+    +   ++  E + D        LV++LR
Sbjct: 1111 SERDEYRIQIDLAQQRIDDITKQNQLLYNQIDLLNRAESVNENSSDDEANGSTALVLSLR 1170

Query: 1005 IERDMHQSQETTAQRDVKLLKKNLKEITEKLAIT--CPEIDEPTNTEKDDFSLTVTHEKI 1062
             ERD+  ++    + +   L++ L +I  +L  T     + E   +E  D  L   ++ I
Sbjct: 1171 RERDILDTKINVIETEKNSLQQKLDDIQNELENTKRSAALLESEYSEHSD--LINNYQTI 1228

Query: 1063 MRELEGLTNTKEENLYLDESIK-SLNE-DK--RTLQXXXXXXXXXXXXAKKNSSAISEQE 1118
              +LE L   +E N+ L   +K +L+E DK  + LQ             +  ++ I E++
Sbjct: 1229 RGDLEQLNLLRESNVTLRNELKQALDEKDKIAKDLQICRNELLPLQSNLESANNLIKEKD 1288

Query: 1119 WQQKIETYQQESEKWKLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLND 1174
               KI +   ES++WK   ++M E        +   L++ L   K  +  K QE ++LND
Sbjct: 1289 L--KIASANDESQRWKTRLEEMIEKHQKVNVDDYTKLEETLNETKQLLDNKVQETNELND 1346

Query: 1175 RFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQ 1234
            RF RLKKQAHEKLN SK    SL  ++S L +  D ++++L+      V +E N+ L+ +
Sbjct: 1347 RFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQLD------VKTEENSELLSE 1400

Query: 1235 L--------------KEENKQ---AKSLELELRHSVDSSE-------KLIADMTKELTTL 1270
            L              +E NK+   ++ LE++L++ ++SS        K I ++ K +  L
Sbjct: 1401 LNNFREKQNDLETLREELNKEISKSEELEVKLQNEIESSSLASRNTNKEIEELQKVIDDL 1460

Query: 1271 KENPIQGSVNVEDYTHR-LEQLKSEFEDEKRVLIEKTTSELTER-----------FERXX 1318
            K      S + ++ T+R +E +K EFE++K   I + T E  +R           F+   
Sbjct: 1461 KTQLAANSTDADEQTNRNVEAIKREFENQKTKFIAEKTEEFNKRLIEETEKIRNEFQENE 1520

Query: 1319 XXXXXXXXXXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLE 1378
                                      +RI EA++NLKK IRLP+EEKI ++I KR+++LE
Sbjct: 1521 KPDTELNVDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELE 1580

Query: 1379 EQFQTKVAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASM 1438
             +F  K+ ++A  L +++ SN+  +EL++ + +E+K R E++ +  +KKAFEEG+QQA+M
Sbjct: 1581 SEFDQKIRDKARDLLMNDHSNEFNNELKEALEKELKERFEDELQAARKKAFEEGKQQATM 1640

Query: 1439 KTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGA 1498
            KTTLLERKI KLE+++Q      +    +      +P +   P T    L+    +F  +
Sbjct: 1641 KTTLLERKIQKLESQIQEKEKDSEETQDVKPEENSTPSVKKIPET----LNSSDTSFGNS 1696

Query: 1499 XXXXXXXXXXXXAKDSANAFSFNAQKVPAQPAFSSRAQPAF-SFGSFNKTSFSDLSHKNS 1557
                           SA    F        PAF+S   P F    S      S+LS    
Sbjct: 1697 NNVKVLKPSSPFGATSAFNNPFTFNNNGNPPAFASAFAPTFKDLMSGQGGQQSELSQNKR 1756

Query: 1558 VG 1559
            VG
Sbjct: 1757 VG 1758

>Skud_11.334 Chr11 (601335..606992) [5658 bp, 1885 aa] {ON} YKR095W
            (REAL)
          Length = 1885

 Score =  271 bits (692), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 398/1554 (25%), Positives = 733/1554 (47%), Gaps = 187/1554 (12%)

Query: 85   ANAELRSAREQVVELRQRLGESETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKK 144
             N E R+ R  VVEL  +     T    S  + +R +++L   +   +     L   +++
Sbjct: 165  TNNECRNLRSTVVELETKQQTYITNDLNSRSELERKTQELNLLQSNKDWLEKELSSKSEQ 224

Query: 145  LLDF-QRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQ 203
             L + QR D  +  IR +L++  ++ +  + +N  L      ++  L +K    K LSD 
Sbjct: 225  YLSYRQRTDATISEIRSELNRLKNDFQLEKTNNDVLKQKNNELSNSLQEKVLDLKNLSDS 284

Query: 204  LSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEE-- 261
            L++++ +F  E+A + +L  +L+ Q+N++  EL +  ++ +    +D   K  S++E   
Sbjct: 285  LNTEKQEFSTEIALKQRLIDLLETQLNAVKEELKSIRKSDSSNVTSDDSRKLISENESLL 344

Query: 262  ------------------EISNYKEQVEELLGIL-GQGAPSIAHXXXXXXXXXXXNVSLK 302
                               +S+  E+  E  G L  + +                   L+
Sbjct: 345  KDLRLTKEKLAQCESECLRLSSITEETGEESGTLTSRSSTDFILLKKQYIKEKRAKEQLQ 404

Query: 303  KQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVD 362
             Q+ESF++ELEH++P +   +++   ++ +L+ +   +   S  K    REL+   +K+ 
Sbjct: 405  NQIESFIVELEHKVPVINSFKERTDMLENELNNSALLLEHTSNEKNAKIRELNIKNEKIA 464

Query: 363  HLNQIFHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTIIENENWDAYK-D 417
                  H L  QR DL  Q+Q+LL  NS    S   L   E+ FI+ I++N+N    + D
Sbjct: 465  KCENDIHILTRQRLDLCRQVQYLLITNSVSNDSKGPLRKEEIKFIQNILQNDNSGTTESD 524

Query: 418  SQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKL 471
            SQ+I++ RL+ F N+ ELQE+N +L+   R+L DK+ES E  +   L      T+  AK 
Sbjct: 525  SQKILTGRLVEFRNVIELQEKNTELLRITRNLADKLESNEIKSKQNLLKIENKTINEAKE 584

Query: 472  QISKLEQSNAQLESEVKNWEALMETLKDGDSLD-SKINVTMVEQ--------QKKIEELE 522
             I  L+     LES+V+  E   ETLK   S   S  N ++++Q        + ++++L+
Sbjct: 585  AILSLQSEKMSLESKVEELERERETLKSSISKQASSFNNSVIQQLTKTKRELESQVQDLQ 644

Query: 523  SKLTDVGESHVQKINVLNKTIDR---NQSTINM-LNEQIKNTVKSDMNAK---SELIACK 575
            ++++ +     Q +++LNK I     ++S I++ L ++  + + ++   K   + L   K
Sbjct: 645  ARISQITRESTQNMSLLNKEIQDIYDSKSDISIELGKEKSSRILAEERFKLLSNTLDLTK 704

Query: 576  RENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKT 635
             EN  L ++  + Q+ + + +SK+ +   +Y    ++LSV         ++  L  + K 
Sbjct: 705  AENDQLRKRSDSLQSSISKQDSKTHETLNEYISCKSKLSVTETAL----SNLKLEQKLKI 760

Query: 636  QMEQKQRSLFDKIQQESKKL----LQLETRNKELEVKISGKELHRKRSEETLSSKITFLS 691
              E+  +   DK+  E   L     QL+T  KE E  +         + ++  +KI  + 
Sbjct: 761  DSEKSLKQELDKLSSEKTSLRIMVTQLQTLQKEREDLLD-------EARKSCQNKINEVE 813

Query: 692  EENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN-------KSNKIIELN 744
            E    L  + + K++ + Q  E +  +I+WYQ  I+ L + N +       K  +I +L 
Sbjct: 814  EAYNELKVETSHKDQHIMQLEEDNTSKIEWYQNKIETLKKDNDSVMNLVNEKQTEIEKLQ 873

Query: 745  DKLRLLSEKSLSNK----PYPVGTEL---KELQNELNGMKAALEVSESQATLYKDTLERN 797
             K++ L ++   NK     Y V  E      L+ EL   K  L  + SQ   YK      
Sbjct: 874  YKVKSLEKEIEENKIRLHTYNVMDETINDDSLRKELEMSKINLTEAYSQIQEYK------ 927

Query: 798  QNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSE 857
               Y ++  S +   S+L   NEA S Q ++L ++    E++   ++ +   + + L  +
Sbjct: 928  -KLYESTAQSLREMNSKLDESNEAFSNQIQSLTDEKINLEDKVSLLKEQSFNLNNELDLQ 986

Query: 858  KTALEEK-------LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSK 910
            K  +E+K       +  L ++ ++I  +K EY++++ KI+ +L  Q+   +   +A  + 
Sbjct: 987  KNEMEKKKVEFKKIIAILQNNNKEIETVKSEYESKLSKIQDDLDQQT---IYANTAQNNY 1043

Query: 911  EKELTSYA---VQIEQLNTEIAKLNSDIAALTEPAEARKTLIKE--------RDSLGQEL 959
            E+EL  +A     I +L  ++      +  LT      + ++KE        + SL ++L
Sbjct: 1044 EQELQKHADVSKTISELREQLHTYRGQVKTLTLSRSELENILKENEKSWTSQKQSLLEQL 1103

Query: 960  KLANQRIESLAAQNSILYD---TFSGMRHVDADAEPNEDLRN-LVINLRIERDMHQSQET 1015
             L+N RIE L++QN +LY+    ++   +   DA     L N +++ LR ERD+  ++ T
Sbjct: 1104 DLSNSRIEDLSSQNKLLYNQIELYTAAGNGVGDARNGPTLNNDILVTLRRERDILDTKVT 1163

Query: 1016 TAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEE 1075
             A+RD K+L++ +  +  +L     +++       +  S+   H+ IM +L  L   +E 
Sbjct: 1164 VAERDAKMLRQKITLMDVELQDARTKLNNSRVENDERSSIVQQHDVIMEKLNQLNLLRES 1223

Query: 1076 NLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAI--SEQEWQQKIETYQQESEKW 1133
            N+ L   +++ ++  + LQ             +   SA+  S QE +Q+I   ++E  +W
Sbjct: 1224 NITLRNELENCSKKNKELQSELVKLKEIIAPIESELSALKYSMQEKEQEIRLAKEEVHRW 1283

Query: 1134 KLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNA 1189
            K   Q + E     ++ + + L+ ++E+ KA ++ K Q+  +  +RF RL++QA EKL  
Sbjct: 1284 KKRSQDILEKHQQLSSNDYEKLESEVESLKAQLEDKMQQGTEAEERFNRLRRQAQEKLKT 1343

Query: 1190 SKATSDSLAIELSELKTVNDALQEKLNNQETN-------SVDSESNAALILQLKEENKQA 1242
            SK T ++L  +L+ELK    AL+  LN+  T         V  ++N + +++  +E+ + 
Sbjct: 1344 SKLTQETLTEQLNELKDAKVALERSLNDANTRIQELEGEKVAEDNNRSEMIKRSQEDAEK 1403

Query: 1243 KSLELE--LRHSVDSSEKLIADMTKELTTLKE-----NPIQGSVNV------EDYTHRLE 1289
             S ELE  L  +  S    +  + +E+ TLKE       IQ  +        ED ++ +E
Sbjct: 1404 SSRELEEKLEENAISYSSTVRKLNEEIATLKEEIEKQGQIQKQLQTAAGHRDEDLSNIVE 1463

Query: 1290 QLKSEFEDEKRVLIEKTTSELTERF-ERXXXXXXXXXXXXXXXXXXXXXXXXXXTLQRIE 1348
             +K  FE++K   IE+ T E+ ++  E                             +R+ 
Sbjct: 1464 SMKKSFEEDKIKFIEEKTREVNKKIQEAQERLNQPSSVNIDEMKKQWEAEHEEEVAERVR 1523

Query: 1349 EAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL---------------- 1392
            EA+E LKK IRLPTEEKI ++I ++K  LE++F  K+ E+   +                
Sbjct: 1524 EAEEALKKRIRLPTEEKISKIIERKKEDLEKEFNEKLEEKVKSISGSEQMEAMLQKQLEI 1583

Query: 1393 -------------------KLSELSNKTA------DELEKEVREEIKTRLEEDFELLKKK 1427
                               KL E+S+ ++      DEL  E+  +++  L ++ + +KKK
Sbjct: 1584 RVQEKQKELEDEYNEKLQEKLKEVSHSSSISVNEKDELRAEIEAKLREELNDELQNVKKK 1643

Query: 1428 AFEEGRQQASMKTTLLERKIAKLEARL----QGGTGPLKSANGLNKINIDSPLM 1477
            +FEEG+QQA+MKTTLLERK+AK+E++L    Q    P K AN     N+ +PL+
Sbjct: 1644 SFEEGKQQATMKTTLLERKLAKMESQLSEIKQSAESPPKHAN-----NVPNPLL 1692

>Suva_11.331 Chr11 (604552..610248) [5697 bp, 1898 aa] {ON} YKR095W
            (REAL)
          Length = 1898

 Score =  264 bits (675), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 394/1554 (25%), Positives = 726/1554 (46%), Gaps = 206/1554 (13%)

Query: 75   LDTVQSSVSTANAELRSAREQVVELRQRLGESETQRFQSELQRDRLSEQLKQGERYINAT 134
            L+ V+++ + +++E +  R  ++EL  +     +    S+ Q +R +++L   +   +  
Sbjct: 155  LEMVKAASNHSDSECKKLRSTILELETKQQTYISNDLNSKSQLERRTQELNLLQSNKDWL 214

Query: 135  NGRLLESTKKLLDF-QRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDK 193
               L    ++ L + Q+ +  +  IR  L++  ++ +  + +N  L      ++++L +K
Sbjct: 215  EKELSSKNQQYLSYRQKTNTIISEIRNDLNRIRNDFQLEKTNNDVLRQKNNELSKDLQEK 274

Query: 194  AALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFA 253
                KTLSD  +S++ DF  E+  + +L  +L+ Q+N++  EL N  E+  +++ N   +
Sbjct: 275  LLQIKTLSDSSNSEKRDFSAEITLKQRLIDLLESQLNAVKEELNNTRES-NYSDVNSDDS 333

Query: 254  KQSSQHEEEI---------------------SNYKEQVEELLGIL-GQGAPSIAHXXXXX 291
            KQ     E++                     S+  E+  +  GIL  +            
Sbjct: 334  KQLISENEKLLKDLQLTKHKLVQCENECLRLSSITEEAGKEDGILTSKSNGDFILLKKQL 393

Query: 292  XXXXXXNVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQ 351
                     L+ Q+ESF++ELEH++P +   +++   ++ +L+ A   +   S  K    
Sbjct: 394  IKEKRAKEHLQNQIESFIVELEHKVPIINSFKERTDTLENELNNAALLLEHTSNEKNAKI 453

Query: 352  RELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTII 407
            +EL    +K+       H L  QR DL  QIQ+LL  NS    S   L   E+ FI+ I+
Sbjct: 454  KELKVKNEKLAEYKDEIHILSKQRLDLCRQIQYLLVTNSVSNDSKGPLRKEEIKFIQNIL 513

Query: 408  ENENWDAYK-DSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL-- 464
            +N++    + DSQ+IV++RL+ F +I +LQE+N +L+   R+L DK+ES E  + + L  
Sbjct: 514  QNDDSATTESDSQKIVTERLVEFRDIIQLQEKNSELLRVTRNLADKLESNENKSKNYLKN 573

Query: 465  ----TLEAAKLQISKLEQSNAQLESEV----------KNWEALMETLKDGDSLDSKINVT 510
                T+  AK  I  L+    QLES++          KNW    ET    +S+  ++  T
Sbjct: 574  IENETINEAKEAILTLQSQKVQLESKIHELEKEREKFKNWTMDQET-SPNNSVIQQLTET 632

Query: 511  MVEQQKKIEELESKLTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAK-- 568
              E + + ++L+++++ V     + +++LNK +     + + L+ ++     S + A+  
Sbjct: 633  KRELESQTQDLQARISQVTRESTENMSLLNKELQDLYDSKSSLSIELGREKSSRILAEER 692

Query: 569  -----SELIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSW 623
                 + L   K EN  L ++    QN + + +SK+ +   DY    ++LS    +  + 
Sbjct: 693  FKLLSNTLDLAKAENDQLRKRSINLQNAISKQDSKTQETLNDYVSCKSKLSAIETELSNL 752

Query: 624  ENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETL 683
            +    L  E +  ++Q+   L  +       + QL+T  KE E  +         ++++ 
Sbjct: 753  KLERTLKIELEKNLKQELSELSSEKTSLHIMVTQLQTLQKERENLLD-------ETKKSC 805

Query: 684  SSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIEL 743
             +KI  L      L  +   K++ +KQ  E ++ +I+WYQ  I+ L    K+  + +  L
Sbjct: 806  QNKIDALQNAQNELKTEAIRKDQYIKQLEEDNDSKIEWYQNKIETLR---KDHESVMSSL 862

Query: 744  NDK----------LRLLSEKSLSNK----PYPVGTEL---KELQNELNGMKAALEVSESQ 786
            N+K          ++ L ++   NK     Y V  E      L+ EL   K  L  + SQ
Sbjct: 863  NEKQIEVERFQYEIKSLEKEIEENKIRLHTYNVLDESINDDSLRRELEKSKINLTDAYSQ 922

Query: 787  ATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLE 846
               YK         Y  +  S Q   S+L   N+A S Q + L ++ T  E++   ++ +
Sbjct: 923  IQEYK-------KLYETTDKSLQEMSSQLDESNKAFSNQIQNLTDEKTSLEDKVSLLREQ 975

Query: 847  HQTIIDRLTSEKTALEEK-------LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS-- 897
               + + L  +  A+E++       ++ L ++ ++I  +K EY++++ KI+ +L  Q+  
Sbjct: 976  MSNLNNELDLQNQAMEKEKAEFKKKISILQNNNKEIEAVKTEYESKLSKIQKDLDQQTIY 1035

Query: 898  --DTRLNFESAL-----TSK-----EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEAR 945
                + N+E  L      SK      ++L +Y  Q+E LN    +      AL E     
Sbjct: 1036 ANTAQNNYEQELQKHADVSKTISELREQLHTYKGQVETLNLARGQFE---KALKENETNW 1092

Query: 946  KTLIKERDSLGQELKLANQRIESLAAQNSILYD-----TFSGMRHVDADAEP--NEDLRN 998
             +   +++SL ++L L+N RIE L++QN +LYD     T +G +  DA +    N D+  
Sbjct: 1093 NS---QKESLLEQLDLSNSRIEDLSSQNKLLYDQIELYTTTGNKPTDAKSGSVLNNDI-- 1147

Query: 999  LVINLRIERDMHQSQETTAQRDVKLLKKNLK----EITEKLAITCPEIDEPTNTEKDDFS 1054
             +I LR ERD+  ++   A+RD K+L++ +     E+ E     C   +     EK  F 
Sbjct: 1148 -LITLRRERDILDTKVAVAERDAKMLRQKISLIDVELQEARTKLC---NSKVENEKRSF- 1202

Query: 1055 LTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAI 1114
            +   H+++M +L  L   +E N  L   + S N   + LQ             +   +A+
Sbjct: 1203 IIQQHDEVMEKLNQLNLLRESNTTLRNELDSSNSKNKELQSELERLRGNIAPIESELAAL 1262

Query: 1115 --SEQEWQQKIETYQQESEKWKLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQE 1168
              S QE +Q+I   ++E  +WK   Q + E     ++T+ + L+ ++E+ KA ++ KTQ+
Sbjct: 1263 KFSIQEKEQEIRLTKEEVHRWKKRSQDIMEKHQQLSSTDYEKLETEIESLKAQLEDKTQQ 1322

Query: 1169 NDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNN--------QET 1220
              D  ++F RL++QA EKL ASK + DS   +L+ELK    AL++ LNN        ++ 
Sbjct: 1323 GADSEEKFNRLRRQAQEKLKASKLSQDSFIEQLNELKDAKLALEKSLNNANARIQELEDA 1382

Query: 1221 NSVDSESNAALILQLKEENKQ-AKSLELELRHSVDSSEKLIADMTKELTTLKE------- 1272
               ++ +  ++I +L+E+ ++ +K LE +L  +  S +  +  + +E+  LKE       
Sbjct: 1383 KVAENRNQLSMIKKLQEDTEENSKELETKLEENAISYDSTVKKLNEEIGILKEELEKQRQ 1442

Query: 1273 ----NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXXX-- 1326
                         +D +  +E +K  FE++K   IE+ T E+ ++               
Sbjct: 1443 IQQQFQAAAGTEQDDLSKVVESMKRSFEEDKIKFIEEKTREVNQKIREFQEAQEAEETGL 1502

Query: 1327 -----XXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQF 1381
                                   ++I EA+E LKK IRLPTEEKI ++I ++K  LE++F
Sbjct: 1503 KPSNINIDEIKKQWEAEHNEEVSKKIREAEEALKKRIRLPTEEKISKIIERKKEDLEKEF 1562

Query: 1382 QTKVAEQANLL--------------------KLSELSNKTADELEKEVRE---------- 1411
              KV E+   +                    K  EL N+   +L++++RE          
Sbjct: 1563 DEKVEERLKSISQSGKMEDIFQKQLESRIQEKQKELENEYNKKLQEKLRELPSSDIISSD 1622

Query: 1412 -------EIKTRLEEDF----ELLKKKAFEEGRQQASMKTTLLERKIAKLEARL 1454
                   +I+ +L E+F    + +KKK+FEEG+QQA MKTTLLERK+AK+E++L
Sbjct: 1623 DKDKLRADIEAQLREEFNHELQTIKKKSFEEGKQQAMMKTTLLERKLAKMESQL 1676

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
            YIL149C (MLP2)
          Length = 1758

 Score =  253 bits (647), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 410/1595 (25%), Positives = 712/1595 (44%), Gaps = 285/1595 (17%)

Query: 105  ESETQRFQSELQRDR---------LSEQLKQGERYINATNGRLLESTKKLLDFQRDDRQV 155
            ++E QR Q EL   R         L+E+ +Q   Y   TNG          + Q    ++
Sbjct: 185  QAEIQRLQQELALVRSNAEWTTGQLNEKNQQLNSYREKTNG----------EIQSTQVEL 234

Query: 156  GVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFEREL 215
             +++ +L+   + + ALR  N  L       +++L D     K L+D L S++ +F RE+
Sbjct: 235  NIVKNELEVEHANVAALRSKNGEL-------SKQLQDALCETKRLTDSLHSEKQEFAREM 287

Query: 216  ATRDKLNAVLKKQVNSLHSEL-------GNGGETPAHAEP--NDQF--AKQSSQHEEEIS 264
            A + +L  +L  QV ++  +L        NGG + +  E   ND F   K+    +  +S
Sbjct: 288  ALKQRLIELLNGQVATMKQDLEKAYDVAKNGGMSDSERERLLNDLFDTKKKLELSQANVS 347

Query: 265  NYKEQVEELL-----------GI--LGQGAPS-----------IAHXXXXXXXXXXXNVS 300
              ++ ++ELL           GI     G+PS           +A               
Sbjct: 348  RLEDTIKELLETDNVQSGGRNGIEHANVGSPSGGSTISTVYGDLAALRKQLVQERRHKEE 407

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQR--ELSSSR 358
            L+ Q+ESFV+ELEH++P L   +K+ +E++++L+  T  ++ E+ A+ R ++  ++   +
Sbjct: 408  LQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVT--LLLEATARERDEKVVQIKQYK 465

Query: 359  QKV-DHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWD 413
             KV D+  Q+ H L  QRSDLA Q+Q LL      + S   L   E+ F+K +    +  
Sbjct: 466  NKVGDYETQVGH-LVQQRSDLARQVQCLLIHISVRDDSSGPLTAEEVEFVKKLQSCRDSA 524

Query: 414  AYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLE 467
               D+Q I+S+RL+ F ++ ELQ++N +L++ +R L  K+E  E    S +      T+ 
Sbjct: 525  TGSDTQAIISNRLVEFKSVVELQQKNAELLNAIRQLAQKLEQEEHKTQSKVKSLEQNTVN 584

Query: 468  AAKLQISKLEQSNAQLESEVKNWEALMETLK------DGDSLDSKINVTMVEQQK---KI 518
             AK  I  L++    LE +++      ++ K        +SL + +    ++ Q+    I
Sbjct: 585  EAKEAILSLQEHVQMLEDQLETVTTERDSFKLLVSEGKNNSLPNPVGAAALQPQEVADGI 644

Query: 519  EELESKLTDVGESHVQKINVLNKTI--------------DRNQSTINMLNEQIKNTVKSD 564
              LE++L  + E   Q   +LN+ I              +R +S+  + +E++    KS 
Sbjct: 645  AHLEARLKAMAEESEQHAKMLNEEIKALYKSNSQLAIELERERSSRELADEKLSLIQKS- 703

Query: 565  MNAKSELIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWE 624
                  L   K EN  L       QN    L +   +++   Q  I E   A ++  S  
Sbjct: 704  ------LELVKGENADL-------QNRAGSLQALLLEQDTRRQSTIEEFVSAKSELFSIS 750

Query: 625  NSFHLLTEEKTQMEQKQRSLFDKIQQESKK---------------LLQLETRNKELEVKI 669
            +   +L        Q +R    K++ + KK               +LQL+T  KE +  I
Sbjct: 751  SQLTIL--------QSERDFLRKVEADLKKENESLNKDNNDSQLLILQLKTAQKERDSLI 802

Query: 670  SGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDEL 729
               E  RKR E    ++I  L  E  +    L  K+ E  +    S  Q KW+Q  +D L
Sbjct: 803  ---EETRKRYE----TRIEELDGELSATKQQLERKQREYDELSSSSSTQCKWFQSKLDSL 855

Query: 730  SEQ-------NKNKSNKIIELNDKLRLLSEK------------------------SLSNK 758
             E+        K K++++  L  +L   + K                        SLS  
Sbjct: 856  KEELGSSKLALKAKTSELDALKARLNSSTSKLEPASMDHQQSSLVLESDHASRVQSLSKD 915

Query: 759  PYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSK 818
                  +L    +E+   KAA   +E  +  Y + ++ N++    + +S +  +++L S 
Sbjct: 916  LDEANRKLSSAYSEIERYKAASNATERPSLSY-NAVQDNKDGSKQAAISLEAELTKLNSD 974

Query: 819  NEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEM 878
                + + + L++++   E                 ++E++ L+EK+N+L   +++I E 
Sbjct: 975  IAMANDRIKVLEDELNRREAT--------------YSTERSELQEKINALVTDKQRIEEA 1020

Query: 879  KGEYDAQIQKIESNLKIQ----SDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSD 934
            K +Y  +I +++++L+ Q    ++    +++AL  K+ E++     IE L        S+
Sbjct: 1021 KADYQQKITQLQTDLEKQISSTNEAETKYQTAL-QKQAEISE---NIESLRKSSESYKSE 1076

Query: 935  IAALTEPA-EARKTLIKERDSLGQE-------LKLANQRIESLAAQNSILYDTF-----S 981
            IA     A EARK L +   +  Q+       L LA+QRIE L+ QN +LYD       S
Sbjct: 1077 IAKFKSAAEEARKVLERNEQTWDQQKADIEANLDLAHQRIEELSTQNRLLYDQIELLSRS 1136

Query: 982  GMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPE 1041
                ++ D + + D R L++ LR ERD+ +++   ++R+ K+L++ L+    +L     +
Sbjct: 1137 PSSSLEPDTKISSDARELIVTLRRERDILETKIDVSKREEKMLRQRLELTKSELDNLRAQ 1196

Query: 1042 IDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQ----XXX 1097
            + E      +    +   E++  +L  L   +E N+ L    + ++E    LQ       
Sbjct: 1197 LSESKGLVTEGTDSSQNQEELFEKLNQLNLLREHNMSLRNESEKVSEHNEFLQNEILSLQ 1256

Query: 1098 XXXXXXXXXAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSENT----ATEIQNLQQ 1153
                      K  ++ ++E+E  QK+   ++ES++WK   Q +          E + L  
Sbjct: 1257 EKVQPMEEQIKSLTATLTEKE--QKLALLKEESDRWKQRSQDILHKYERIDPEEYRKLAS 1314

Query: 1154 QLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIEL-------SELKT 1206
            ++E  KA+++ K+ E+ D  +RF +L+KQA+E+L+  KA    +  EL       S+L+ 
Sbjct: 1315 EIEVLKAELERKSAESIDSQERFRKLRKQANERLDEFKAAKAKVESELELALSGKSQLEA 1374

Query: 1207 VNDALQEKLNNQETNSVD---SESNAALILQLKEENKQAKS-------LELELRHSVDSS 1256
                 +EK+ + ET   +   SE +  +  +L+E   + +        L+ E   S +S 
Sbjct: 1375 KLSEAREKITSLETQLTERPASEDDNPVSHELEETKTKLQDAENTINMLKSEWSISEESF 1434

Query: 1257 EKLIADMTKELTTLKEN--PIQGSVNVEDY----THRLEQLKSEFEDEKRVLIEKTTSEL 1310
            +K + ++ K+L T+++N  P  G  +   Y    T  LE  K + E+E+R LIE    EL
Sbjct: 1435 KKQLDELNKQLETIQKNSAPSSGHSDPSSYHEQPTAVLEDFKKQVEEERRTLIESHQQEL 1494

Query: 1311 TERFERXXX--------------------XXXXXXXXXXXXXXXXXXXXXXXTLQRIEEA 1350
            T R E                                               TLQRI EA
Sbjct: 1495 TARLEASRKNFLAEKEKALEELRDSLTNVSVEAASQNLEALKKKWEEEYEQQTLQRIREA 1554

Query: 1351 KENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKV-AEQANLLK--LSELSNKTADELEK 1407
            +E LKK IRLP+EE+I +VI +++  LE++F TKV A    LLK     +++  AD ++ 
Sbjct: 1555 EEALKKRIRLPSEERINQVIERKQKALEQEFTTKVNATALALLKENPDSIASDKADLIKD 1614

Query: 1408 EVRE--EIKTRLEEDFE----LLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPL 1461
              +E  ++K  L + FE     +KKKAFEEGRQQ  MK  LLE KI+KLE++ +   G  
Sbjct: 1615 HQKEIVQLKKDLADKFEGQLVQVKKKAFEEGRQQGIMKVKLLESKISKLESQAKAPLG-- 1672

Query: 1462 KSANGLNKINIDSPLMVAGPLTNE-PVLDEKPNAF 1495
               N   KI    PL    PL  + PV   KP+ F
Sbjct: 1673 --TNVPTKI----PLENTQPLAQQVPV---KPSPF 1698

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score =  247 bits (630), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 343/1321 (25%), Positives = 615/1321 (46%), Gaps = 142/1321 (10%)

Query: 161  KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220
            KL+Q+ +E +++   N  LLD  ++++  + +K    K L D  ++++ +F +E+  + K
Sbjct: 219  KLNQTQTENESVSTYNKFLLDQNKKLSHLVEEKLLEIKNLKDTANTEKSEFSKEMTLQKK 278

Query: 221  LNAVLKKQVNSL---HS----ELGNG--GETPAHAEPNDQFAKQSSQHE---EEISNYKE 268
            +N +L+ Q+ S    HS    E G+    + P H +  ++      + E   EE    K 
Sbjct: 279  MNDLLRSQLTSFERGHSLRPKEKGDDKLCKNPEHIDVAEELIDAKLKLEKSKEECQLLKN 338

Query: 269  QVEELLGILGQ------GAPSIAHXXXXXXXXXXXNVS-------LKKQMESFVIELEHR 315
             V + +   G        AP++              V        ++ Q++ FV+ELEH+
Sbjct: 339  IVSDCIEENGTTVNTNTAAPTVGKLFSNIKTLKRQLVKERSQKFQVQNQLKDFVLELEHK 398

Query: 316  LPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQR 375
             P L   +++ + ++ +L  +T  +   S AK + +++L+S  QK++      H L  QR
Sbjct: 399  TPALVSFKERTELLEHELKCSTELLETMSLAKRKDEKKLTSLEQKINSYEANIHSLVRQR 458

Query: 376  SDLAHQIQFLLT----VNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431
             DLA Q++ LL+    + ++ + L   EL  ++ ++E+EN    +DSQ I++++L+ F N
Sbjct: 459  LDLARQVKILLSNISAIQTTTSPLSNDELMSLRKLLESENTVNERDSQIIITEKLVEFKN 518

Query: 432  IPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQLES 485
            I ELQE+NM+L+  +R L DK+E+ E + D  +      T++ AK  I ++E  N++L  
Sbjct: 519  IDELQEKNMELLDCIRILADKLETNEGEADKTVAKIENQTIKEAKEAIIEMESINSKLAL 578

Query: 486  EV------KNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESHVQKINVL 539
             V      ++   L+ +  D  +      +T    +KKI EL+SKL+             
Sbjct: 579  RVNILTRERDSYKLLASANDNKTHADTEGITEATYEKKIRELQSKLSS------------ 626

Query: 540  NKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKRENLSLTQQISTKQNE 591
              T   + + I  LN Q+    KS  + K  L        +  ++E + L ++I+  + +
Sbjct: 627  --TRVESSAIIQNLNGQLLTYKKSQTDGKIALQEFENFKVLVAEKEAM-LQERINHLKTQ 683

Query: 592  LDELNSKSAQKERDYQLK-IAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQ 650
            L++    +A   +DY+   + +LS + NK  S +     L +E T +   + SL   +++
Sbjct: 684  LEKQRLSAAPPVQDYKYSNLTDLSHSENKIGSLKYEISNLKKENTGLIAMKESLTRDLER 743

Query: 651  ESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQ 710
              K+ +QL  +  E E   + + L     E   S++I  L +  K L+  L  KE+E+K 
Sbjct: 744  CCKEKMQLHVKLSESETSHNEQNLIFGSKELQYSTRIKVLEKNLKELNVRLESKEQEIKT 803

Query: 711  FIEKSEKQIKWYQQNIDE-------LSEQNKNKSNKI------IE-LNDKLRL--LSEKS 754
                   Q+KW Q  ID+       +S +  NK   I      IE L ++LR+  L  K 
Sbjct: 804  LQSSKNSQLKWAQNTIDDTEKNLKSVSAELSNKETTIGRLSLEIENLGNELRMTKLQYKF 863

Query: 755  LSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISE 814
            LSN      T    L+ EL   +  L+ + SQ   Y++ +  N+N               
Sbjct: 864  LSNTS-DTNTLEPTLRKELKQTQIELKDAHSQIKAYEEIISTNENV-------------- 908

Query: 815  LQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLN-------- 866
            L+  N  L K  E  + +I + EN+ KG + E  + + +   E   L+ KL         
Sbjct: 909  LKELNGELKKAKEDCETKI-QLENKEKGAKEEELSHLRKELDEIRCLQPKLREGASYLVL 967

Query: 867  ---SLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQ 923
                +    ++I EMK + D     IE+  K +S     ++S L +  K+L+ + +++E+
Sbjct: 968  QSEKVGDQAQRIQEMKNKIDKMAAIIEAYQKEESS---QYQSELKTN-KDLSEWVMRLEK 1023

Query: 924  ----LNTEIAKLNSDIAALTEPAEAR-KTLIKERDSLGQELKLANQRIESLAAQNSILYD 978
                  TE+ K    + +  E  +   K  ++E+    +EL    ++ ESL  +NS+L +
Sbjct: 1024 EAFDYQTELKKTKKSLYSTQELLDRHEKKWMEEKADYERELISNIEQTESLRVENSVLIE 1083

Query: 979  TFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAIT 1038
               G        E   +L +L  NLR ER   +++ TT +RD+ LL++    + + +   
Sbjct: 1084 KIDGATEGSNSNEKYLELVSLFSNLRHERSSLETKLTTCKRDLALLRQKNASLEKSIGDL 1143

Query: 1039 CPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXX 1098
                  P N  +    +   +EKI++E+  +   +E N  L +S+K++ E    +     
Sbjct: 1144 QRANTVPRNKVQCPAVIIDEYEKIIKEIAQVNILRENNAILHKSLKNVTEKNEAIYKELI 1203

Query: 1099 XXXXXXXXAKKNSSAISEQEW--QQKIETYQQESEKWKLMCQQMSENTATEIQNLQQQLE 1156
                     + +     EQ      K+  Y+ E E+ K   Q +S+      +N  ++L 
Sbjct: 1204 NMQEEISRLQGHLIQTKEQVSINANKVLAYESEIEQCKQRYQDLSQQQKLTHKNETEKLH 1263

Query: 1157 TFKADIQLKT----QENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQ 1212
                D+++K       N DL ++F RLKKQAHEKL+ASK    +L  EL+ELK   D L+
Sbjct: 1264 NVIGDLEVKLLNVQNANADLENKFNRLKKQAHEKLDASKKQQTALTNELNELKETKDKLE 1323

Query: 1213 EKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLKE 1272
            E L+N+E+  VD E      L+LKE   Q   +      S D          +E+ +LK+
Sbjct: 1324 ENLHNEESKVVDLE------LKLKEHGLQVGEV------SKDHDSIAFKPFVEEIESLKK 1371

Query: 1273 NPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFE------RXXXXXXXXXX 1326
              +Q   N  D +   E++K+  E+EK  +I++ T +  ++ +      +          
Sbjct: 1372 -ELQVFRNANDASDAFEKIKNNMEEEKNKIIDEKTKDFEKKLQDAVNKSKSNESEVENSE 1430

Query: 1327 XXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVA 1386
                            T++RI+EA+ENLKK IRLP+EE+I+++I+KRK +LE++F+ K+ 
Sbjct: 1431 HIEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLK 1490

Query: 1387 E 1387
            E
Sbjct: 1491 E 1491

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score =  243 bits (619), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 387/1444 (26%), Positives = 651/1444 (45%), Gaps = 229/1444 (15%)

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360
            L+ Q+ESF+IELE+++P +   +++N+ ++ +L   T  + + S  K   Q +L++   K
Sbjct: 382  LQTQIESFIIELENKIPIISSFQEKNQALENELTNLTLLLNKTSNEKNTIQNKLNNYDSK 441

Query: 361  VDHLNQIFHKLRVQRSDLAHQIQFLLTV----NSSDTVLPPSELSFIKTIIEN-ENWDAY 415
            +        +L  QR DLA+Q++ LL      N S   L   E+ FI  I  N E+ +  
Sbjct: 442  LLTYQSNIKELIRQRLDLANQVKHLLLFVAVKNDSGGPLTREEIEFINKISNNSEDLNGS 501

Query: 416  K-DSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDS----GLTLEAAK 470
            +  SQ ++S+RL+ F NI ELQ +NM+L++++RSL + +E+ E  N        T+  AK
Sbjct: 502  ELTSQHVISERLVTFSNIEELQAKNMELLNSIRSLSENLENIENANSHKEFQNKTIADAK 561

Query: 471  LQISKLEQSNAQLESEVKNWEALMETLK----DGDSLDSKI-------------NVTMVE 513
              I  L+  N  LES+VK  EA  ++ K    +  S+DS I             N   +E
Sbjct: 562  EAILTLQYHNDILESKVKVLEAERDSFKLLLNNNVSIDSSIKNDDLSSSTSPETNEKSIE 621

Query: 514  Q-QKKIEELESKLT---DVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKS 569
            + Q  IEEL+++L    D  ES +        T D++  TI++  E+  NT+ ++  + +
Sbjct: 622  KLQTLIEELKAELKKNKDALESQIASF-----TADKSNLTISLEKEKSSNTLMAEKISLT 676

Query: 570  E--LIACKRENLSLTQQISTKQNELDELNSKSAQKERDY---QLKIAELSVAANKCKSWE 624
            E      K EN  L ++    QN + +  SK       Y   + +I+ L    +  KS  
Sbjct: 677  ESAFDMLKTENKELNKRFENLQNIIIKQESKLGDIINKYITGETEISNLKTQLSIAKS-- 734

Query: 625  NSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISG-KELHRKR----- 678
                    EK  + + Q SL  ++ + S      E +NK L + +S  + L  +R     
Sbjct: 735  --------EKDFLVKSQDSLNSELIKTS------EEKNK-LRIMLSQLQSLQNERMTLLD 779

Query: 679  -SEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNK--- 734
             +++   SKI  L   N  L  +L  K  E+++    +E Q  WYQ  ID+L + N    
Sbjct: 780  DTQKKFMSKIHELENNNLDLIKNLGSKMTEIQKLSISNESQCTWYQNTIDDLKKINSAIK 839

Query: 735  ----NKSNKIIELNDKLRLLSEKSLS----NKPYPVGTELKELQNELNGMKAALEVSESQ 786
                +K++ I +LN K+ LL  +S +     +    G +  ++  +L+  K  L  + +Q
Sbjct: 840  TELTSKNSLISDLNTKIELLESQSYTIDTNTRCSSSGNDFSQISKDLDITKLHLSEAYTQ 899

Query: 787  ATLYKD----------TLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITET 836
               YK           TLE   NF +   L   + IS+L S+NE L         +I+E 
Sbjct: 900  VEEYKQLYTSTEESLKTLE--SNFESVKNL-MDDKISKLLSENETLKASTGEYDKRISEL 956

Query: 837  ENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQ 896
                K  +       ++ + E   L  ++  L+  ++  A+   EY+ +I K++S L+++
Sbjct: 957  STDLKNEK-------NKYSEEIAQLNVQITRLNKFKKDSADTASEYEEKISKLQSQLELK 1009

Query: 897  SDTRLN----FESALTSKEKELTS---YAVQIEQLNTEIAKLNSDIAALTEPAEARKTLI 949
            +    N    +ES LT     L S   +  QIE+LN  I  + SD+   T      ++L 
Sbjct: 1010 AKFADNAQEKYESLLTKDNANLQSIEEFKEQIEKLNQRIVIIESDLEKKTSLLSENESLW 1069

Query: 950  KER-DSLGQELKLANQRIESLAAQNSILYDTFSGMRH---VDADAEPNEDLRNLVINLRI 1005
            K++ D+   +L+ + ++I++L  QN +  D    +         ++ + + +++   LR 
Sbjct: 1070 KKKQDAFISDLEESKKKIDNLTNQNKLYVDQLELLNKDFSSMDSSQLSSETKHMFNRLRA 1129

Query: 1006 ERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRE 1065
            +RD+ +++ + A+RD K     L+ + ++LA    ++    N       L   HEKI+ E
Sbjct: 1130 DRDVLETKLSIAERDSKNNASKLESLRDELANVQMKLISSENKLLRHSDLIENHEKIVSE 1189

Query: 1066 LEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAISEQ--EWQQKI 1123
            L  +T  KE N  L   +  LNE  +TLQ                  ++ E   + +  I
Sbjct: 1190 LNQITLFKESNETLRNQVSELNEKNKTLQTKLNEENSKLSNLSMELKSVKESLGDKETDI 1249

Query: 1124 ETYQQESEKWKLMCQQMSENT----ATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRL 1179
               ++ES KW+L  +++S          +  L  +L+  K D + K ++N +L +RF  L
Sbjct: 1250 MLIKEESNKWRLRAEELSVQIDKVDLDSVSKLSTELDALKDDAETKRKQNAELEERFNLL 1309

Query: 1180 KKQAHEKLNAS--------------KATSDSLAIELSELKTVNDALQEKLNNQETNSVDS 1225
            KKQAHE+LNAS              KA++ ++ + LS  +  +  LQ  L++ E      
Sbjct: 1310 KKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNEVKYTQK 1369

Query: 1226 ESNAALILQ-LKEENKQAK----SLELELRHSVDSSEKLIADMTKELTTLKENPIQGSVN 1280
             SN    L+ LK EN   K      ++EL   VDS +K + +   +L+ +  +    ++N
Sbjct: 1370 LSNIESELKALKTENNSFKLSSEKEKMELTDEVDSLKKSLVEAQSKLSAIGSDSTDSTMN 1429

Query: 1281 V--------------EDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXXX 1326
                           +    +  +L+++++ EK  L+ K   E  E  +           
Sbjct: 1430 AMIESMKKEFEEEKLKLLEDKTNELEAQWKLEKDKLL-KEYEEKIEDLQSARTDQSIKIE 1488

Query: 1327 XXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVA 1386
                            TL+RIEEAKE LKK IRLP+E KI RVI KRK +LE +++ K+ 
Sbjct: 1489 EFQSLKKEWEEEYEKATLERIEEAKETLKKRIRLPSETKINRVIEKRKHELENEYEVKLQ 1548

Query: 1387 EQANLLKLSELSNKTAD--ELEKEVREEIK----TRLEEDFELLKKKAFEEGRQQASMKT 1440
            E+ N ++ +  S +T D  +L +E++EE+K     + E D    KKK+FEEG+QQ+SMKT
Sbjct: 1549 EKLNEIEANRNSIETIDPGKLREEIKEEVKRDMLIKFENDLNEAKKKSFEEGKQQSSMKT 1608

Query: 1441 TLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEKPNAFAGAXX 1500
            TLLERKI+KLE++L                        +  + N+   D+ P        
Sbjct: 1609 TLLERKISKLESQL------------------------SEAIENDKQSDKNP-------- 1636

Query: 1501 XXXXXXXXXXAKDSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGA 1560
                        D A   +  + + P      S  +PAFSFG FN T        NS+ A
Sbjct: 1637 ---------IISDLAQTSTLASIQPP------SAKKPAFSFGGFNTT--------NSLNA 1673

Query: 1561 ASG-------------------TPFRFGFA--SNPPTPFQNTAENGTDAKRKSQTEASKE 1599
              G                    PF  G +  S+ P  F   + + T +   +Q   SK 
Sbjct: 1674 NKGFSSSSNNTSQSSKDTEIVQNPFSLGVSQTSSSPMHFNPFSSSATTSNVFNQNGTSKN 1733

Query: 1600 VEDN 1603
            +  N
Sbjct: 1734 IFGN 1737

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
            MLP1Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved with Tel1p in telomere length
            control; involved with Pml1p and Pml39p in nuclear
            retention of unspliced mRNAs
          Length = 1875

 Score =  240 bits (613), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 393/1508 (26%), Positives = 719/1508 (47%), Gaps = 225/1508 (14%)

Query: 149  QRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQR 208
            Q+ D+ +  IR +L++  ++ +  R +N  L      +++ L +K    K LSD L+S++
Sbjct: 230  QKTDKVILDIRNELNRLRNDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEK 289

Query: 209  HDFERELATRDKLNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEE---EISN 265
             +F  E++ + +L  +L+ Q+N++  EL +  E        D   KQ+ ++E+   E+  
Sbjct: 290  QEFSAEMSLKQRLVDLLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQL 349

Query: 266  YKEQV----EELL--------------GILGQGAPSIAHXXXXXXXXXXXNVSLKKQMES 307
             KE++    +E L               +  + +                   L+ Q+E+
Sbjct: 350  TKEKLAQCEKECLRLSSITDEADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIET 409

Query: 308  FVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQI 367
            F++ELEH++P +   +++   ++ +L+ A   +   S  K    +EL++  QK+      
Sbjct: 410  FIVELEHKVPIINSFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECEND 469

Query: 368  FHKLRVQRSDLAHQIQFLLTVNS----SDTVLPPSELSFIKTII-ENENWDAYKDSQRIV 422
               L  QR DL  QIQ+LL  NS    S   L   E+ FI+ I+ E+++     DSQ++V
Sbjct: 470  LQTLTKQRLDLCRQIQYLLITNSVSNDSKGPLRKEEIQFIQNIMQEDDSTITESDSQKVV 529

Query: 423  SDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKL 476
            ++RL+ F NI +LQE+N +L+  VR+L DK+ES E  +   L      T+  AK  I  L
Sbjct: 530  TERLVEFKNIIQLQEKNAELLKVVRNLADKLESKEKKSKQSLQKIESETVNEAKEAIITL 589

Query: 477  EQSNAQLESEVKNWEALME----TLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGESH 532
            +     LES ++  +  +E    ++ + D+  S + +  + + K+  +LES++ D+ ++ 
Sbjct: 590  KSEKMDLESRIEELQKELEELKTSVPNEDASYSNVTIKQLTETKR--DLESQVQDL-QTR 646

Query: 533  VQKINVLNKTIDRNQSTINM--LNEQIKNTV--KSDMNAK------SELIA--------- 573
            + +I          +ST NM  LN++I++    KSD++ K      S ++A         
Sbjct: 647  ISQIT--------RESTENMSLLNKEIQDLYDSKSDISIKLGKEKSSRILAEERFKLLSN 698

Query: 574  ----CKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHL 629
                 K EN  L ++    QN + + +SK+ +   +Y    ++LS+   +        +L
Sbjct: 699  TLDLTKAENDQLRKRFDYLQNTILKQDSKTHETLNEYVSCKSKLSIVETEL------LNL 752

Query: 630  LTEEK--TQMEQKQRSLFDKIQQESKKL----LQLETRNKELEVKISGKELHRKRSEETL 683
              E+K    +E+  +   +K+  E   L     QL+T  KE E  +   E  RK  ++ +
Sbjct: 753  KEEQKLRVHLEKNLKQELNKLSPEKDSLRIMVTQLQTLQKEREDLL---EETRKSCQKKI 809

Query: 684  SSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN-------K 736
                  LSE    L  + + K+  +KQ  E +   I+WYQ  I+ L +  ++       K
Sbjct: 810  DELEDALSE----LKKETSQKDHHIKQLEEDNNSNIEWYQNKIEALKKDYESVITSVDSK 865

Query: 737  SNKIIELNDKLRLLS----EKSLSNKPYPVGTEL---KELQNELNGMKAALEVSESQATL 789
               I +L  K++ L     E  +    Y V  E      L+ EL   K  L  + SQ   
Sbjct: 866  QTDIEKLQYKVKSLEKEIEEDKIRLHTYNVMDETINDDSLRKELEKSKINLTDAYSQIKE 925

Query: 790  YKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQT 849
            YKD        Y  ++ S Q T S+L    +  + Q + L ++ T  E++   ++ +   
Sbjct: 926  YKD-------LYETTSQSLQQTNSKLDESFKDFTNQIKNLTDEKTSLEDKISLLKEQMFN 978

Query: 850  IIDRLTSEKTALEE-------KLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQS----D 898
            + + L  +K  +E+       +++ L ++ +++  +K EY++++ KI+++L  Q+     
Sbjct: 979  LNNELDLQKKGMEKEKADFKKRISILQNNNKEVEAVKSEYESKLSKIQNDLDQQTIYANT 1038

Query: 899  TRLNFESAL-----TSK-----EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTL 948
             + N+E  L      SK      ++L +Y  Q++ LN    +L + +       E  K+ 
Sbjct: 1039 AQNNYEQELQKHADVSKTISELREQLHTYKGQVKTLNLSRDQLENALK------ENEKSW 1092

Query: 949  IKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINL 1003
              +++SL ++L L+N RIE L++QN +LYD      +  AD E N       L N++I L
Sbjct: 1093 SSQKESLLEQLDLSNSRIEDLSSQNKLLYDQIQI--YTAADKEVNNSTNGPGLNNILITL 1150

Query: 1004 RIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIM 1063
            R ERD+  ++ T A+RD K+L++ +  +  +L     ++D     +++  S+   H+ IM
Sbjct: 1151 RRERDILDTKVTVAERDAKMLRQKISLMDVELQDARTKLDNSRVEKENHSSIIQQHDDIM 1210

Query: 1064 RELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAI--SEQEWQQ 1121
             +L  L   +E N+ L   +++ N  K+ LQ             +   +A+  S QE +Q
Sbjct: 1211 EKLNQLNLLRESNITLRNELENNNNKKKELQSELDKLKQNVAPIESELTALKYSMQEKEQ 1270

Query: 1122 KIETYQQESEKWKLMCQQMSEN----TATEIQNLQQQLETFKADIQLKTQENDDLNDRFT 1177
            +++  ++E  +WK   Q + E     ++++ + L+ ++E  K +++ K ++  +  ++F 
Sbjct: 1271 ELKLAKEEVHRWKKRSQDILEKHEQLSSSDYEKLESEIENLKEELENKERQGAEAEEKFN 1330

Query: 1178 RLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNS-VDSESNAAL----- 1231
            RL++QA E+L  SK + DSL  +++ L+   + L+  L+  E N+ ++   NA +     
Sbjct: 1331 RLRRQAQERLKTSKLSQDSLTEQVNSLRDAKNVLENSLS--EANARIEELQNAKVAQGNN 1388

Query: 1232 ----ILQLKEENKQA-KSLELELRHSVDSSEKLIADMTKELTTLKE----------NPIQ 1276
                I +L+E+ ++A + L+ +L  S  S E  I  + +E+TTLKE              
Sbjct: 1389 QLEAIRKLQEDAEKASRELQAKLEESTTSYESTINGLNEEITTLKEEIEKQRQIQQQLQA 1448

Query: 1277 GSVNVE-DYTHRLEQLKSEFEDEKRVLIEKTTSELTER-FERXXXXXXXXXXXXXXXXXX 1334
             S N + D ++ +E +K  FE++K   I++ T E+ E+  E                   
Sbjct: 1449 TSANEQNDLSNIVESMKKSFEEDKIKFIKEKTQEVNEKILEAQERLNQPSNINMEEIKKK 1508

Query: 1335 XXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQ------------------ 1376
                      Q+I EA+E LKK IRLPTEEKI ++I ++K +                  
Sbjct: 1509 WESEHEQEVSQKIREAEEALKKRIRLPTEEKINKIIERKKEELEKEFEEKVEERIKSMEQ 1568

Query: 1377 -------LEEQFQTKVAEQANLL------KLSE------LSNKTADELEKEVREEIKTRL 1417
                   L +Q + KV E+   L      KL E       S+  +D+   ++R EI++RL
Sbjct: 1569 SGEIDVVLRKQLEAKVQEKQKELENEYNKKLQEELKDVPHSSHISDDERDKLRAEIESRL 1628

Query: 1418 EEDF----ELLKKKAFEEGRQQASMKTTLLERKIAKLEARL----QGGTGPLKSANGLNK 1469
             E+F    + +KKK+F+EG+QQA MKTTLLERK+AK+E++L    Q    P KS N    
Sbjct: 1629 REEFNNELQAIKKKSFDEGKQQAMMKTTLLERKLAKMESQLSETKQSAESPPKSVN---- 1684

Query: 1470 INIDSPLM 1477
             N+ +PL+
Sbjct: 1685 -NVQNPLL 1691

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
            similar to Ashbya gossypii AFR286W
          Length = 1769

 Score =  235 bits (599), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 407/1510 (26%), Positives = 694/1510 (45%), Gaps = 259/1510 (17%)

Query: 167  SEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLK 226
            S+++  R +NS L      ++ +L +K    K L+D L++++ +F RE++ + +L  +L+
Sbjct: 242  SQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEEFTREMSLKQRLIDLLE 301

Query: 227  KQVNSLHSEL--------GNGGETPAHAEPNDQFAKQSSQHEE-EISNYKEQ--VEELLG 275
             QV+S+ S+L         NG  TP   +  D+        E  +  N K +  V ELL 
Sbjct: 302  SQVSSMKSDLENAYQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEATVNELLS 361

Query: 276  ILGQGAPSIAHXXXXXXXXXXXNVSLKK------------------------QMESFVIE 311
            + G+   ++ +             ++ K                        Q+ESFV+E
Sbjct: 362  VNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQVESFVVE 421

Query: 312  LEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQR--ELSSSRQKVDHLNQIFH 369
            LEH++P L   +++   ++++L+  T  ++ ES AK R Q+  EL+  + K+++      
Sbjct: 422  LEHKIPILNSFKERTDMLERELNDVT--LLLESTAKQRDQKTIELNQYKNKINNYESQVC 479

Query: 370  KLRVQRSDLAHQIQFLLT-VNSSDTVLPP---SELSFIKTIIENENWDAYKDSQRIVSDR 425
             L VQRSDLAHQ+Q+LL  ++  D    P    E+ F+K II +E+     D+Q I+S+R
Sbjct: 480  SLIVQRSDLAHQVQYLLMQLSVRDDAHGPLTEQEVEFVKRIISSEDEAPKSDTQGIISER 539

Query: 426  LLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQS 479
            L++F ++ ELQ +N +L++T+R L DK+E  E  +   L      T++ AK  I  L++ 
Sbjct: 540  LVQFKSVIELQSKNAELLNTIRQLADKLEDEEKKSRFRLKSVETQTVKEAKEAILSLQEH 599

Query: 480  NAQLESEVKNWEALMETLKDGDSL----DSKINVTMVEQQKKIE----ELESKLTDVGES 531
              +LE ++K      +  K  +S     DS  + T   Q KK++    ELE +L ++ E 
Sbjct: 600  VQRLEDQLKIVSKERDAFKLANSANKQGDSAPSSTY--QSKKLDEHIMELEKRLKNLAEQ 657

Query: 532  HVQKINVLN---KTIDRNQSTINMLNEQIKNT-VKSDMNAK---SELIACKRENLSL--- 581
                I +LN   K + + +S + ++ EQ +++ V ++   K   S L   K ENL L   
Sbjct: 658  SQDNIKLLNDEIKALYKAKSEVTVILEQERSSKVLAEERLKLIQSTLSLTKEENLELHKR 717

Query: 582  ---TQQISTKQNE-----LDELNSKSAQ------------KERDYQLKI-AELSVAANKC 620
                Q++  KQ+E     +DE+ +  +Q             ERD+  KI AEL       
Sbjct: 718  SDDLQRVLLKQDEKTQSTIDEIIATKSQLSNLTSKLAILTSERDFLRKIEAEL------- 770

Query: 621  KSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLL-QLETRNKELEVKISGKELHRKRS 679
               +N    LT+E T                SK L+ QL+T  +E ++ +   + + +++
Sbjct: 771  ---KNENEALTKENTT---------------SKILVSQLQTLQRERDILLEEAQTNYRKN 812

Query: 680  EETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKN---- 735
             E L S +    E     H     +E E ++  + S  Q KW+Q  +D L+EQ  N    
Sbjct: 813  IEKLESDLHETRE-----HLVRRTREYEEQRVSDTS--QYKWFQAKVDSLNEQLDNARKT 865

Query: 736  ---KSNKI--IELNDK--LRLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSE---- 784
               K+N I  ++L+ K     L E  L  + Y V     ++ +++  ++  LE +     
Sbjct: 866  LQEKTNSIETLQLHAKSLTAKLEEAELRTQSYSVLANADDITDKIETLRKNLEKANINLA 925

Query: 785  ---SQATLYKDTLERNQNFYNNSTLSFQNTISELQS---KNEALSKQ-HETLQNQITETE 837
               SQ   YK   + ++     S +     + E Q+   KN AL +Q  ++L +QI    
Sbjct: 926  DAYSQIEQYKSMAKVSE----QSAVEISKALEESQANYRKNIALLEQERKSLTDQIALLN 981

Query: 838  NQSKGI--QLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKI 895
            +Q K +  +L+HQ   ++  SEK+ L +KL+ L  S+  + E+K EY+ +I K++ +L  
Sbjct: 982  DQIKDLNSELDHQKSQNQ--SEKSELIKKLSILQGSQRSLDELKSEYEEKISKLQEDLTQ 1039

Query: 896  QSD----TRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPA-EARKTLIK 950
            Q+      + N+E  L  K  ++T     I  L  E  K  S++      A EA+  L +
Sbjct: 1040 QASYANQAQKNYEQEL-QKHADVTKT---ISLLREESQKYKSEMEGFKRSASEAKSALER 1095

Query: 951  ERDSLGQ-------ELKLANQRIESLAAQNSILYDTFSGM-RHVDADAEPNEDL----RN 998
               S  Q       +L LA QR E L  QN +LYD    + +   +D+E    +    R 
Sbjct: 1096 NEQSWCQQVADLESQLSLAQQRTEELNTQNRLLYDQVELLSKATSSDSEAAASMSAESRE 1155

Query: 999  LVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVT 1058
            L++ LR ERD+ +++   + R+ K+L++ L     +L     E  +   T  D      +
Sbjct: 1156 LIMTLRRERDILETKLDVSIREEKILRQRLGLAKTELENVRLEFSKTQATAPDSIFARES 1215

Query: 1059 HEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXX--XAKKNSSAISE 1116
             E+IM +L  L   +E N+ L    K   E  +  Q              ++  S  I+ 
Sbjct: 1216 QEQIMEKLNQLNLLRESNVTLRNESKKYLEQSQHFQNEIAKLQEQLQPLESQLKSLTITI 1275

Query: 1117 QEWQQKIETYQQESEKWKLMCQQMSENT----ATEIQNLQQQLETFKADIQLKTQENDDL 1172
             E  Q+I   ++ES +WK   Q +          E Q L  ++   K +++ K+ EN + 
Sbjct: 1276 SERDQQISLLKEESSRWKQRSQDILHKYERIDPVEHQKLADEVTELKNELEKKSLENLES 1335

Query: 1173 NDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKL-------------NNQE 1219
             +RF +L+KQA+E+L+  KA    +  E   +      L+ +L              +  
Sbjct: 1336 QERFRKLRKQANERLDEFKAAKAKVESEFEAVSIAKAQLEAELAQTLDKVSELESKLSSS 1395

Query: 1220 TNSVDSESNAALILQLKEENKQAKSLELELRHSV-------DSSEKLIADMTKELT---- 1268
             N  + E+++     LKEE ++ ++  +E   +V        SSEK + +  +ELT    
Sbjct: 1396 ANEKNGEADS-----LKEELEELRANFIEANEAVADIKAEAASSEKDLKNQIQELTEKIK 1450

Query: 1269 TLK------ENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXX 1322
            TL+      E   + S +  D+   +E +K +FE+EK+VLI++   EL  + E       
Sbjct: 1451 TLESEIEHSELEAKNSNDSPDFAPIVENMKKKFEEEKQVLIQEKDEELRMKLEEIQKQYE 1510

Query: 1323 XXXXXXXXXXXXX--------------------XXXXXXXTLQRIEEAKENLKKHIRLPT 1362
                                                    TL+RI EA+E LKK IRLP+
Sbjct: 1511 EERERELSELKASLVESTPNAPLIDEETLKSKLEAEYEKKTLERIREAEEALKKRIRLPS 1570

Query: 1363 EEKIERVIAKRKAQLEEQFQTKVAEQANLLKL-----SELSNKTADELEKEVREE---IK 1414
            EE+I +VI +R+  L+++F+ +V  +A  L+L           TA +L KE +EE   ++
Sbjct: 1571 EERINQVIERRQRALDQEFELRV--RARALELFKENPESFVGDTA-KLIKEHQEEMDKLE 1627

Query: 1415 TRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDS 1474
             + +E   L++KKAFEEG+QQ  MK  LLE KIAKLE +      P       NKIN+++
Sbjct: 1628 AKFDEQLALVRKKAFEEGKQQLVMKVKLLESKIAKLEGQ------P-------NKINLNN 1674

Query: 1475 PLMVAGPLTN 1484
             +    P+ N
Sbjct: 1675 SVPSKIPIDN 1684

>KAFR0D02220 Chr4 complement(443928..448952) [5025 bp, 1674 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1674

 Score =  234 bits (597), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 245/855 (28%), Positives = 420/855 (49%), Gaps = 140/855 (16%)

Query: 841  KGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNL-----KI 895
            + I+ E+Q + D+L  EK + + +  SL++  +KI E     +   + +E +L     K+
Sbjct: 869  QAIRAEYQHLHDQLQLEKNSFDTEKASLNNELDKIMENNSLTEVAKKSLEDDLHDVEMKL 928

Query: 896  QSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSL 955
            + + + + E+  T  EKEL       E++  EI+    +   L++ AE +  +   R+ L
Sbjct: 929  EEERQKHEETNATLSEKELLC-----EKMIEEISGYREE---LSKSAEMQVDIQHTRE-L 979

Query: 956  GQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQET 1015
               L LAN+RI+ L  QN++L++  +    ++ D +  +D++++++ ++ ERD  Q +  
Sbjct: 980  EDLLDLANKRIDDLCTQNNLLHEQLNATLDLE-DTQNKDDIKDIIVCMKRERDTLQKKLA 1038

Query: 1016 TAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDD----FSLTVTHEKIMRELEGLTN 1071
              +R+ ++L+       E+ A    E+D  +  ++       +L   HEKI+ EL+ +  
Sbjct: 1039 IVEREGEVLR-------ERCAGLKSELDAVSKGQQWHNLPLSNLLTGHEKILDELKEVHL 1091

Query: 1072 TKEENLYLDESIKSLNEDKRTL--QXXXXXXXXXXXXAKKNSSAISEQEWQQKIETYQQE 1129
             +E N+ L   +  L  D   L  +             +KN++    +E  Q+I  Y+ E
Sbjct: 1092 LRENNVSLLTEVNQLKHDNCILNDELSQVRKLSGPLQDQKNNTERYFKEKDQEISLYKDE 1151

Query: 1130 SEKWKLMCQQM---SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEK 1186
             E+WK   QQM    ++T     N + ++++ K  I+ +T+E + L+++F  LKKQAHEK
Sbjct: 1152 IERWKKRWQQMVHRQDDTLGLEANFKNEIDSLKGLIEERTKEKEKLSEKFQLLKKQAHEK 1211

Query: 1187 LNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLE 1246
            L+A+K    +L  +LSE+K  N  L+E                     +KE++K+ + +E
Sbjct: 1212 LDANKIHIQTLNNDLSEIKASNLQLEE--------------------VMKEKDKKIREIE 1251

Query: 1247 LELRHSV---DSSEKLI---------ADMTKELTTLKE---------NPIQGSVNV---- 1281
            L L+ ++   D  EKL+         A + K +T L++           ++  +NV    
Sbjct: 1252 LTLKENLEKFDKDEKLVSEKTFKENEAKLNKTITMLQKLNETLNQEVVSLREEINVLRKK 1311

Query: 1282 EDYTHRL-EQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXXXXXXXXXXXXXXXXX 1340
            +D T++L   +K +FE EK  LIE+   EL E+FE                         
Sbjct: 1312 DDETNQLISTMKLDFEREKDRLIEEKVRELNEKFESGRNEVLSKQSENVTNDNTGSNVDK 1371

Query: 1341 ----------XXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQAN 1390
                        TLQRIEEAKENLK+HIRLP+EEKI+R+I KR+A+LE  F  +V E+AN
Sbjct: 1372 LKQELRKDWEEQTLQRIEEAKENLKRHIRLPSEEKIQRIIEKRRAELESDFDKRVEEKAN 1431

Query: 1391 LLKLSELSNKTADELEKEVREEIKTRLEED----FELLKKKAFEEGRQQASMKTTLLERK 1446
            L+ L++ ++ + DEL+++VR E++  +E+D     E ++ KAFEEG++QA MKTTLLERK
Sbjct: 1432 LIALADKADMSPDELKQKVRRELEHAIEQDLQAKLETIRTKAFEEGKRQAEMKTTLLERK 1491

Query: 1447 IAKLEARL----QGGTGPLKSANGLNKINIDSPLMV---AGPLTNEPVLDEKPNAFAGAX 1499
            ++KLE+++    + G+   KS +GL KI+++SP +     G  T E VL  +P A   + 
Sbjct: 1492 LSKLESQVAKDNESGSKVRKSISGLTKIDVNSPQLYKDNTGTRT-EAVLKLRPTAKVDS- 1549

Query: 1500 XXXXXXXXXXXAKDSANAFSFNAQKV-----PAQPAFSSRAQPAFSF------------- 1541
                         + +N F+   Q++     PA       A P FSF             
Sbjct: 1550 --------GKDVSNDSNPFTSPTQELSKSNSPAALPIVHMA-PTFSFTPGKSTGTVNKEL 1600

Query: 1542 -----GSFNKTSFSDLSHKNSVGAASGTPFRFGFASNPPT---PFQNTAE-NGTDAKRKS 1592
                  +F   +FS+     + G  SG    FG  +N  +   PF+   E +    KR  
Sbjct: 1601 NKTAQATFGAPTFSNFGTSTAFGGFSG----FGKTTNDQSGFKPFEALKEIDNESIKRPV 1656

Query: 1593 QTEASKEVEDNKRPK 1607
              E   +  ++K+PK
Sbjct: 1657 SDEKEDDFSESKKPK 1671

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score =  220 bits (561), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 415/1572 (26%), Positives = 714/1572 (45%), Gaps = 265/1572 (16%)

Query: 71   KTGILDTVQSSVSTANAELRSAREQVVEL--RQRLGESETQRFQSELQRDRLSEQLKQGE 128
            K G + T+Q        E R+ R+Q +EL  + R+ +SE  + +++        QL Q  
Sbjct: 148  KIGDIATLQQETERLLQEARTLRQQNLELEGQARVYKSEELKHKADFH------QLSQKV 201

Query: 129  RYINATNGRLLES--TKKLLDF----QRDDRQVGVI-------RGKLDQSLSEIKALRDS 175
              +N TN   LES   +K  +F    QR   ++  +        G L  +   IK LR+ 
Sbjct: 202  SLLN-TNNEWLESQLNQKNSEFNAYRQRTQSELASVSQRLETCEGDLQAATKTIKTLREQ 260

Query: 176  NSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLKKQVNSLHSE 235
            N        +   EL  +    K L+D+L+S + +F RE++ + +L  +L+ QV++L SE
Sbjct: 261  NG-------QKESELEGQFQAVKKLTDELTSAKQEFTREMSLKQRLVELLEGQVSALKSE 313

Query: 236  L---------GNGGETPAHAEPNDQFAKQSSQHEE---EISNYKEQVEELLG-----ILG 278
            L          +   T + ++  D+   ++ Q EE   +I   ++ VE+LL      I G
Sbjct: 314  LEFKNSPQASTDAATTESQSQIEDELVHKTQQLEESELKIQKLEQTVEQLLSADEKTISG 373

Query: 279  -QGAPS----IAHXXXXXXXXXXXNVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKL 333
             Q  P     I                L+ Q+E+FV+ELE+++P L   + +N  ++++L
Sbjct: 374  SQSLPDLYADIGILKKQVIHERRQKEFLQNQVEAFVVELENKVPMLSSFKDRNDVLEKEL 433

Query: 334  HAATNKMIEE-SKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQIQFLL---TVN 389
             A T  M++  SK K  T  +L  ++ ++  L      L  QRSDLA Q+Q+LL   TV 
Sbjct: 434  -AETAYMLDSISKDKDETAADLKRTKSQIRDLESQISALTQQRSDLARQVQYLLIQVTVR 492

Query: 390  S-SDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRS 448
              S   L   E +F+K ++  EN     D+Q I+S+RL+ F NI ELQ +N  L+ TVR+
Sbjct: 493  GDSHGPLSAEETAFVKKVVNMENTQPDGDAQGIISERLVEFKNIVELQAKNADLLHTVRN 552

Query: 449  LVDKVESWE---------ADNDSGLTLEAAKLQISKLEQSNAQLESEVK-------NWEA 492
            L +++E+ E          +ND   T+  AK  I  L+    +LE+ +         ++A
Sbjct: 553  LANQLETEERKVKSKTEAIEND---TITEAKEAIVTLQDHIQELETRIDVITRERDAYKA 609

Query: 493  LM-ETLKDGDSLDSK-INVTMVEQQK-KIEELESKLTDV---GESHVQKINVLNKTIDRN 546
            +  +T  +G +   + +N    E    KI ELE  L+      E++V+ +   N+ + R+
Sbjct: 610  IQSQTSHEGSNGGLRDVNAKASENSDLKIRELEELLSAAKREAEANVKLLMTENQELARS 669

Query: 547  QSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKS------- 599
            +S +          V  +    S L+A +R  +S +  + TKQ E +ELN +        
Sbjct: 670  KSEL---------VVNVEKEKSSRLLAEERLKISKSSLLLTKQ-ENEELNKRGLVLENNL 719

Query: 600  AQKERDYQLKIAELSVAANKCKS--------WENSF---HLLTEEKTQMEQKQRSLFDKI 648
            A+++   Q  I+EL      CKS         +NS    +LL     ++++    L  + 
Sbjct: 720  AKQDTRTQETISELI----DCKSQLATLSAELKNSIAKENLLNTSHQKLKETNEQLTKER 775

Query: 649  QQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEV 708
             + +  + QL+T  KE +  +       K S++    KI  L  E   L   L+ K  E+
Sbjct: 776  NELTILVTQLQTLQKERDTLL-------KDSDDNFKGKIDSLEAEISQLRTLLSQKATEL 828

Query: 709  KQFIEKSEKQIKWYQQNIDELSEQNKN-------KSNKIIELNDKLRLLSEK-------- 753
              F+  S+ + +WYQ+ ID L+E  K+       K+  I EL  +  LL+ K        
Sbjct: 829  SDFMSTSDSRSRWYQEKIDALNECLKSTTSDLNSKTQMIQELQSQQSLLTSKLRDAETKS 888

Query: 754  ---SLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQN 810
               S+ N+   V T+   L++EL   +  L+ + SQ   YK      +      T + ++
Sbjct: 889  QSYSVLNQTDDVLTQTDALRSELEKTRINLKDAFSQVDEYKGLYASTKETLTAMTTALEH 948

Query: 811  TISELQSKNEALSKQHETLQNQITETENQSKGI--QLEHQ-TIIDRLTSEKTALEEKLNS 867
            +  +   + E L K+ + L N     ++Q   +  +L++Q  +++ L  E    EE++ S
Sbjct: 949  SKQDHTIEVETLKKERDALSNDAAVLKDQLANLNSELDYQKNLLETLKHEHNKCEEEVKS 1008

Query: 868  LSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYA---VQIEQL 924
               ++  +A MK +Y  ++ K+  +L  Q+   +    A  + E+EL  +A     I QL
Sbjct: 1009 ---NKTALASMKDQYQLELSKLTEDLNQQA---MYANKAQENYEQELQRHADVSKTISQL 1062

Query: 925  NTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELK--------LANQRIESLAAQNSIL 976
              E  K  + + +L       K  ++E +S     K        L++QRIE L+ QN +L
Sbjct: 1063 REEAQKHKNKVHSLEASITELKKSLEENESCWAAQKQEYETQASLSSQRIEDLSTQNRLL 1122

Query: 977  YDTFSGMRHVDADAEP-NEDL----RNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEI 1031
            +D  S     D D+ P N++L    R L+  L+ E D+ Q++   A+RD   LK+ L+  
Sbjct: 1123 FDQISLK---DTDSIPINDELKSEARELISTLKRECDILQTKLELAKRDESNLKQKLEFT 1179

Query: 1032 TEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYL------------ 1079
             ++L++   EI +   T      +   + KI+ +L  +   +E N+ L            
Sbjct: 1180 EQELSVAKSEIRKSQVTSDTRSIMIEENSKILEQLNQVNLLRESNITLRNELQRKSQRNQ 1239

Query: 1080 ---------DESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAISEQEWQQKIETYQQES 1130
                      E++K L  D  TLQ              K  S I+E+     +  ++Q S
Sbjct: 1240 DLERNVEELQEALKPLENDILTLQRSVGAKD-------KQISLITEE-----VNRWKQRS 1287

Query: 1131 EKWKLMCQQMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNAS 1190
            +   L  +++      E + L ++L   +A+     Q+  +L DRF RLKKQA E+L+ +
Sbjct: 1288 QDILLKYERVD---PEEHKKLAEELSQARAEAAANAQQRSELEDRFQRLKKQARERLDNA 1344

Query: 1191 KATSDSLAIELSEL----KTVNDAL----------QEKLNNQETNSVDSESNAALILQ-- 1234
            + T ++L  EL+E     K + DAL          QE +   E N +++ S     LQ  
Sbjct: 1345 RTTQNTLNAELTEARESQKALEDALDKEREKTRSLQESIKATEENEIENSSATRDQLQDA 1404

Query: 1235 -LKEENKQAK-------------SLELEL---RHSVDSSEKLIADMTKELTTLKE--NPI 1275
              K E+ QA+             +L  EL   R  V   E+ +A    E+  L+E  N +
Sbjct: 1405 LQKLEDAQARINEMSTAPSQEEQTLREELERTRQHVKQLEEHLAKTQNEVRVLEEAKNQV 1464

Query: 1276 QGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXXXXXXXXXXXX 1335
             G+         + ++K+E  D    L+ +  +E+ E++E+                   
Sbjct: 1465 SGT------EAEIARVKTELIDHSNKLLAEKEAEIKEKYEKQRLEDKAELEKSLASSESL 1518

Query: 1336 XXX------------XXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQT 1383
                               T++RIEEA E L+K IRLPTEEKI ++I  RK +L+E+F+ 
Sbjct: 1519 KSSDIENLKKEWEEEYEQRTIKRIEEANEILRKRIRLPTEEKINKIIENRKRELDEEFEA 1578

Query: 1384 KVAEQANLLK--------LSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQ 1435
            K+ ++ + L          +E+  +   E+EK ++ ++K  ++E+    KKKAF+EG+QQ
Sbjct: 1579 KLQQRTSELAGEKPLPATFTEVMKRHKQEVEK-LKADMKREMDEEVAQAKKKAFDEGKQQ 1637

Query: 1436 ASMKTTLLERKI 1447
            ASMK+  LE+KI
Sbjct: 1638 ASMKSMFLEKKI 1649

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  214 bits (545), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 321/1179 (27%), Positives = 548/1179 (46%), Gaps = 149/1179 (12%)

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQK 360
            L+ QMESF+ ELE + P L   +++ + ++Q+L  +T+ +   S AK + ++EL+S RQK
Sbjct: 385  LQNQMESFIKELERKTPELISFKERTESLEQELKNSTDLLETISLAKRKDEKELTSLRQK 444

Query: 361  VDHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVLPPSELSFIKTIIENENWDAYK 416
            +++     H L  QR DLA Q++ LL     V    + L   EL  +K ++E+ +    K
Sbjct: 445  INNCEANIHSLVKQRLDLARQVKLLLLNISAVQKKASPLSNDELISLKKLLESGDVPNEK 504

Query: 417  DSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAK 470
            DSQ I+++RL+ F+N  ELQE+NM+L++ VR L DK+E+ E   D  L      T++ AK
Sbjct: 505  DSQIIITERLVEFNNTNELQEKNMELLNCVRVLADKLENHEGKQDKSLAKLENQTIKEAK 564

Query: 471  LQISKLEQSNAQLESEV------KNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESK 524
              I +LE  N+ LES +      ++   L+ +           N T     KKI+ELES+
Sbjct: 565  DAIIELEHVNSTLESRIDILSRERDSYKLLASANGNKIYADAANKTEAANLKKIKELESE 624

Query: 525  LTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKR 576
            L+            L K    N + +  LN+++    KS  N +  L        +A ++
Sbjct: 625  LS------------LTKV--ENSAVVQRLNKELLTCKKSQSNGQIALQEFSNFKVLAIEK 670

Query: 577  ENLSLTQQISTKQNELDELNSKSAQKERDYQLKI--------AELSVAANKCKSWENSFH 628
            ENL         Q  +D+L +K  ++       I         ELS   NK KS      
Sbjct: 671  ENLL--------QTRIDDLKTKLEKQRSSAPSSIHGSIGSEETELSQYKNKTKSLMCEIS 722

Query: 629  LLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKIT 688
             L+++ T +   + SL   +++  K+ +QL+ +  E E   + ++L     +   ++KI 
Sbjct: 723  NLSKKNTDLRCMKESLTRDLERCCKEKMQLQMKLTESETSHNEQKLKSDSKQVQYNTKIK 782

Query: 689  FLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLR 748
             L +  + L+N L  K +E++        Q+KW Q  ID+  +  K+ S  + E    +R
Sbjct: 783  NLEKNCEELNNRLHSKVQEIETLQTSKNSQLKWAQNTIDDTEKNMKSLSTDLSEKKTTIR 842

Query: 749  LLSEKSLSNKPYPVGTELKELQNELNGMKAALEV------SESQATLYKDTLERNQ---- 798
             LS             E+K+L+ EL   K   ++      + +  T  K  LER+Q    
Sbjct: 843  KLS------------LEMKDLEIELQKTKLQYKLLNNSSDANTLETALKKELERSQIDLK 890

Query: 799  ------NFYNNSTLSFQNTISELQSKNEALSKQHETLQ--NQITETENQSKGIQLEHQTI 850
                    Y     + +NT+ EL   N+ L+K  E L+  +Q  + EN +K    E  + 
Sbjct: 891  DAHSQIEAYEEIISTDENTLKEL---NDQLTKTKEELKVKSQSLDEENNAKE---EEISF 944

Query: 851  IDRLTSEKTALEEKLNS----LSHSEEKIAEMKGEYDA---QIQKIESNLKIQSDTRLNF 903
            + R   E   L+ KL      L    EK+        A   +I K+ + +++  +   + 
Sbjct: 945  LRRELDEIRGLQPKLKEGALRLVQQSEKLGNQTQRIQAMNEKIDKMTTIVELHQEVETSQ 1004

Query: 904  ESALTSKEKELTSYAVQIEQ----LNTEIAKLNSDIAALTEPAEAR-KTLIKERDSLGQE 958
              A     K+L++  +++E       TE+ K  S + +  E  +   +  ++E+    +E
Sbjct: 1005 YQAKLKANKDLSALVLRLENEVLDYQTELKKTKSSLHSTQELLDKHERKWMEEKADYERE 1064

Query: 959  LKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED-----LRNLVINLRIERDMHQSQ 1013
            L    ++ ESL  +NS L +        D   E N D     L +L  +LR ER+  +++
Sbjct: 1065 LISNIEQTESLRVENSALVEKID-----DGTGENNGDKEYLKLVSLFSSLRHERNTLETK 1119

Query: 1014 ETTAQRDVKL-------LKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMREL 1066
             TT +RD+ L       L+K++ ++ +   ++  ++   T+   D+F      E IM+E+
Sbjct: 1120 LTTCKRDLALAKQKNANLEKSVNDMQQTHLVSRKDVQCSTDI-IDEF------EDIMKEI 1172

Query: 1067 EGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAISEQEW--QQKIE 1124
              +   KE N  L +S+K + E    +              + + +   EQ      K+ 
Sbjct: 1173 AQVNILKENNTILQKSLKKVTEKNEAIYKEHTSLQYEISQLQGDLAQTKEQVSVNANKVL 1232

Query: 1125 TYQQESEKWKL----MCQQMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLK 1180
             Y+ E E+WK     + QQ  E    E + L  ++   KA +      N DLND+F RLK
Sbjct: 1233 VYESEIEQWKQRYDNLSQQQKETHKDETEKLFNEISDLKAKLLNAQNANADLNDKFNRLK 1292

Query: 1181 KQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENK 1240
            KQAHEKL+ASK    +L  E+ ELK + + L+E L+++E+  ++ E+      +LK+   
Sbjct: 1293 KQAHEKLDASKKQQTALTNEVDELKDMKNELEESLHSEESKVLELEA------KLKKHLV 1346

Query: 1241 QAKSLELELRHSVDSSEKLIADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKR 1300
            QA+ +      S D  E     + +E+  LK   +Q      D +  +E++K   E EK 
Sbjct: 1347 QAEGV------SKDQEEDTSKPLMEEIELLKR-ELQVFKETSDSSDTIEKMKEIMEAEKN 1399

Query: 1301 VLIEKTTSELTERFE----RXXXXXXXXXXXXXXXXXXXXXXXXXXTLQRIEEAKENLKK 1356
             +IE+ T+E   + E    +                          T++RI+EA+ENLKK
Sbjct: 1400 KIIEEKTTEFERKLEEATGKNTGATIENGENMEELKKQWLKQYEEETMRRIKEAEENLKK 1459

Query: 1357 HIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLS 1395
             IRLP+EE+I+++I+KRK +LE++FQ K+   +    LS
Sbjct: 1460 RIRLPSEERIQKIISKRKEELEQEFQRKLKANSGSFTLS 1498

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score =  205 bits (521), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 342/1353 (25%), Positives = 611/1353 (45%), Gaps = 177/1353 (13%)

Query: 161  KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220
            KL Q  S  +++   N  LL+  +++++ + +K    K L D  S ++ +F +E+  +  
Sbjct: 219  KLYQMQSNYESVFTYNKFLLNQNKQLSQSVEEKVLEMKNLKDTASVEKAEFSKEMTLQKN 278

Query: 221  LNAVLKKQVNSLHSELG---------NGGETPAHAEPNDQF---------AKQSSQHEEE 262
            +N +L+ Q+ SL  +           N    P H +  D+          +K   Q  + 
Sbjct: 279  MNDLLRSQLTSLEKDCSLRAIEKNDDNSCRNPEHTDVIDELIDTKLRLEKSKNECQRLQN 338

Query: 263  ISNYKEQVEELLGILGQGAPSIAHX-------XXXXXXXXXXNVSLKKQMESFVIELEHR 315
            I     + EE        +P++                       L+ Q+E F++ELEH+
Sbjct: 339  IVMDCTKEEEATMTTSAVSPTVGKLFSDIKVLKRQLIKERNQKFQLQNQLEDFILELEHK 398

Query: 316  LPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQR 375
             P L   +++ K ++ +L  +T  +   S  K + +RE++S RQK++      H L  QR
Sbjct: 399  TPELISFKERTKSLEHELKRSTELLETVSLTKRKQEREITSLRQKINGCEANIHSLVKQR 458

Query: 376  SDLAHQIQFLLTVNSS--DTVLPPS--ELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431
             DLA Q++ LL   S+  +T  P S  EL  ++ I+E+ N     DSQ I+++RL+ F N
Sbjct: 459  LDLARQVKLLLLNTSAIQETASPLSQDELISLRKILESSNIVNENDSQAIITERLVEFSN 518

Query: 432  IPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQLES 485
            + ELQE+N++L++ +R L DK+E++E   D  L      T++ AK  I +LE  NA++E+
Sbjct: 519  VNELQEKNVELLNCIRILADKLENYEGKQDKTLQKVENQTIKEAKDAIIELENINAKMET 578

Query: 486  EVK-------NWEALMETLKDGDSLDSKINVTMVE--QQKKIEELESKLTDVGESHVQKI 536
             +        +++ L  T ++  + +S   VT +E  ++KKI ELE++L+          
Sbjct: 579  RINILLRERDSYKLLASTEENKANTNS---VTSMEAAREKKIRELEAELSS--------- 626

Query: 537  NVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKRENLSLTQQISTK 588
                 T   N + I  L +++    KS    K+ L        +A ++E + L + I   
Sbjct: 627  -----TKVENSAIIQNLRKELLIYKKSQCKKKTTLEDFENFKGLAKEKERM-LEEAIDHL 680

Query: 589  QNELDELNSK-----SAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRS 643
            + EL++  S        +KER       ELS +  K KS E     L +E       + S
Sbjct: 681  KAELEKQKSWVPSYIHVEKERAS----TELSQSRIKIKSLEYEISKLKKETASFIPTKES 736

Query: 644  LFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAF 703
            L    +Q  K+  +L+ R KE E+  +  ++     E    +KI  L    + L +DL  
Sbjct: 737  LTRDFEQCCKEKKELQMRLKESEISHNENKMDFSSKEGQYKAKIKELENNLERLRSDLQS 796

Query: 704  KEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPV- 762
            K +E++      + Q+KW Q  ID+   + K+             LL+E  LSNK   + 
Sbjct: 797  KIQEIESIRSCKDSQLKWAQNTIDDTEMKMKS-------------LLTE--LSNKETTIE 841

Query: 763  --GTELKELQNELNGMKAALEVSE--SQATLYKDTLERNQNFYNNSTLSFQNTISELQSK 818
               +E++ L  EL   K   +  +  S A+  + TL +         +  ++  S++Q+ 
Sbjct: 842  KLSSEIENLDKELRKTKFQYKFLDQNSDASTLEPTLRKE---LEQIQVQLKDANSQIQAY 898

Query: 819  NEALSKQHETL---QNQITET-ENQSKGIQLE------HQTIIDRL---TSEKTALEEKL 865
             E +S     L   +N++ +T EN    I+LE       +  + RL     E  AL+ KL
Sbjct: 899  EEIISSNENALIELKNELAKTKENYDAKIELEKKEKWAREEDLSRLRGELGEIRALQPKL 958

Query: 866  NSLS-HSEEKIAEMKGEYDA------QIQKIESNLKIQSDTRLNFESALTSKEKELTSYA 918
               + H  ++  +++ E +       +I+K+ + +++     ++   +   + K+L+   
Sbjct: 959  KEGALHFVQQSEKLRNEVERIQKMIEKIEKMSTIVQLCKKKEMSQYQSTMKENKDLSELV 1018

Query: 919  VQIEQ----LNTEIAKLNSDIAALTEPAEAR-KTLIKERDSLGQELKLANQRIESLAAQN 973
            +++E+       E+ K  S + +  +  +   +  ++E+    +EL    ++ ESL  +N
Sbjct: 1019 IRLEKDAADCQAELTKTKSSLYSAQDLLDKHERKWMEEKADYERELISNIEQTESLRVEN 1078

Query: 974  SILYDTFSGMRHVDADAEPNED-----LRNLVINLRIERDMHQSQETTAQRDVKLLKKNL 1028
            S+L      +  VD  A  N D     L +L  NLR ER+  +++ TT +R++  +K+  
Sbjct: 1079 SVL------IEKVDDTAANNGDKDHLKLVSLFSNLRHERNSLETKLTTCKRELAFVKQK- 1131

Query: 1029 KEITEKLAITCPEIDEPTNTEKDDFSLTVT----HEKIMRELEGLTNTKEENLYLDESIK 1084
                + L  T  ++       + ++  +       + I +E+  +   KE N  L +S+K
Sbjct: 1132 ---NDSLEKTINDLQRTQTLSEKEYQCSAVIIDEFKDITKEVTQVNILKENNAILQKSLK 1188

Query: 1085 SLNEDKRTLQXXXXXXXXXXXXAKKNSSAISEQEW--QQKIETYQQESE----KWKLMCQ 1138
            ++ E  R +              +++     EQ      KI  Y+ E E    +++ + Q
Sbjct: 1189 NVTEKNREIYKQLNDRQEEISRLQRDLIQTKEQVSINSNKILVYESEMEQCKQRYQDLSQ 1248

Query: 1139 QMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLA 1198
            Q  +    +I+ L  ++   K  +      N DL ++F RLKKQAHEKL+ASK    +L 
Sbjct: 1249 QQKDAQKKDIEKLTNEISDLKGKLSSAENANADLENKFNRLKKQAHEKLDASKKQQAALT 1308

Query: 1199 IELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEK 1258
             EL+ELK + D L++ L+ +    +D        L  K +  + +S ++   H  D+   
Sbjct: 1309 NELNELKAIKDKLEQDLHFENAKVID--------LDTKLKAHELQSEDVSRDHEKDTYRT 1360

Query: 1259 L---IADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSE----LT 1311
            L   I  + KEL   K             +   E+LK   E EK  +I++ T E    L 
Sbjct: 1361 LMEEIESLKKELQIFK--------TANSSSDAFEKLKVNMEKEKDRIIDERTKEFEKKLQ 1412

Query: 1312 ERFERXXXXXXXXXXXXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIA 1371
            E   +                          TL+RI+EA+ENLKK IRLP+EE+I+++I+
Sbjct: 1413 ETLNKSTSSEAEYSKDIETLKKEWLKEYEDETLRRIKEAEENLKKRIRLPSEERIQKIIS 1472

Query: 1372 KRKAQLEEQFQTKVAEQANLLKLSELSNKTADE 1404
            KRK +LEE+F+ K+ E A  L    L NK + E
Sbjct: 1473 KRKEELEEEFRKKLKENAGSLTF--LDNKGSGE 1503

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score =  174 bits (441), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 382/1592 (23%), Positives = 691/1592 (43%), Gaps = 258/1592 (16%)

Query: 147  DFQRD-DRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLS 205
            D++ D D + G +  K +    E++  +   ++L+   ER+++EL  + A  + L D   
Sbjct: 154  DYEADLDSKTGALVSKEE----ELRLAKSERASLISQTERLSQELLQRDADIRQLVDADK 209

Query: 206  SQRHDFERELATRDKLNAVLKKQVNSLHSELG-NGGETPAHAE---PNDQFAKQSSQHEE 261
             ++ ++  E+  +     +L++QV SL  E    G ET    E   P ++ A Q   H  
Sbjct: 210  LRQDEYTDEINLQKHRARLLQEQVASLEKEAKLVGHETEPEYEIPPPGEEVALQQRSHSI 269

Query: 262  EISNYKEQVEELLGILGQGAPSIAHXXXXXXXXXXXNVSLKKQMESFVIELEHRLPGLQI 321
             + +     +E    + +   +I+               L+KQ+  FV ELE   P ++ 
Sbjct: 270  SMDSLLTGNDETSHSMSELNNNISILSNRLKRETLSKQKLEKQVHKFVTELEQTAPIIKS 329

Query: 322  LEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKLRVQRSDLAHQ 381
             ++++++   ++H     +   +K K    +E+   +++++ ++     LR +R DLA Q
Sbjct: 330  FKQKSEQSDAQIHKLQLHLEHVTKDKETIFQEVEQYKKQLEQISGQDKILRRERFDLARQ 389

Query: 382  IQFLLT---VNSSDTVLPPSELSFIKTIIEN---ENWDAYKDSQRIVSDRLLRFDNIPEL 435
            +Q+LL    V  SD  L  SE S+IK I+     E   +  DSQ I+S R+L+F +I EL
Sbjct: 390  LQYLLLNGFVKDSDDPLTSSEFSYIKEILNTDPEEGNTSSTDSQLIISKRMLKFKSIVEL 449

Query: 436  QEQNMKLVSTVRSLVDKVESWEADNDSGLTLEA---AKLQISKLEQSNAQLESEVKNWEA 492
            Q+QN+ L+S VR+L D+ E+ E   +SG ++EA   AK  +  L+Q N+ LE++V++   
Sbjct: 450  QQQNINLLSAVRTLSDRAETLERKLESGDSIEAINEAKQTLLDLQQYNSSLEAKVESLTN 509

Query: 493  LMET----------------LKDGD---SLDSKINVTMVEQQKKIEELESKLTDVGESHV 533
             ++                 L DG+   +L +K +  M E  + I  L S++ ++ +S  
Sbjct: 510  KLKANEHFTSIGDGEFGNSDLSDGNNIQALKNKYDSLMAESSETIGHLYSQINNLQQSKS 569

Query: 534  QKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELD 593
                 L K  +   ++ +++ +++K  +  DM     L   K EN +L  +I      L 
Sbjct: 570  D----LAKECESLINSKHLIEDRLK--ITQDM-----LDLSKNENSTLRNRIKNTSQALK 618

Query: 594  ELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESK 653
            E   +++Q  + Y   +A+L V     +  EN+      EK  ++  Q S+ +K+ Q  K
Sbjct: 619  EREVETSQTIKKYLDCVAKLDVIQ---RQLENTLV----EKDILQNAQSSIENKLNQALK 671

Query: 654  KLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIE 713
            +    +    +L      ++   K  + +L +KI  L  EN  L N +  KE      + 
Sbjct: 672  ERNNFQGLIPQLRALQKNQDEQLKDIQVSLQNKIDDLELENTELRNKIDTKETSPSSALT 731

Query: 714  KSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLR-----------LLSEKSLSNKPYPV 762
              + +++WYQ   D LS  N   + K+IE    +            LL E +  NK    
Sbjct: 732  NPKAELEWYQTKFDSLSGSNDALNEKMIECASTIETLTVKTQTLDILLQEANSKNKLL-- 789

Query: 763  GTELKELQNELNGMKAALEVS-ESQATLYKDTLERNQNFYNNSTLSFQNTI-------SE 814
              E +E  +++N +  ALE    +  T   DT  R     +N+   +Q+ I       SE
Sbjct: 790  --EARETVDDVNKLTGALETELATSRTRLTDT-SRELEISSNTIRQYQSEIKVLNERQSE 846

Query: 815  LQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEK 874
            L+++N+ L  +   L++++T       G + E          EK AL +KL++L   + +
Sbjct: 847  LENENKHLRDEIAILRDELTHN-----GGEFER---------EKEALMKKLSNLEIRQAE 892

Query: 875  IAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTS--YAVQIEQLNTEIAKLN 932
            + +++ +Y A+I+K    LK+  D +     A+  KE +L       +++  NTE  +  
Sbjct: 893  LTKLEEDYTAEIEK----LKLDLDKQ-----AMLGKEIKLAHDEEVREVQNRNTETYRNE 943

Query: 933  SDIAALTEP---AEARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRH---- 985
             ++  + +     E  K L      L ++++L  +R++  + + S+L +    +      
Sbjct: 944  LELVEIRQTKVFVEKEKELESRIKILNEQIELDKERMKQFSDEESLLREQVKLLADEKAS 1003

Query: 986  --VDADAEPNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEID 1043
              VDA   P  +  +LV  L  E+   +S+   +Q +   L++ L +   ++A+     +
Sbjct: 1004 DLVDAGVSP--EYTDLVRKLSDEKKNLESKLFASQSEKNRLREQLTKTESEIAVLNMNYE 1061

Query: 1044 EPTNTEKDDFSLTVTHEKIMRE--LEGLTNTKEENLYL-----------DESIKSLNEDK 1090
            +     K + +  V +E    E  +  L + KE N+ L            E I  LNE K
Sbjct: 1062 QA----KKEVAAEVNNESGRAEEHIAQLESLKESNMSLTNEVKLAQMRNGEIIAELNELK 1117

Query: 1091 RTLQXXXXXXXXXXXXAKKNSSAISEQEWQQKIETYQQESEKWKLMCQQMSEN----TAT 1146
               +                 + +S ++   K+   Q E  + K     M +N    +++
Sbjct: 1118 TKFKSVESQLDEAR-------NVLSSKDM--KLMELQTECSRLKATSHDMPQNGNKDSSS 1168

Query: 1147 E-IQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELK 1205
            E +  LQ  + T    +      N +L DRF RLK+QA E+L+ASK T +SL   +  L 
Sbjct: 1169 ELVGALQSSVATLTEQVDNLKHANTELEDRFGRLKRQARERLDASKVTINSLRDNVETLT 1228

Query: 1206 TVNDALQEKL--NNQETNSVDSE-----SNAALILQLKEE----NKQAKSLELELRHSVD 1254
                ALQ+ +  +  E N + ++       +A++ +LK E      + K +E EL  +  
Sbjct: 1229 KDKTALQDVIERSKDELNELRAKIQEHIETSAVMKELKTELAAVMSKNKDIEAELNETSK 1288

Query: 1255 SSEKLIADMTKELTTLKEN-----------PIQGSVNVEDYTHRLEQLKSEFEDEKRVLI 1303
            SS +L   + +E+ +LK             P QG+   E+ +  +E ++  FEDEK   +
Sbjct: 1289 SSNQLTTALNEEIESLKHEVQYLKEASSAEP-QGN---EEMSGVVESMRKAFEDEKIAFM 1344

Query: 1304 EKTTSELTERF--ERXXXXXXXXX----------------XXXXXXXXXXXXXXXXXTLQ 1345
            + T+ +   R   ER                                          TLQ
Sbjct: 1345 KATSEDSEARLAEERGKLKREMEALEKEKDSLVMEKTRLGEENTALMKARSDVPDIETLQ 1404

Query: 1346 RIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTADEL 1405
            +  EA    K+ + L  +EK ++++  +  +LEEQFQ +V  +           K  + L
Sbjct: 1405 KQWEASN--KERLVLLYKEKSDQMMRAKMDELEEQFQNRVRNK----------EKELNAL 1452

Query: 1406 EKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPLKSAN 1465
            + E+ E+ KT  E+    +KK+AFEEG+QQA+MK ++LERKIAKLEA     +   KS +
Sbjct: 1453 KDEIEEKCKTGHEDTLIAVKKRAFEEGKQQATMKMSILERKIAKLEAE----SKATKSGS 1508

Query: 1466 GLNKINIDSPLMVAG-----PLTNEPVLDEKPNAFAGAXXXXXXXXXXXXAKDSANAFSF 1520
             ++ ++ D+P  V          N+P L     A AG+                     F
Sbjct: 1509 DMS-VSEDAPRFVTPNNNKVQQANQPFL-----ATAGS--------------------GF 1542

Query: 1521 NAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGTPFRFGFASNPPTPFQN 1580
            + Q   + P  +  ++ A              +H N+   +   P  F   S PP     
Sbjct: 1543 SVQSSESNPFTTPVSRGA--------------AHTNASSQSKFAPT-FLLNSQPPVLVSG 1587

Query: 1581 TAENGTDAKRKSQT--EASKEV----EDNKRP 1606
            +++   D  R +    +A   V    E+NKRP
Sbjct: 1588 SSDEDNDTMRGTSVDEDAGTAVPSLNENNKRP 1619

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope, connects the nuclear pore complex with
            the nuclear interior; involved in the Tel1p pathway that
            controls telomere length; involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1771

 Score =  171 bits (433), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 247/923 (26%), Positives = 425/923 (46%), Gaps = 152/923 (16%)

Query: 679  SEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSE------- 731
            +E++   K+  L  E   L   L+ K+EE   FI+ ++ + +WYQ+ ID L+E       
Sbjct: 801  TEKSYKEKVDALEVEASQLRTQLSRKDEEFNDFIQTNDSRSQWYQEKIDSLNETLKVVTS 860

Query: 732  --QNKNKSNKIIE-----LNDKLRLLSEKSLS----NKPYPVGTELKELQNELNGMKAAL 780
              +++ ++ + +E     L  +L+ +  K+ S    N+   V  + + L+ EL   K  L
Sbjct: 861  QLESQAQTTRDLESQKKLLEGRLKEVETKAQSYDVLNQTDDVLAQTEALRMELEKSKIKL 920

Query: 781  EVSESQA----TLYK----------DTLERNQNFYNNSTLSFQNTISELQSKNEALSKQH 826
            + + SQ     + YK          +  ER   F N  +  F N    ++ K + L  Q 
Sbjct: 921  QDAYSQIEEHRSRYKSAEEALSAITNAFER---FKNEHSKDFGN----MKKKEDELVGQV 973

Query: 827  ETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQI 886
            E L++QI+   N+     L HQ    +  SEK  LE +L SL  ++E +  MK  Y+ Q+
Sbjct: 974  EALKHQISNLNNE-----LGHQK--KQFDSEKNELENQLVSLQSTQETMNSMKEHYEQQL 1026

Query: 887  QKIESNLKIQSDTRLNFESALTSK-----EKELTSYA---VQIEQLNTEIAKLNSDIAAL 938
             K+  +L        N ++A  +K     E+EL  +A     I QL  E  K  +  + L
Sbjct: 1027 GKLTQDL--------NQQAAFANKAQENYEQELQRHADVSKTISQLREESQKYKNQASVL 1078

Query: 939  TEPAEARKTLIKERDS--LGQ------ELKLANQRIESLAAQNSILYDTFSGMRHVDADA 990
                E  +  + E D   L Q      +L+  NQRIE L  QN +L D    +   D ++
Sbjct: 1079 QSSIEQLEKTLDESDGKWLNQKEEYEAQLRSLNQRIEDLTVQNGLLLDQL-DLEAKDPNS 1137

Query: 991  E-----PNEDLRNLVINLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEP 1045
            E     P E +R L+ +LR ERD+ Q++   ++R   +  + L+ I ++L+    E+   
Sbjct: 1138 ELGQSEPQEKVRELITSLRRERDILQTKLEVSKRSETVSLRKLEAIEQELSFAKEELSSL 1197

Query: 1046 TNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLDESIKS-------LNEDKRTLQXXXX 1098
                  +  +   H K++ +L  L   +E N+ L   ++        L      LQ    
Sbjct: 1198 QALSSQNSIMADEHNKLLEQLNQLNLLRESNITLRSEVQKKTQRCQELEGQIDNLQQSLQ 1257

Query: 1099 XXXXXXXXAKKNSSAISEQEWQQKIETYQQESEKWKLMCQ----QMSENTATEIQNLQQQ 1154
                     K++  A   Q     I    +E+ +WK   Q    +       E + L ++
Sbjct: 1258 PLESELASLKRSVRAKDSQ-----ISLISEETNRWKQRSQDILSKFERIDPEEHKKLGEE 1312

Query: 1155 LETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELK--------- 1205
            L   KA++  K  +N +L DRF RLKKQA E+L+A+KA  ++L++EL++ +         
Sbjct: 1313 LSQAKAELAAKADQNSELEDRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQ 1372

Query: 1206 -----TVNDALQEKLNNQETNS-VDSESNAAL---ILQLKEENKQA-----------KSL 1245
                  VN ALQE L   E+ +  DS +   L   + +L +  K+A           K+L
Sbjct: 1373 LRKEQDVNKALQESLQRVESEAKADSTTQPELESALQKLSQAEKKAQDIESDRAQIEKAL 1432

Query: 1246 ELELRHSVDSSEKL---IADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVL 1302
            + EL      +E+L   + +  +E+ +L+E   QG+      +  LE++K + E+    L
Sbjct: 1433 QSELEKVKSHAEELERRLDEARREVESLEEVK-QGAFT---DSSELEKMKRDLEEHSNTL 1488

Query: 1303 IEKTTSELTERFERXXXXXXXXXXXX------------XXXXXXXXXXXXXXTLQRIEEA 1350
            I +  +E+   +E                                       T++RIEE+
Sbjct: 1489 IAEKEAEIRSHYEELRLKEKATYEKELEENGKHTPVDIETLKKQWEEDYEQKTIKRIEES 1548

Query: 1351 KENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLL--------KLSELSNKTA 1402
             E L+K IRLPTEEKI +++  RK++LE++F+ K+ ++A+ L          +E+  +  
Sbjct: 1549 NEILRKRIRLPTEEKINKIVETRKSELEQEFEAKLQKRASELANEKPQPASFTEVMKRHK 1608

Query: 1403 DELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQG-GTGPL 1461
             E+EK ++ ++   ++E+   ++KKAF+EG+QQASMK+  LE+KIAKLEA+++  GT  +
Sbjct: 1609 QEMEK-LKADLTREMDEEMAQVRKKAFDEGKQQASMKSMFLEKKIAKLEAQVKASGTEAV 1667

Query: 1462 KSANGLNKINIDSPLMV--AGPL 1482
             SA        + P+ +  A PL
Sbjct: 1668 PSAPTSKNSPTEKPVRILEASPL 1690

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score =  160 bits (406), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 289/1108 (26%), Positives = 515/1108 (46%), Gaps = 159/1108 (14%)

Query: 301  LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKMIE-ESKAKIRTQRELSSSRQ 359
            L++Q+E FVIELE++LP +  L+ +N+ ++Q+L   T  + E E ++ IR  +EL++  +
Sbjct: 376  LQEQVELFVIELENQLPTVNSLKDRNQTLEQELMQITGLLEETERESDIRI-KELTTENR 434

Query: 360  KVDHLNQIFHKLRVQRSDLAHQIQFLLT----VNSSDTVLPPSELSFIKTIIENENWDAY 415
            ++    +  + L  QR DLAHQ+QFLL           +L P E++F++ II++ N    
Sbjct: 435  RLKEQTENINVLMSQRVDLAHQVQFLLLNLDLKKHQQHLLTPDEITFLRKIIKSRNSQND 494

Query: 416  KDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISK 475
             DSQ+I+S+RL++F +I  LQ+QNM+L++T R+L +++ES +  +   +T   +K +I+K
Sbjct: 495  SDSQKIISERLVKFHDISVLQKQNMELLTTTRNLAEQLESSDTKSVQKITRNESKEKIAK 554

Query: 476  LEQSNAQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDVGE----- 530
            L++S   L S+++     ++  KD   L S  N     +Q   EEL S+L    E     
Sbjct: 555  LQESINGLTSKLEK----LQKEKDAYKLLSLQNTG---EQTPTEELRSQLQKKEEQLTKL 607

Query: 531  -------SHV--QKINVLNKTIDR-NQSTINMLNEQIKNTVKSDM-NAKSELIACKRENL 579
                   SH+  +K  VLN++I +  +   ++ N  IK T +  +   KS+++    E L
Sbjct: 608  ERMSSLDSHLAEEKAKVLNQSIIKLKKEKYDLNNAIIKETSQRAIAEKKSKMLEDSLELL 667

Query: 580  SLTQQISTKQNE-----LDELNSKSAQKERDYQLKIAELSVAANKCKSW----------- 623
                 ++ K+ E     L++ N+++ +  R+ +   A++S+   + +S+           
Sbjct: 668  HKKYDLAVKKYEHYETLLNDHNAENIKHSRENETTQAKISILQKEIESYKQNLLQYSKDN 727

Query: 624  ENSFHLL---TEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSE 680
            EN+   L   T+EK  +  +  ++ ++++Q+   + + ET  KE +  IS + L  K+S+
Sbjct: 728  ENTLSKLAAATQEKETLGSRLSTVKNELEQKINLMQERETYYKEHD-SISERLL--KKSK 784

Query: 681  ETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKI 740
              L  KI                  +EVK F  K   QI WYQ+ +D L+  N    +K+
Sbjct: 785  IQLEDKI------------------KEVKDFEAKKNSQINWYQKRLDSLTTTN----DKL 822

Query: 741  -IELNDKL--------------RLLSEKSLSNKPYP--------VGTELKELQNELNGMK 777
             +ELN +L              + LS+ +  +   P        +  ELKE Q E+N  +
Sbjct: 823  QVELNKELTKINIQRLKISDLEKTLSQNTNGSSSLPRVDQDFEKLKNELKEKQLEINQYR 882

Query: 778  AALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETE 837
              L ++E      +  L + +   +++    +    +L    +  S  +  LQ Q  + E
Sbjct: 883  DLLNLAEETKNRLQKDLNKQRQIVDDAMEGKEQLDQQLAELTQECSSMNSLLQKQKAKCE 942

Query: 838  NQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIE--SNLKI 895
            +  K IQ            + T  E   NSLS  E KI  ++ E   + +  E   N   
Sbjct: 943  DDQKIIQ-----------DKATETENLKNSLSSLENKITTLENEMVEKTKSFEEKENTYK 991

Query: 896  QSDTRLNFESALTSK-EKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKER-- 952
            +   +L+  S L  K E E  +Y   ++ L   IA     I+A       R+ L+ E+  
Sbjct: 992  EQLHKLSESSTLIEKMEAENKAYKTSLDGLKANIAAYEDAISAY------RQKLLDEKFN 1045

Query: 953  -----DSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNE--DLRNLVINLRI 1005
                 D   + +   N +I     + S +    S   +   +   N+  D   L++ LR 
Sbjct: 1046 HELQVDEFKETIDNLNFQIHIQKGKRSFITSEGSTTSNDTDETVVNDTSDKNELILALRR 1105

Query: 1006 ERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRE 1065
            ERD    +   +QR+V  L++ ++ +   L  T        +    + + T  H++ +++
Sbjct: 1106 ERDGLDIKLDISQREVYSLREQVENLKNSLDETRQSFKGLESEVSGEMTTTEQHKEAVKQ 1165

Query: 1066 LEGLTNTKEENLYLDESIKSLNEDKRTLQXXXXXXXXXXXXAKKNSSAI--SEQEWQQKI 1123
            L  L   KE N  L + ++  +++   +              K     +  S  E  Q++
Sbjct: 1166 LNELNTLKETNEQLQQKLRENDKENNIIHTKLELLKNEMNPLKDKVERLKNSIMEKDQQL 1225

Query: 1124 ETYQQESEKWKLMCQQM----SENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRL 1179
                +E+E+WKL  +++     +    E   L ++L T K  +  KT++N+DLNDRF RL
Sbjct: 1226 TLLSEENERWKLRSREILMKRQQVDLEEHNKLMEELSTLKTQLDTKTKDNEDLNDRFNRL 1285

Query: 1180 KKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESN----------- 1228
            KKQAHEKL+A+KA + SL  E+++L      L+  L+ +     + ES            
Sbjct: 1286 KKQAHEKLDAAKAQNASLTAEITDLIDAKSKLEIDLDEERKRIQEVESQLKQKPDNPDVI 1345

Query: 1229 AALILQLKEENKQAKSLELELRHSVDSSEKLIADMTKELTTLK--------ENPI----Q 1276
             AL  +L +  + +K +E  L+ +V+SS +L   +T+E+ +LK        +N +     
Sbjct: 1346 TALEKELSDSVENSKKIEENLQETVNSSLELNKKLTEEVNSLKSQLETLKNQNGVISVAD 1405

Query: 1277 GS-VNVEDYTHRLEQLKSEFEDEKRVLI 1303
            GS +N E   H    LK  FE EK  LI
Sbjct: 1406 GSAINSETIAH----LKESFEVEKTELI 1429

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score =  153 bits (386), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 314/1307 (24%), Positives = 566/1307 (43%), Gaps = 195/1307 (14%)

Query: 167  SEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLK 226
            SE++  R SN  L  S+  ++ +L  K + NK + D+ +  + +  +E++ + ++   L+
Sbjct: 234  SELEIARTSNQKLKQSVHSLHEQLEQKLSENKEIKDEYNFSKQELTKEMSLKQRMIDALE 293

Query: 227  KQVNSLHSELG---NGGETPAHAEPN-----------------------------DQFAK 254
            K + SL  E+    N  ++    E                               D+   
Sbjct: 294  KHMESLKKEMDATKNNMDSSYFTEKERDELIEELNAVKYRLDASESNCIKLKETIDELTS 353

Query: 255  QSSQHEEEISNYKEQVEELLGILGQGAPSIAHXXXXXXXXXXXNVSLKKQMESFVIELEH 314
                 + E+ N     E+ + ++ +    +                LK Q+E+FV+ELEH
Sbjct: 354  NIKLEDSEVGNTTASSEKSVSVIPKLYGDLGMLKKQLVIEKRQKDELKMQVEAFVVELEH 413

Query: 315  RLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQR--ELSSSRQKVDHLNQIFHKLR 372
            ++P L   +++++ ++++L+  T  ++ ES  K R Q+  +L   +  V         L 
Sbjct: 414  KIPVLNSFKERSEMLERELNEVT--ILLESTGKDRDQKSSQLDYLKATVKSYETQIASLS 471

Query: 373  VQRSDLAHQIQFLL---TVNSSDT-VLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLR 428
             QR DLAHQIQ+LL   ++ S D   L   EL F+K +  ++      D+Q I++DRL+ 
Sbjct: 472  KQRVDLAHQIQYLLVNESIKSEDGGPLSAEELQFVKNLTNSQEITKTSDTQGIITDRLVE 531

Query: 429  FDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNAQ 482
            F ++ ELQ++N +L+ST+R+L D++E  EA+N S +      T+  AK  I  L      
Sbjct: 532  FRSVVELQQKNSELLSTIRNLADELERREAENKSQIQVLEDETVREAKETILTLHDHAQN 591

Query: 483  LESEV-------KNWEALMETLKDGDSLDSKINVTMVEQQKKIEELESKLTDV---GESH 532
            LE+++         ++AL      G +    I     +   K+++LE++LT V    E++
Sbjct: 592  LENQLVILSKERDAYKALSVNASSGTNTPKAITYPSPDNDDKVKDLETRLTAVIQEAENN 651

Query: 533  VQKINVLNKTIDRN--QSTINMLNEQIKNTVKSD-MN-AKSELIACKRENLSLTQQISTK 588
             ++ +  N  + +   + ++N  +E+   T+  D +N  +S L   KR+   L ++ S  
Sbjct: 652  AKEWSSENSNLRKKLYEISLNFESEKTSRTLAEDRLNLLQSTLELSKRQCEELQKRSSDL 711

Query: 589  QNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSL---- 644
            Q+ L        ++++  Q  +  L    +   S ++   +L  EK  M + Q+ L    
Sbjct: 712  QDIL-------TKQDKRTQETVDSLIKTKSTLSSIQSELSILKSEKQFMAKVQKELKAEN 764

Query: 645  --FDKIQQESKKLL-QLETRNKELEVKI-----SGKELHRKRSEETLSSKITFLSEENKS 696
              F K   E K L+ QL+T  +E E+ +     S KE  RK   E LS  +  L E  K+
Sbjct: 765  ERFSKESVEYKVLIAQLQTLQREREMLLKETQNSYKEKLRKLEIE-LSGSLERLEEIEKN 823

Query: 697  LHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIE-----------LND 745
                 + KE            Q  W+Q+ ID+L+ +   +   + E           +N+
Sbjct: 824  TTGIASNKEH-----------QYNWFQEKIDKLTSEAAQQKTTLEEKEAQLQKMQSTINE 872

Query: 746  KLRLLSEKSLSNKPYPVGTELKELQN-------ELNGMKAALEVSESQATLYKDTLERNQ 798
            +   L E     + Y + + + + QN       EL  +   L  S SQ   +K   E++ 
Sbjct: 873  QSAKLKEAEARAQSYTMLSNVDDAQNLVETLRQELEKVNLQLSDSYSQIEHHKTLAEQSV 932

Query: 799  NFYNNSTLSF-------QNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTII 851
               N  + +F       Q TI  L+++   L      L +Q+ +  N+    + E+QT  
Sbjct: 933  QSVNEVSQAFEEAQKESQKTIITLENERNQLQSTVNILNDQVKDLNNEIFHQKSEYQT-- 990

Query: 852  DRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKE 911
                 E+ A  E+++ L   +E +   K +Y+ +I  I+ +L++Q  T+   ES   S E
Sbjct: 991  -----ERNATMEEISKLQMVKESVDRTKADYEEKIAMIQKDLEMQ--TQYANESQ-RSYE 1042

Query: 912  KELTSYA---VQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQE--------LK 960
             EL  +A     I  L TE     SD+  L   ++     +K  + L  E        L 
Sbjct: 1043 LELQKHADVSKTITSLRTEAQSYKSDLETLKTQSQLAMENLKNSEKLWNEQKTEYEDKLS 1102

Query: 961  LANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLVINLRIERDMHQSQETTAQRD 1020
            +  QR++ L+ QN +LYD    +   + D + + D  +L+I+LR ERDM +++   A  +
Sbjct: 1103 VLEQRVQELSTQNKLLYDQIELLNKTE-DRDNSHDSSDLLISLRRERDMLETKLEVALSE 1161

Query: 1021 VKLLKKNLKEITEKLAITCPEIDEPTNTEKDDFSLTVTHEKIMRELEGLTNTKEENLYLD 1080
              +LK+ L     ++     ++ +  N+  +   L    E IM+EL+ L   +E N+ L 
Sbjct: 1162 QTVLKQRLDIAKSEIEDLNTQLSQVKNSSSESAHLLEQQENIMKELDQLHLLRESNVTLR 1221

Query: 1081 ESIKSLNEDKRTLQXXXXXXX------XXXXXAKKNSSAISEQEWQQKIETYQQESEKWK 1134
                S  ++   L+                  + +N   I EQE  Q     ++E+E+WK
Sbjct: 1222 SENSSFKKECDNLKSQLQECNDRLAPLQSSISSLQNGIKIKEQELIQS----KEEAERWK 1277

Query: 1135 LMCQQMSENT-----------ATEIQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQA 1183
               Q +                 EI +++ +L+T K  +Q    E DD   +F R++ QA
Sbjct: 1278 SRSQDILHKYERIDPEEHGKLKEEINDVKNELQTTKDTLQSVIAEKDDWESKFQRIRLQA 1337

Query: 1184 HEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEE----- 1238
             ++LNASK    SL+ E++++      ++  L   +T   + E    ++ Q  E      
Sbjct: 1338 RDRLNASKEKEQSLSSEINQINEAKSQVEADLGKCKTACKELEERLQVVTQEAETKEQTF 1397

Query: 1239 NKQAKSLELELRHSV---------------DSSEKL-------------IADMTKELTTL 1270
            N Q   L+ +L HS+               DS EK+             I ++  E +  
Sbjct: 1398 NSQLSKLQEDL-HSIQVQMENASKTEQNNADSDEKIKSLTETVEMLNSKIQELEAEASNA 1456

Query: 1271 KENPIQGSVNV--EDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFE 1315
            ++   +    V  ED    ++ LK+EFE EK  LI+    EL  +FE
Sbjct: 1457 QKIVAEHHTPVINEDTKSIVDNLKTEFEAEKEQLIKDKEKELRSKFE 1503

 Score = 78.2 bits (191), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 75/115 (65%), Gaps = 8/115 (6%)

Query: 1343 TLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTA 1402
            TL++I+ A+E LKK IRLPT++KI++++  RKA LEE F+ KV E+A  L   E+ N  A
Sbjct: 1564 TLEKIKLAEEALKKRIRLPTQQKIDKIVEARKAVLEESFEEKVNEKAQKLA-GEIGN-DA 1621

Query: 1403 DELEKE------VREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLE 1451
              LEK       +++ ++ + E D   +K+K+FEEG+QQ S+K   LE KI  LE
Sbjct: 1622 ITLEKHRAELNALKDSMRKQFEADLAEIKQKSFEEGKQQVSLKLKFLESKIRNLE 1676

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
            (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score =  140 bits (354), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 159/539 (29%), Positives = 260/539 (48%), Gaps = 72/539 (13%)

Query: 941  PAEARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNEDLRNLV 1000
            P E  K L    + + +EL+    R+++LA QN +L +      +++ D        ++ 
Sbjct: 714  PIEEEKNL----ELITKELEDTKVRVQNLATQNRLLLEKLERSANLEVD--------DIF 761

Query: 1001 INLRIERDMHQSQETTAQRDVKLLKKNLKEITEKLAITCPEIDEPTNTE---KDDFSLTV 1057
            ++LR ERD    Q    ++D++++  +L+ +  +L     +I    N     +D     V
Sbjct: 762  VSLRYERDTLSDQVVNYEKDMQVILADLESVQSELNAANSQILNFENQRAMVQDHKKGNV 821

Query: 1058 THEKIMRELEGLTNTKEENLYLDESIKSLNEDKRTL--QXXXXXXXXXXXXAKKNSSAIS 1115
              E ++ +L  L   KE N+ L + I +LNE+   L  Q             K +   I 
Sbjct: 822  NEETLIEKLTELDELKERNMELTQEIHALNENNIALKCQLEESLERLKPLETKISELNIL 881

Query: 1116 EQEWQQKIETYQQESEKWKLMCQQMS----ENTATEIQNLQQQLETFKADIQLKTQENDD 1171
             ++    I    +++E WK    +++     N   ++ NLQ+Q+E        K++EN++
Sbjct: 882  IEDKDNIINVSNEKAENWKTRFNELTLSAKNNDNEDLINLQKQVEE-------KSKENEE 934

Query: 1172 LNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAAL 1231
            L+DRF RLKKQA+E+L+ASK   ++L  + +ELK  N  L+  L+ Q     + E++ +L
Sbjct: 935  LSDRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLSEQMERFKELENSISL 994

Query: 1232 -------ILQLKEENKQA----KSLELELRHSVDSSEKLIADMTKELTTLKE--NPIQGS 1278
                   I  LKE+   A    K  E EL  +V  SE L++D+  E+ +L E     + S
Sbjct: 995  KDQELGSIGDLKEQLANALDKSKKFEEELIKTVSESESLVSDLKNEIESLNEKLKSKESS 1054

Query: 1279 VNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXXXXXXXXXXXXXXXX 1338
            V +++         SE E+ K++LI    +EL E+  +                      
Sbjct: 1055 VGLQE---------SEIENAKKILI----AELEEKLNKTKSELDLKHKEELKVLKTEYEG 1101

Query: 1339 XXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELS 1398
                  +R+ EA+E LK+ IRLP+EEKI  +I  + A LEE ++          KL  +S
Sbjct: 1102 DIQ---KRVAEAEEALKRKIRLPSEEKINTIIESKVADLEEDYKK---------KLETVS 1149

Query: 1399 NKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGG 1457
             ++ D       E+IK   E++    KKKAFEEG+QQASMKT  LE KIAKLE++LQ  
Sbjct: 1150 AESTD------IEKIKQEFEDNLVNAKKKAFEEGKQQASMKTKFLENKIAKLESQLQNN 1202

 Score = 90.5 bits (223), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 166/667 (24%), Positives = 296/667 (44%), Gaps = 97/667 (14%)

Query: 106 SETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKKLL---DFQRDDRQVGV--IRG 160
           S+T+ F+ + + D L+ Q+    ++IN  N +L    K ++   +  + D+   +  ++ 
Sbjct: 39  SDTESFKDKFKIDNLNLQI----QHINNDNLKLSNQLKNIIEKFNLSKIDQNKTIENLKL 94

Query: 161 KLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDK 220
           KL +  +E K L  +N  L D  + +N  L  K    K L+D ++        ++  +DK
Sbjct: 95  KLFKLENENKTLNSTNLNLTDKNDTLNNNLNLKLIELKNLNDNITELELKRNNDIQLKDK 154

Query: 221 LNAVLKKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHEEEISNYKEQVEELLGILGQG 280
               L +Q+NS    L   G++P       +    S    ++I N K  +          
Sbjct: 155 ----LIQQLNSKIENLLKLGKSPKFKNE-VEIINDSKTINDDIENSKATI---------- 199

Query: 281 APSIAHXXXXXXXXXXXNVSLKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATNKM 340
            PS A            N  LK  +++++ ELE +LP ++  + + + +Q  L+   N +
Sbjct: 200 PPSPAK------ALSKQNNGLKSDIQNYLNELEQQLPLIENFKAEIENLQDNLNKK-NLI 252

Query: 341 IEESKAKIRTQRELSSSRQK-VDHLNQIFHKLRVQRSDLAHQIQFLL----TVNSSDTVL 395
           IE  +   +   +L  S +K ++  +     L +QR+DLAHQ+Q+LL      N ++  L
Sbjct: 253 IESLQNDKKENLKLMDSMKKTINEKSSSIEALDIQRTDLAHQLQYLLIHSSIQNDNNGPL 312

Query: 396 PPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVES 455
             SE+ F++ +I  +      D Q ++SDRL++F +I  LQE+NM+L  ++R+L   +ES
Sbjct: 313 SKSEILFMQNLINKDKQRLSSDVQSVISDRLIKFKDIVSLQEKNMELTKSIRNLAFSLES 372

Query: 456 WEA---------DNDSGLTLEAAKLQISKLEQSNAQLESEVKNWEALMETLKDGDSLDSK 506
            E+         DND   T+  AK  I  L++ N  L+ E+                   
Sbjct: 373 KESEIKNSRENYDND---TINEAKETILSLQEYNNVLKLEIGTL---------------- 413

Query: 507 INVTMVEQQKKIEELESKLTDVGESHVQKINV-----------LNKTIDRNQSTINMLNE 555
                   Q KI EL+S + +  ES  Q  N            L+K    +QSTI  LN+
Sbjct: 414 --------QSKISELQSSIPNSKESEKQHFNYHSNLVKDLESKLSKLSAYSQSTIENLNK 465

Query: 556 QIKNTVKSDMNAKSELIACKRENLSLTQQISTKQNELD-------ELNSKSAQKERDYQL 608
            I+N      +    L   K   +   ++++  QN  D       EL+SK++  E+    
Sbjct: 466 DIQNLYNERTDILINLEKEKSSTILANEKLTLLQNSYDLLTLENEELSSKNSMLEQQLNE 525

Query: 609 KIAELSVAAN---KCKS----WENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETR 661
           +   L+   N   KCK+    + N   LL   K  +E++  SL  +I+   +++  L+++
Sbjct: 526 EEKNLNSVLNDYIKCKTNLLDFTNRLTLLNNNKLGLEEENNSLKQEIKSNYEQIKDLDSK 585

Query: 662 NKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKW 721
           +K LE  +  +        + L   I+ L+E+   L   L  K  E+      +  QI W
Sbjct: 586 SKHLEQSLENEISKYTDKVKELELNISKLNEQKLILERKLQNKNIEIDDLNSSNYDQISW 645

Query: 722 YQQNIDE 728
           YQ+ +D+
Sbjct: 646 YQKKLDQ 652

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1554

 Score =  137 bits (345), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 134/407 (32%), Positives = 204/407 (50%), Gaps = 57/407 (14%)

Query: 1118 EWQQKIETYQQESEKWKLMCQQMSE-----------NTATEIQNLQQQLETFKADIQLKT 1166
            E +Q +   Q+E E+WKL  Q + +            +  +I+ L++QLET +       
Sbjct: 1120 EKEQHLNICQEELERWKLRSQTILQQGKIVEEEAHMKSLEKIKTLEEQLETVRT------ 1173

Query: 1167 QENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKL------NNQET 1220
             EN  L DRF RLKKQAHEKL+A+K    +L  +++EL      L++ L      NNQ  
Sbjct: 1174 -ENAQLTDRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQEIEKNNQSG 1232

Query: 1221 NSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKL---IADMTKELTTLK--ENPI 1275
            N    ES    I++L+ E +++ +   EL   V+ ++K    I  +  EL ++K  EN  
Sbjct: 1233 NGAADESEE--IIRLRAELEKSNNFSNELEKKVEDAKKFKNEIESLKSELQSVKAYENST 1290

Query: 1276 QGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFERXXXXXXXX----------- 1324
              S  ++D       LK  F+ EK  LIE+   E   + E+                   
Sbjct: 1291 VNSKIIKD-------LKESFKREKDELIEQMKKEFKTKLEKEKETILAQRKNNILANGQE 1343

Query: 1325 XXXXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTK 1384
                               L+RI EA+ENLKK +RLP+EEKI  VI KR+  LE++F+TK
Sbjct: 1344 SANIEELKKKWEEEQEALILKRITEAEENLKKRMRLPSEEKINAVIEKRRKVLEQEFETK 1403

Query: 1385 VAEQANLLKLSELSNKTADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLE 1444
            + E       + +   T  ++EKE+RE+    L E    +KKKAFEEG+QQ+ MK+TLLE
Sbjct: 1404 LRELGLNADGNGVVTDTRAQIEKELREKFNLELAE----IKKKAFEEGKQQSMMKSTLLE 1459

Query: 1445 RKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLTNEPVLDEK 1491
            RK++KLE++      P K+ N  N+  + S + ++   ++ P L EK
Sbjct: 1460 RKLSKLESQ---TLSPTKN-NDSNETQVPSKINLSNINSSSPPLGEK 1502

 Score =  123 bits (309), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 230/898 (25%), Positives = 403/898 (44%), Gaps = 111/898 (12%)

Query: 147  DFQRDDRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSS 206
            D  R   Q+ ++  ++    SEI  L+  N +L   L+R       K    K L D L+S
Sbjct: 223  DASRLQDQLQIVSSEILSLKSEIATLKYMNESLSTDLQR-------KLFRIKDLDDNLNS 275

Query: 207  QRHDFERELATRDKLNAVL-------KKQVNSLHSELGNGGETPAHAEPNDQFAKQSSQH 259
             + +F +E+  + ++N +L       KKQ+  L S+     E     E  D   ++    
Sbjct: 276  SKQEFAKEITLKQRVNELLHNEIASYKKQIERLTSKNLETPEKKIIQELVD-LKEKLVNS 334

Query: 260  EEEISNYKEQVEELLGI--------LGQGAPSIAHXXXXXXXXXXXNVSLKKQMESFVIE 311
            E+E +  K  V++ + I         G     I               +L++Q+ESF++E
Sbjct: 335  EKECNELKSTVDKYINIDEKKLISKFGNPKKLIEILRRQLVKEKRHKDTLQRQVESFLVE 394

Query: 312  LEHRLPGLQILEKQNKEVQQKLHAATNKMIEESKAKIRTQRELSSSRQKVDHLNQIFHKL 371
            LE +LP +   +++N  ++++L   T+ + E +K +    REL++ ++K+ +  Q   +L
Sbjct: 395  LEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKKISNNEQFNDEL 454

Query: 372  RVQRSDLAHQIQFLLTVNSSDTVLPPSELSFIKTIIENENWDAYKDSQRIVSDRLLRFDN 431
              QRSDLAHQ+Q+LL    + +     E + +K I+ NEN +   DS +I+S RLL F N
Sbjct: 455  LRQRSDLAHQVQYLLLCIDNKSPFTEKEATLVKKIVSNENTENDTDSHKIISKRLLHFQN 514

Query: 432  IPELQEQNMKLVSTVRSLVDKVESWEADNDSGLTLEAAKLQISKLEQSNAQLESEVKNWE 491
            + ELQ++NM+L+ T R LV  +E  E +    L +      +   + ++  LE  +K  E
Sbjct: 515  VKELQQKNMELLRTTRQLVQTLERQEQEQQKTLRITDNNKIVESAKSTSVDLEKHIKTLE 574

Query: 492  ALMETL-KDGDSLDSKINVTMVE-----------QQKKIEE--LESKLTDVGESHVQKIN 537
            + +  + ++ DS    +  + ++           QQ ++E+  L ++L+ + + HV+ + 
Sbjct: 575  SKINIISQERDSYKLLVTNSTIQSNTSNNSISSLQQCELEKERLTNELSSMKQQHVKVLE 634

Query: 538  VLN---KTIDRNQSTINMLNEQIK---NTVKSDMNAKSELIACKRENLSLTQQISTKQNE 591
             L    KT+ ++Q T  M  E+     + +K + N   E +  K EN   T +    +NE
Sbjct: 635  ELENKIKTLQKSQLTSKMEVEKHALNFDEMKDNNNLLKEYVD-KLENKIKTLEQDLAENE 693

Query: 592  LDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKI--Q 649
            L E N  +       Q KI ELSVA  K      SF  L +E + ++ K ++L DKI   
Sbjct: 694  LFEKNLITGGVNNLEQSKIIELSVAEQKI-----SF--LDKEISNLKSKNKNLEDKILTM 746

Query: 650  QESKKLLQLETRNKELEVKISGKELHRK---RSEETLSSKITFLSEENKSLH----NDLA 702
              SK L  L+ +  +LE  +S +EL +    ++EE   +K    + E K L     +D++
Sbjct: 747  TLSKNL--LDNKVLQLETSLSERELPKNTQIKNEEKEPAKQQTYTFERKKLESVNDSDIS 804

Query: 703  FKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLS--NKPY 760
            +                  Y +N++EL  Q +    ++ E+ + L + +E  L   NK  
Sbjct: 805  Y-----------------LYYENLEELQNQFRTLRRELKEVQEDLDMKTESHLKLENKYT 847

Query: 761  PVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNE 820
             V  +LK+   +L             A++Y  TLE+  +F  NS    Q    EL     
Sbjct: 848  KVKNDLKQATYKL-------------ASVY-TTLEQKNSFLANSVSQLQGKEKELNELKS 893

Query: 821  ALSKQHETLQNQITETENQSK---GIQLEHQTIIDRLTSEKTALEEKLNSLSHSEEKIAE 877
             L ++ E L  Q+ E EN  K    I L  QT+++  T+ K A +   NSLS   + I  
Sbjct: 894  KLVEKTEKL--QMAENENSEKINNAIVL-LQTMVEENTTFKDAFKHFKNSLSRLRQAINS 950

Query: 878  MKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAA 937
            ++     Q   IESN   + D   +    L   E ++ S+  ++ ++   +   +  I  
Sbjct: 951  IQ----QQSLVIESNYNTEID---HANERLEEAEVKMASFDGKVTEI---LESYDGKILN 1000

Query: 938  LTEPAEARKTLIKERDSLGQELKLANQRIESLAAQNSILYDTFSGMRHVDADAEPNED 995
                    ++LI E+  L   L  AN  +     +N    + F     +D  ++  ED
Sbjct: 1001 TAAIGHLVRSLIHEKKMLALNLNSANYSLRRARYRNKNPREKFPSFVKIDQQSKKEED 1058

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 219/799 (27%), Positives = 375/799 (46%), Gaps = 81/799 (10%)

Query: 643  SLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLA 702
            SL   +++  K+ +QL+ + KE E+ ++ ++++         ++I  L E  + L  +L 
Sbjct: 736  SLTRDLERCCKEKIQLQMKLKESEISLNEQKVNFDSKGIKYDARIKQLEESLERLRIELK 795

Query: 703  FKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRLLSEKSLSNKPYPV 762
             K +E+K      + Q+KW Q  ID+  E+ K+    + EL+ K + +   +LS+K   +
Sbjct: 796  SKAQEIKSLQSSKDSQLKWAQNTIDDTEEKLKSV---LTELSRKEKTVV--TLSSKIENL 850

Query: 763  GTELKELQNELNGMKAALEVSESQATLYKDTLERNQ---NFYNNSTLSFQNTIS----EL 815
              EL+E + +   +    + S  Q  L K+ LE+ Q      ++   +++  IS     L
Sbjct: 851  DNELRENKLKYEFLNNTSDASTLQPALRKE-LEQTQLELKDAHSQVRTYEEIISTNEKAL 909

Query: 816  QSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLN--------- 866
            +  N  L+   E    +I E E + K    E  +++ R   E  +L+ KL          
Sbjct: 910  KELNSQLASMKEDYDARI-ELECKEKLANEEELSLLRRELDEIRSLQPKLKEGTVCLVKQ 968

Query: 867  --SLSHSEEKIAEMKGEYD-----AQIQKIESNLKIQSDTRLNFESA--LTSKEKELTSY 917
               L +  EKI EMK + D      Q+ K E   + QS  + N E +  +T  EKE T  
Sbjct: 969  SEKLRNQAEKIQEMKAKIDKMNWNVQVYKKEKTSQFQSIMKANKELSELVTRLEKEATDS 1028

Query: 918  AVQIEQLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLANQRIESLAAQNSILY 977
             +++++L + + K   D+    E     K  ++E+    +EL    ++ ESL  +NS+L 
Sbjct: 1029 QMELKKLKSSLHK-TQDLLDTHE-----KKWMEEKADYERELISNIEQTESLRVENSVLI 1082

Query: 978  DTFSGMRHVDADAEPNEDLRNLVI---NLRIERDMHQSQETTAQRDVKLLKKNLKEITEK 1034
            +       V   ++ NED   LV    NLR ER+  +++ TT +RD+ L+K+  K  + +
Sbjct: 1083 EKIGS---VTEGSDGNEDYLKLVSFFSNLRHERNSLETKLTTCKRDLALVKQ--KNASLE 1137

Query: 1035 LAITCPEIDEPTNTEKDDFSLTVTHE--KIMRELEGLTNTKEENLYLDESIKSLNEDKRT 1092
              I   +ID+P +  +   S  +  E   I +E+  +   KE N  L +S+K++ E  R 
Sbjct: 1138 KNINDLQIDQPASQTELQCSAVIIDEFNDITKEIAQVNLLKENNAILQKSLKNVTEKNRE 1197

Query: 1093 LQXXXXXXXXXXXXAKKNSSAISEQEW--QQKIETYQQESEKWKLMCQQMSENTATE--- 1147
            +              K +     EQ      KI  Y+ E ++    C+Q   + +T+   
Sbjct: 1198 IYEELTIRQEEVSQLKSDLIKTKEQVSVNANKILIYESEMDQ----CKQRYHDLSTQQRE 1253

Query: 1148 -----IQNLQQQLETFKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELS 1202
                 I+ L  ++  FKA +        +L ++F RLKKQAHEKL+ASK    +L  EL 
Sbjct: 1254 VQKKTIEKLNSEISDFKAKLLDAENTKTELENKFNRLKKQAHEKLDASKKQQTALTNELK 1313

Query: 1203 ELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLIAD 1262
            ELK V D L++ LN++   +VD ++        KE   Q+  L   LR   D  +     
Sbjct: 1314 ELKAVRDKLEQDLNSKNFKTVDLDTEP------KEHTVQSGDL---LR---DQEKVASLP 1361

Query: 1263 MTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTSELTERFE------R 1316
            + +E+ +LK   +Q   N  + +   E+L+   E+EK  +I + T E  ++ E      +
Sbjct: 1362 LIEEIESLK-RELQVFKNANNSSDAFEKLRDNMEEEKNKIINERTKEFEKKLEEIVSKSK 1420

Query: 1317 XXXXXXXXXXXXXXXXXXXXXXXXXXTLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQ 1376
                                      T++RI EA+ENLKK IRLP+EE+I+++I+KRK +
Sbjct: 1421 STGKVADNSENIETLKKEWLKEYEEETIRRIREAEENLKKRIRLPSEERIQKIISKRKEE 1480

Query: 1377 LEEQFQTKVAEQANLLKLS 1395
            LEE+FQ K+ E A+ L  S
Sbjct: 1481 LEEEFQRKLKENASSLTFS 1499

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score =  117 bits (292), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 85/115 (73%)

Query: 1343 TLQRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSNKTA 1402
            T QRI+EA+ENLK+ IRLPTEEKI +VI KR+ QLE +FQ KV  +A  L   +  N+  
Sbjct: 1553 TSQRIKEAEENLKRRIRLPTEEKINKVIDKRRTQLENEFQNKVEARAKELLTGDEKNEFF 1612

Query: 1403 DELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEARLQGG 1457
            D ++KE++EE+  + EE+ +++KKKAF+EGRQQ  MKT+ LE+KI KLE+ LQ  
Sbjct: 1613 DRMKKEIQEELARKYEEELQVVKKKAFDEGRQQVLMKTSFLEKKITKLESDLQNA 1667

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 217/458 (47%), Gaps = 58/458 (12%)

Query: 301 LKKQMESFVIELEHRLPGLQILEKQNKEVQQKLHAATN----KMIEESKA-KIRTQRELS 355
           L+K+   F+ ++E +LP LQ     N  V+ + +        K+I E  + K+  Q    
Sbjct: 300 LEKKFNDFLFDIESKLPYLQ-----NNSVENETNNGNKIEEQKIIHEHDSLKLENQ---- 350

Query: 356 SSRQKVDHLNQIFHKLRVQRSDLAHQIQFLLTVNS-----SDTVLPPSELSFIKTIIENE 410
           S + K++        L  QRSDL HQI +LL   S     ++ +L  +EL+FI+ ++   
Sbjct: 351 SLKIKLNDFESTVKTLLQQRSDLGHQINYLLITQSYLNEDNNKILTENELNFIRNLVAQP 410

Query: 411 NWDAYKDSQRIVSDRLLRFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL-TLEAA 469
                 ++Q I+S+RLL+F N+ +L  +N+KL+S VR L +K+ES E  N      LE  
Sbjct: 411 TNTWSTETQNIISERLLKFSNVSDLTAKNIKLISLVRELTNKMESIEKQNSQKFGDLEMD 470

Query: 470 KLQISKLEQSNAQLESE-VKNWEALMETLKDGDSLDSKI---NVTMVEQQKKIE-ELESK 524
              I + +Q    L+ E VKN + + + + +   L+ KI   N T+ E  K +E + E  
Sbjct: 471 FKSIDEAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPT 530

Query: 525 LTDVGESHVQKIN--VLNKTIDRNQSTINMLNEQIKNTV---KSDMNAKSELIACKRENL 579
           L ++    +QK N  +L K    NQ +I + N   +N +   K D+     LI    E  
Sbjct: 531 LKNL---ELQKTNQSLLEKN---NQLSIEISNASNENKILKEKFDL-----LIKSYTELK 579

Query: 580 SLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEKTQMEQ 639
            L  +IST         S    K+ +   KI+EL     KCK+ E SF     +  ++E 
Sbjct: 580 ELKSEISTYT------KSSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEI 633

Query: 640 KQRSLFDKIQQESKKLLQLETRNKELEVKISGKE-------LHRKRSEETLSSKITFLSE 692
           +  ++ D++    KK+L      K     I           ++   +++ L  ++  +  
Sbjct: 634 ENNNVKDEL----KKVLSEYNTFKSTRGTIDSFNQNKNSIGINENTNKQLLKEELNTVKS 689

Query: 693 ENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELS 730
            NKSL   +  +E ++K  IEK + QIKWYQ  IDE++
Sbjct: 690 LNKSLEAKIKLQENDIKILIEKYKSQIKWYQDKIDEMN 727

 Score = 34.7 bits (78), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 12/94 (12%)

Query: 1123 IETYQQESEKWKLMCQQMSENTATEIQNL------------QQQLETFKADIQLKTQEND 1170
            IE Y+ + + ++    +M+     +I NL            + +++  K  I+ K++E  
Sbjct: 709  IEKYKSQIKWYQDKIDEMNTTMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKELT 768

Query: 1171 DLNDRFTRLKKQAHEKLNASKATSDSLAIELSEL 1204
            +  DRF RLKKQA +KLN  K T + L  +  +L
Sbjct: 769  ESLDRFARLKKQAKDKLNEFKGTENKLREDYCDL 802

>KAFR0H00210 Chr8 complement(27128..31492) [4365 bp, 1454 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1454

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 74/112 (66%), Gaps = 3/112 (2%)

Query: 1345 QRIEEAKENLKKHIRLPTEEKIERVIAKRKAQLEEQFQTKVAEQANLLKLSELSN---KT 1401
            +++ +A+ENLKK IRLPTEEKI  +I KRK++LE  F+ K+ E+A  L L    +   K 
Sbjct: 1230 KKVSQAEENLKKRIRLPTEEKINGIIEKRKSELESSFEQKIKEEAKSLLLHSDDDKIKKI 1289

Query: 1402 ADELEKEVREEIKTRLEEDFELLKKKAFEEGRQQASMKTTLLERKIAKLEAR 1453
              E+E+  RE ++   +E   +++KKAFEEG+Q   MK+  LERKI+ LE +
Sbjct: 1290 YKEIEESGRETLQQEFDEQLNIVRKKAFEEGKQHVLMKSAFLERKISMLEGQ 1341

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 180/808 (22%), Positives = 348/808 (43%), Gaps = 148/808 (18%)

Query: 107 ETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTKKLLDFQRDDRQVGVIRGKLDQSL 166
           E+ + + EL+   + E L   +  +  TNG+  E       F+R++     +RGK    +
Sbjct: 159 ESYKDRKELEYQNVMENLTAIDNELRMTNGKNAEL------FKRNEELSKDLRGK----I 208

Query: 167 SEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQLSSQRHDFERELATRDKLNAVLK 226
           SEIK+L +S                            L +   DF  E   +D+L   L+
Sbjct: 209 SEIKSLENS----------------------------LKTSNGDFLSEKQLQDQLINALQ 240

Query: 227 KQVNSLHSELGNGGETPAHAEPNDQFAKQSSQHE--EEISNYKEQVE----ELLGILG-- 278
            Q+ +L  +L    E+ +  + +D   ++  +HE   +I N  E++E    E L ++   
Sbjct: 241 NQIKTLQEQL----ESLSDEKFDDPGTQKLDKHELLRQIKNLNEKLEISERERLSLVHSM 296

Query: 279 ---QGAPSIAHXXXXXXXXXXXNVS-----------------------LKKQMESFVIEL 312
              Q  P               N +                       L++QM   + EL
Sbjct: 297 EEFQNIPEEESSSVSSHASGRNNSALSLSGDVNILRKHFLKERQQKRQLEEQMRQILQEL 356

Query: 313 EHRLPGLQILEKQNKEVQQKLHAATNKMIEE-SKAKIRTQRELSSSRQKVDHLNQIFHKL 371
           E  +P L   ++++  ++++L+++ N ++E   K  +    EL     +  +L    + L
Sbjct: 357 ERNMPSLSSYKERSTFLEKELNSS-NILLEHIKKENLDKSAELEKKESECSNLRSSINSL 415

Query: 372 RVQRSDLAHQIQFLLTVNSSDTVLPPS----ELSFIKTIIENENWDAYKDSQRIVSDRLL 427
             QR+ LA Q+++LL +  ++  L  S    +L  +   +     +A  DS++I+ +RL 
Sbjct: 416 AFQRTVLARQVKYLLLIIQNNETLGSSLGRKDLELLGQYLAANTAEAMSDSEKILLERLA 475

Query: 428 RFDNIPELQEQNMKLVSTVRSLVDKVESWEADNDSGL------TLEAAKLQISKLEQSNA 481
           +F N+ ELQ +NM+L+   R L  K E  E  N   +      T+  AK  I  L++ + 
Sbjct: 476 QFKNVKELQNRNMQLLQVSRELASKAEKLEKVNLKQISSEEDETINDAKEAILVLQEYSQ 535

Query: 482 QLESEVKNWEALMETLKDGDSLDSKINVTMVEQQKKIEE----LESKLTDVGESHVQKIN 537
           +LES++K            D L        V++++K E+      SK+ D   SH   + 
Sbjct: 536 KLESQIKEL---------SDEL-------AVQKKEKTEKESISAMSKIEDDASSHTIDLG 579

Query: 538 V-LNKTIDRNQSTINMLNEQIKNTVKSDMNAKSEL--------IACKRENLSLTQQISTK 588
             L+  +  ++  I+ LN +I+N  +++ +    L        +A  R NL L   +S  
Sbjct: 580 KQLSANLKHSKDIIDALNSEIENLHQANTDVNISLDKEKSARKLAEDRYNL-LEYNVSLL 638

Query: 589 QNELDELN--------------SKSAQKERDYQLKIAELSVAANKCKSWENSFHLLTEEK 634
           ++E +EL                + +   RDY    ++LS A  +  S      L  E +
Sbjct: 639 KSEKEELQEEVNKLQQNILDKEKQFSYSSRDYISCKSKLSTAEAEITSLRAENELSIETQ 698

Query: 635 TQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEEN 694
           T +  K+ +L ++       + Q+ + N EL+  +       K ++     K+   + + 
Sbjct: 699 TTLRTKKEALLNERNNLRMTVTQMNSLNNELQTLL-------KETKSGYDDKLKISALKC 751

Query: 695 KSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNID-------ELSEQNKNKSNKIIELNDKL 747
              +N L   ++ + +   +++ +IKWY+  ID       EL+E+ K K  KI E +  L
Sbjct: 752 TQTNNQLQLVQQRMSELKSQNDSEIKWYKATIDDLKANVFELNEELKQKEEKIEEFSKTL 811

Query: 748 R-LLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTL 806
             + +E +L+N    V  E + L+ EL+ +K+ LE S  +   Y++ +  ++  + N ++
Sbjct: 812 ENVQNELTLANSK-DVSEEKRALEKELSEVKSQLEKSNLEVKEYENVISTSKRSFENKSI 870

Query: 807 SFQNTISELQSKNEALSKQHETLQNQIT 834
            +++ I  L SK ++  ++  TLQ  ++
Sbjct: 871 QYEDRIKALASKLDSELRERTTLQENLS 898

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 46/80 (57%), Gaps = 12/80 (15%)

Query: 1119 WQQKIETYQQESEKWKLMCQQMSENTATEIQNLQQQLETFKADIQLKTQENDDLNDRFTR 1178
            +Q KI+ + +E+ K +        N A     L+   E  K   + K++E ++ ND+F+R
Sbjct: 626  FQNKIDNFNEETTKNQF-------NNA-----LKNDYENLKKSFEEKSKEVEEANDKFSR 673

Query: 1179 LKKQAHEKLNASKATSDSLA 1198
            LK+QA+E+LNASK T   L+
Sbjct: 674  LKRQANERLNASKTTQKELS 693

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score = 42.0 bits (97), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 35/48 (72%)

Query: 1158 FKADIQLKTQENDDLNDRFTRLKKQAHEKLNASKATSDSLAIELSELK 1205
            FK   ++K++END+  DRF RLKKQA+ +L++SK   ++L  ++S LK
Sbjct: 973  FKEKYEMKSKENDENIDRFNRLKKQANARLHSSKEEQNALNEQISSLK 1020

>AAL085C Chr1 complement(192432..193783,193783..194932) [2502 bp,
           833 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR285W (ZIP1); artificial frameshift
          Length = 833

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 75/152 (49%), Gaps = 21/152 (13%)

Query: 106 SETQRFQSELQRDRLSEQLKQGERYINATNGRLLESTK---KLLDFQRD----------- 151
           S+  R Q E  R    EQLK  E+Y++    +L ++++   +++D Q+            
Sbjct: 459 SDLVREQVEAVRLNFMEQLKGVEKYLDKFGCQLDKNSQYENQVVDLQKQVHNIALQKSEV 518

Query: 152 -------DRQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAALNKTLSDQL 204
                  D +V  +  +L QS   + +LR+SNSAL   + ++  ELT K   N  + ++L
Sbjct: 519 VALMKVKDTEVDSLNAQLLQSGESVNSLRESNSALDKQVIQLGLELTRKVEENTRICEEL 578

Query: 205 SSQRHDFERELATRDKLNAVLKKQVNSLHSEL 236
           +S++  FE++   + ++  +L  +  SL S L
Sbjct: 579 TSEKATFEQKFEAQKEVVKLLTHEAESLKSRL 610

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
           Anc_1.295 YJL074C
          Length = 1227

 Score = 38.5 bits (88), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 58/106 (54%), Gaps = 13/106 (12%)

Query: 845 LEHQTI-IDRLTSEKTALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNF 903
           +EHQ + ++   SEK  LEE L S+    EK+     E +  I + E  +  Q D   +F
Sbjct: 744 VEHQRVKLNNKKSEKYVLEESLQSVVLKREKV-----ETNISIIR-EKVISYQHDLETDF 797

Query: 904 ESALTSKEKELTSYAVQIEQLNTEIAKLNSDIAALTEPAEARKTLI 949
           ESAL+S++K+L      +E ++  I+K+++D+   +E  E+  T I
Sbjct: 798 ESALSSEQKQL------LETISASISKISNDLTVTSEALESITTTI 837

>TPHA0B00830 Chr2 (187071..194681) [7611 bp, 2536 aa] {ON} Anc_4.238
            YDL058W
          Length = 2536

 Score = 38.1 bits (87), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 113/423 (26%), Positives = 184/423 (43%), Gaps = 74/423 (17%)

Query: 462  SGLTLEAAKL-QISKLEQSN-----AQLESEVKNWEALMETLKDGDSLDSKINVTMVEQQ 515
            + L LE AKL +  K+ Q+N     ++L+S++ N E      K+ D    K      E +
Sbjct: 1481 TSLELEIAKLTEEKKINQTNFNDKISELKSDIINLE------KEKDDSKEKNKTESAELK 1534

Query: 516  KKIEELESKLTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSELIACK 575
             +IEEL++K   + E H   ++ L   ++R +        Q  N++ SD+  K+EL+   
Sbjct: 1535 SEIEELQNKNFKMIEEHTITLDALKTDVERLEKAKEDFQVQ-NNSLTSDLETKNELLHKL 1593

Query: 576  RE----------------NLSLTQ----------QISTKQNELDELNSKSAQKERDYQLK 609
            +E                NL L +          ++S    +L+EL++K         LK
Sbjct: 1594 KEKSANTISSLKEDLETQNLQLKEKTKCAEESAIELSNISKDLNELSAKYESLNSKLSLK 1653

Query: 610  IAELSVAANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELE--- 666
               LS   N+     +      EE   +      +  ++  + K    +E++N +LE   
Sbjct: 1654 QDALSEITNENAELNSQLEKHKEEIADLNSSLNDINSRLDLKIKNFDSIESKNSDLEKEL 1713

Query: 667  VKISGKELHRKRSEE----TLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWY 722
            +K++ +  H K S      +L+ KIT LSEE         F E+E  Q  E S+   K Y
Sbjct: 1714 LKVNEELAHLKESSSKTILSLNDKITSLSEE---------F-EKERTQLTEGSDSITKEY 1763

Query: 723  QQNIDELSEQNK----NKSNKIIELNDKL-RLLSEKSLSNKPYPVGTELKELQNE-LNGM 776
             + I+ L E  +    +K  + +E  +KL  ++ + S + K      E K++  E LN  
Sbjct: 1764 SEKINRLEESLRKVELDKDKETLEYKNKLTSIIDQLSETEKDLTAAEEDKKILTETLNDQ 1823

Query: 777  KAALEVSESQATLY----KDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQ 832
            K +L+ S  +  L      D L   Q        S  N ISELQS NEAL K+ E+L  Q
Sbjct: 1824 KTSLDKSHEELELLNKQLSDALSDAQ--------SKVNCISELQSNNEALIKEVESLHLQ 1875

Query: 833  ITE 835
            IT+
Sbjct: 1876 ITD 1878

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score = 37.7 bits (86), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 48/119 (40%), Gaps = 12/119 (10%)

Query: 1424 LKKKAFEEGRQQASMKTTLLERKIAKLEARLQGGTGPLKSANGLNKINIDSPLMVAGPLT 1483
            +   AF+    + S+   + E+KI++LE   +GG  P    +GL   NID    +   L 
Sbjct: 1435 IGTGAFDVMIDEESLMKYMPEQKISELEDGEEGGATPYSDEHGLANANID----IKDELM 1490

Query: 1484 NEPVLDEKPNAFAGAXXXXXXXXXXXXAKDSANAFS-FNAQK-VPAQPAFSSRAQPAFS 1540
              P++D      +G+              +   A S F A    PA P F   + P FS
Sbjct: 1491 FSPLVD------SGSTDAMSGGFTAYGGAEYGGATSPFGAYGDAPASPGFGGVSSPGFS 1543

>KAFR0F03020 Chr6 (595158..597632) [2475 bp, 824 aa] {ON} Anc_4.46
           YLR309C
          Length = 824

 Score = 36.2 bits (82), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 95/210 (45%), Gaps = 43/210 (20%)

Query: 518 IEELESKLTDVGESHVQ---KINVLNKTIDRNQSTI----NMLNEQIKNTVKSDMNAKSE 570
           +EE+   L DVG   V+   KI   N++ + N   I    N+ NE  +   ++D N K+E
Sbjct: 302 VEEVRDMLRDVGNELVEAKDKIKEFNQSSNANDELISKNSNLENEITRIKEEND-NVKNE 360

Query: 571 LIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLL 630
           + A ++EN +L  +IST + + D LN                +    N     EN   L+
Sbjct: 361 ISAARQENENLKTEISTLKTDTDNLN--------------GHIQSIKNDNNKLENEIQLV 406

Query: 631 TEEKTQMEQKQRS-------LFDKIQQESKKLLQLETRNKELEVKISGKELHR------- 676
            +E +++E + ++       L  ++ Q   KL+Q E     LE +I  KE          
Sbjct: 407 KKENSKLETEVKTSKNETDKLSSQLNQVKNKLIQKEKTVIYLEKQI--KEYAENQEPVKQ 464

Query: 677 -----KRSEETLSSKITFLSEENKSLHNDL 701
                KR  + LS++I  L  EN+SL+NDL
Sbjct: 465 AMDLLKRENKQLSNRIDLLKNENESLNNDL 494

>YDR356W Chr4 (1186107..1188941) [2835 bp, 944 aa] {ON}  SPC110Inner
           plaque spindle pole body (SPB) component, ortholog of
           human kendrin; involved in connecting nuclear
           microtubules to SPB; interacts with Tub4p-complex and
           calmodulin; phosphorylated by Mps1p in cell
           cycle-dependent manner
          Length = 944

 Score = 35.4 bits (80), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 65/279 (23%), Positives = 126/279 (45%), Gaps = 61/279 (21%)

Query: 647 KIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLSSKITFLSEENKSLHNDLAFKEE 706
           K+ QE    ++ E + +E   KIS  +L  +++  TL+ KI+ L+ EN  L N +     
Sbjct: 483 KVAQEKYSKMEKELKEREFNYKISESKLEDEKT--TLNEKISNLAAENSQLKNKIEDNST 540

Query: 707 EVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELNDKLRL------LSEKSLSNKPY 760
                 E  EKQ++  +++I+E  E  K+  +KI EL  K+R+      +SEK       
Sbjct: 541 ATHHMKENYEKQLESLRKDIEEYKESAKDSEDKIEEL--KIRIAENSAKVSEKR------ 592

Query: 761 PVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNE 820
               ++K+   +++ +   L++ E + +  K  ++R +  +N             Q K+E
Sbjct: 593 --SKDIKQKDEQISDLTQNLKLQEDEISSLKSIIDRYKKDFN-------------QLKSE 637

Query: 821 ALSKQHE------TLQNQITETENQSKGIQLEHQTII--------------DRLTSEK-- 858
             + QH+       L+N++ E+E++ K ++   +  I              DRL +EK  
Sbjct: 638 QSNIQHDLNLQILNLENKLIESEDELKSLRDSQKIEIENWKRKYNNLSLENDRLLTEKES 697

Query: 859 --------TALEEKLNSLSHSEEKIAEMKGEYDAQIQKI 889
                   + L  KL+ +   +  + E K +Y  ++QK+
Sbjct: 698 ASDKEREISILNRKLDEMDKEKWNLQESKEKYKRELQKV 736

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa] {ON}
            complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 35.4 bits (80), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 93/201 (46%), Gaps = 47/201 (23%)

Query: 763  GTELKELQNELNGMKAALEVSESQATLYKDTLER--NQNFYNNSTLSFQNTI-------- 812
            G  L E   EL    +ALE   S+    K  LE+   Q F NN  L++   I        
Sbjct: 827  GLTLLESHKELKSKYSALE---SENAELKSKLEKLDGQEFRNN-ILTYSQNIDLFMNEWK 882

Query: 813  -SELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSHS 871
              +L ++NEA+SK  +T ++ ++ T ++S+     H+ +I +L+S       +L+ L H 
Sbjct: 883  KGKLNTENEAISKDSDTNKSPVSPTSSKSQ----HHKAVISKLSS-------RLDELLHK 931

Query: 872  EEKIAEMKGEYDAQIQKIESNLK------IQSDTRL-----NFESALTS----------K 910
             E +A+ K +     +++ES  K      + S ++L     N+  +LTS           
Sbjct: 932  SEDLADTKDKLTTDYKQLESKHKSLSQEYLASQSKLQLAENNYRDSLTSVTNTSKALEVT 991

Query: 911  EKELTSYAVQIEQLNTEIAKL 931
            + EL+ Y ++  ++  E+ K+
Sbjct: 992  QTELSKYKIEYTKIKDELEKV 1012

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 35.0 bits (79), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (53%)

Query: 685 SKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKIIELN 744
           SK+ FL+  NKSL  D+   EE++K   E+  K +    + I E+ E     S K ++LN
Sbjct: 377 SKVNFLTTRNKSLKEDIKVNEEKIKALEEERNKVVLPDPEKIHEVDENLSTASAKRLKLN 436

Query: 745 DKLRLLSEK 753
           D +  L EK
Sbjct: 437 DDIADLKEK 445

>Kpol_1067.22 s1067 complement(46246..48414) [2169 bp, 722 aa] {ON}
            complement(46246..48414) [2169 nt, 723 aa]
          Length = 722

 Score = 35.0 bits (79), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 11/100 (11%)

Query: 1203 ELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSEKLIAD 1262
            E+K + DAL EK N   +++  +ES + + L+L E +K+ K  E+EL    D++ KLI  
Sbjct: 216  EVKDLKDALAEKSN---SHAELTESLSTITLKLTESDKKIKEAEIELEKHNDTNNKLI-- 270

Query: 1263 MTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVL 1302
             TKE     EN IQ  +N+E    +L++ K   E E + L
Sbjct: 271  -TKE-----ENIIQLELNIEKLNAKLQEEKIIHEREIKAL 304

>NCAS0F02500 Chr6 complement(491248..492601,492690..493831) [2496 bp,
            831 aa] {ON} Anc_5.296 YDR285W
          Length = 831

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 51/171 (29%), Positives = 76/171 (44%), Gaps = 12/171 (7%)

Query: 1144 TATEIQNLQ-QQLETFKADIQLKTQENDDLN-----DRFTRLKKQAHEKLNASKATSDSL 1197
             AT  Q LQ QQLE  K  +Q++  E D        +++ +L K   EKL    +  D  
Sbjct: 179  CATLKQELQTQQLENKKLKVQIRNFEVDSGKIHTKVEKYHQLLKALQEKLKILLSERDKN 238

Query: 1198 AIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLELELRHSVDSSE 1257
            + + +ELK   +  QEK+        D + + + +  LK      K  ELEL       E
Sbjct: 239  SQDCAELKKTYETFQEKITCYRNAISDMKGSISNLKSLK------KDTELELMKKEKEIE 292

Query: 1258 KLIADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEFEDEKRVLIEKTTS 1308
             L  ++      L E  I+    ++++T   E LK  FE +K  L EKTTS
Sbjct: 293  YLKREVDDTSGQLSEEKIKNCSLLQEFTKTRETLKENFESQKEDLKEKTTS 343

>Kpol_1028.89 s1028 complement(197927..200560) [2634 bp, 877 aa]
           {ON} complement(197927..200560) [2634 nt, 878 aa]
          Length = 877

 Score = 34.7 bits (78), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 66/253 (26%), Positives = 120/253 (47%), Gaps = 16/253 (6%)

Query: 682 TLSSKITFLSEENKSLHNDLAFKEEEVKQFIEKSEKQIKWYQQNIDELSEQNKNKSNKII 741
           ++ SK++ L E +K    ++A + EE++  +  ++++++  +Q +  L   N + +NKI+
Sbjct: 300 SIESKLSMLQETHKQ---NIA-ETEELESNVAVAKREVEALKQQLAMLETNNNDSNNKIL 355

Query: 742 ELNDKL---RLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQ 798
           ELN KL   R L+++S     Y     ++    +L   K  L+   S   +    LE N 
Sbjct: 356 ELNQKLTTSRQLNKESKDKIQY-FNNMIEVSGGKLEDNKIKLKQENSMVDVNTKQLELNH 414

Query: 799 NFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEK 858
           N  +  T   QN  + L +    L+K  E  +NQ    ENQ   +QL+++ + D    + 
Sbjct: 415 NSLSTLTSELQNMSTFLVAY---LAKHKELGENQ-KSVENQHSQLQLKYKALDD----QN 466

Query: 859 TALEEKLNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYA 918
            AL +K N L      I   + EY A++ +++S     S  ++ FE      +K+   YA
Sbjct: 467 KALVDKDNDLKKYTLDIEAQEKEYHAKVDRLQSLFDDLSKKKMLFEQENELLKKKNLEYA 526

Query: 919 VQIEQLNTEIAKL 931
             I+ L+    KL
Sbjct: 527 QNIQSLSERQMKL 539

>TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1192

 Score = 34.3 bits (77), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 75/174 (43%), Gaps = 27/174 (15%)

Query: 748 RLLSEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLS 807
           R  S ++ S  PY     + E+ NELN   + LE+ + Q     DTL  ++    N  L 
Sbjct: 690 RYTSIRNYSLPPYLKINLIGEIYNELNHAVSKLEIVKEQLKYLFDTLSSDEEDRCNKKL- 748

Query: 808 FQNTISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNS 867
              T+ E +  +E + + +    N I  T+N           ++ R +++   LE     
Sbjct: 749 ---TVKEFRDLSEFVFRYYFMYINIINATKN-----------LLSRFSTQNIGLE----- 789

Query: 868 LSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAVQI 921
           L   +E  +E+      ++ K+     IQ D RL F+S + SK   L SY V I
Sbjct: 790 LKKQDETYSELGVNLLMKMNKL-----IQKDRRL-FKSKICSK-TYLISYLVLI 836

>TBLA0A03620 Chr1 (904992..907904) [2913 bp, 970 aa] {ON} Anc_5.414
           YDR356W
          Length = 970

 Score = 34.3 bits (77), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 86/164 (52%), Gaps = 22/164 (13%)

Query: 86  NAELRSAREQVVELRQRLGESETQR--FQSELQ-----RDRLSEQLKQGERY-INATNGR 137
           N  + +  EQ+ +L+Q + E   +   FQ++L+     R RL+E L+  ++  IN     
Sbjct: 331 NENINNNDEQIEKLKQDIAELSKKNLDFQNQLKKSQNDRIRLNELLQDSKKTEIN----- 385

Query: 138 LLESTKKLLDFQRDD--RQVGVIRGKLDQSLSEIKALRDSNSALLDSLERINRELTDKAA 195
              S   L+  Q++D  ++   +  +L + LSEI  L+DS     + ++ +N  L D+  
Sbjct: 386 -FYSDLDLIKEQKNDIEKKNHSLDNELRKKLSEIDELKDSIEECKNQMDNLNYALKDEKK 444

Query: 196 LNKTLSDQLSSQRHDFERELATRDKLN---AVLKKQVNSLHSEL 236
            NKTL+++++ Q++     +AT D+LN     LK + + + SEL
Sbjct: 445 KNKTLTEKITEQQNKL---IATDDQLNEKHEALKSEYDIITSEL 485

 Score = 33.5 bits (75), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 35/125 (28%), Positives = 70/125 (56%), Gaps = 14/125 (11%)

Query: 1182 QAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQ 1241
            Q+ EK+   ++T++ L++++S L+   D L+E+L   E NS ++E N  L LQ ++EN  
Sbjct: 227  QSKEKMKILESTNNQLSLKMSNLQNSYDHLKEQLLGIENNS-NNEKNLLLQLQSEKENLL 285

Query: 1242 AKSLELELRHSVDSSEKLIAD-----------MTKELTTLKENPIQGSVNVEDYTHRLEQ 1290
             K   +E +H +D+S+K +++           + K+   LK+   Q + N+ +   ++E+
Sbjct: 286  RKV--MENKHELDNSQKALSEKELQLIELNKQLDKKAQDLKQLKTQQNENINNNDEQIEK 343

Query: 1291 LKSEF 1295
            LK + 
Sbjct: 344  LKQDI 348

>Suva_2.361 Chr2 complement(634656..635954) [1299 bp, 432 aa] {ON}
            YDR192C (REAL)
          Length = 432

 Score = 33.9 bits (76), Expect = 3.9,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 2/60 (3%)

Query: 1527 AQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGTPF-RFGFASNPPTPFQNTAENG 1585
            +  A S+  +PAF   S  +++F    +K +   A   PF  FG +SN  +PF N  +NG
Sbjct: 196  SSSASSAFGKPAFGAASNTQSAFGTNQNKTTSAGAGAAPFGSFGVSSNNKSPFGNL-QNG 254

>NCAS0A01320 Chr1 (257101..259305) [2205 bp, 734 aa] {ON} Anc_5.260
          Length = 734

 Score = 33.5 bits (75), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 29/62 (46%), Gaps = 5/62 (8%)

Query: 1513 DSANAFSFNAQKVPAQPAFSSRAQPAFSFGSFNKTSFSDLSHKNSVGAASGT-----PFR 1567
            DS   FSFN      QP+ +   +PAFSFG+ +    S      S G A GT     PF 
Sbjct: 177  DSKPGFSFNQNTGGNQPSTTETNKPAFSFGATSDGKDSAAKPTLSFGTAPGTNDSTKPFS 236

Query: 1568 FG 1569
            FG
Sbjct: 237  FG 238

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa]
           {ON} YLR086W (SMC4) - SMC chromosomal ATPase family
           member [contig 172] FULL
          Length = 1396

 Score = 33.5 bits (75), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 86/174 (49%), Gaps = 28/174 (16%)

Query: 511 MVEQQKKIEELESKLTDVGESHVQKINVLNKTIDRNQSTINMLNEQIKNTVKSDMNAKSE 570
           M   +  ++ L+  L D+GES  +K+ +  +  DR++ +   L E++KN  + ++ +   
Sbjct: 408 MAAMKADLQSLKLILGDLGESE-KKLTLEKRACDRDRVS---LEEKLKNLTQKEVKSSRS 463

Query: 571 LIACKRENLSLTQQISTKQNELDELNSKSAQKERDYQLKIAELSVAANKCKSWENSFHLL 630
           L        S+T  IST Q +++EL +   Q E+D    + EL+               +
Sbjct: 464 L-------QSITSSISTTQAKMEELANDQEQHEKD----LLELNGT-------------M 499

Query: 631 TEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHRKRSEETLS 684
            EEK ++++ + SL DKI   S+++ ++E   +   VK+  K+   K  E T+S
Sbjct: 500 KEEKEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTIS 553

>Kpol_483.11 s483 complement(25219..32859) [7641 bp, 2546 aa] {ON}
           complement(25219..32859) [7641 nt, 2547 aa]
          Length = 2546

 Score = 33.5 bits (75), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 57/106 (53%), Gaps = 6/106 (5%)

Query: 865 LNSLSHSEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQL 924
           L++LS  +E++   +G+ + +IQ+    + +  D+++ F   L S EK++T     +E  
Sbjct: 840 LSNLSKEKEQLRIEQGKLEKKIQE---QISVYEDSKIKFNQELESTEKQITDLQSNLESK 896

Query: 925 NTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLANQRIESLA 970
           NTE+  LN + + L +     K   K  D+L  +L    ++++SLA
Sbjct: 897 NTELDNLNKEKSGLMKELTEWKAKFKSHDALVPKL---TEKLKSLA 939

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar to
            uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
            chromosome segregation protein
          Length = 1170

 Score = 33.1 bits (74), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 88/202 (43%), Gaps = 40/202 (19%)

Query: 1117 QEWQQKIETYQQESEKWKLMCQQM---SENTATEIQNLQQQLETFKADIQLKTQENDDLN 1173
             E  ++I+  + ESEK     +++   +E  A EI    + L++   DI+ K +E   +N
Sbjct: 801  HELNEQIKDLESESEKLNDTYEKIKVETEQIANEIDTDTKSLDSTVQDIEKKLEEEIKIN 860

Query: 1174 DRFTRLKKQAHEKLNASKATSDSLAIELSELKTVNDALQEKLNNQETNSVDSESNAALIL 1233
                ++ K + E+L    +  + L +E   +  ++D L+E                   +
Sbjct: 861  ----KMLKTSEEEL---MSVQNDLNVERKRISNIDDELEE---------------LERTI 898

Query: 1234 QLKEENKQAKSLELELRH--------SVDSSEKLIADM-------TKELTTLKENPIQGS 1278
            + KEE+K    LEL+  H        S D  EK + D+       T E+           
Sbjct: 899  KQKEESKNTYELELKQLHHDLSKYKNSTDGIEKALNDIQEEHEWVTDEMLVRSICEQNAG 958

Query: 1279 VNVEDYTHRLEQLKSEFEDEKR 1300
            VNV +Y HR+EQL+  F++ +R
Sbjct: 959  VNVNEYRHRMEQLQKNFDELRR 980

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] {ON}
            Anc_7.186 YFR031C
          Length = 1170

 Score = 33.1 bits (74), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 80/168 (47%), Gaps = 22/168 (13%)

Query: 1144 TATEIQNLQQQLETFKADIQLKTQENDDL--NDRFTRLKKQAHEKLNASK---ATSDSLA 1198
            T  EI +L++ LE      Q+KTQ+ D+L  N    +L+KQ  + LN      AT    +
Sbjct: 270  TTDEIISLKEDLE------QIKTQKKDELDKNGVLPKLEKQEGDFLNQISRINATKQICS 323

Query: 1199 IELSE-----------LKTVNDALQEKLNNQETNSVDSESNAALILQLKEENKQAKSLEL 1247
              L E           L++++  LQEKL+         + + + + QLKEE+K    L  
Sbjct: 324  QNLEENKKKIQKLQNTLESLSRELQEKLDRYREIETAYKQDESTLNQLKEEHKSRSELLS 383

Query: 1248 ELRHSVDSSEKLIADMTKELTTLKENPIQGSVNVEDYTHRLEQLKSEF 1295
             L   + S+ +     T +L+++KE   +  VN++ +  R+E ++ E 
Sbjct: 384  TLSIGISSTGEAETGYTAQLSSVKEQYNETEVNIQTHRKRIEFIEKEL 431

>Skud_14.88 Chr14 (164165..168115) [3951 bp, 1316 aa] {ON} YNL250W
            (REAL)
          Length = 1316

 Score = 33.1 bits (74), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 111/416 (26%), Positives = 185/416 (44%), Gaps = 89/416 (21%)

Query: 608  LKIAELSVAANKC-KSWEN-SFH--LLTEEKTQMEQK-QRSLFDKIQQESKKLLQLETRN 662
            L+IAE       C + +EN SF   LL E K + +   ++SL D +Q E + L  L   +
Sbjct: 682  LEIAERDSCCYLCSRKFENDSFKSKLLQELKIKTDANFEKSLKDTVQNEKEYLDSLRLLD 741

Query: 663  KEL------EVKISGKELH-RKRSEETLSSKITFLSEENKS--LHNDLAFKEEEVKQFIE 713
            K +        KI+    H  K +EET SSK+     E KS  L ND  F E +++  IE
Sbjct: 742  KHIISLSSINEKINNSREHLEKANEETKSSKLKLYELETKSTTLRNDKEFAESDIRPLIE 801

Query: 714  K---SEKQIKWYQQN--------------------IDELSEQNKNKSNKIIELNDKLRLL 750
            +    EK+IK  + N                    +DEL +Q +       ++ND LR L
Sbjct: 802  RFTYVEKEIKDLENNSKSISDELSIYSTSGDGIQTVDELRDQQR-------KMNDSLRQL 854

Query: 751  SEKSLSNKPYPVGTELKELQNELNGMKAALEVSESQATLYKDTLERNQNFYNNSTLSFQN 810
             +  L      +  E  E   E + + +  +  E + +  + +L + QN  +NS  S + 
Sbjct: 855  RKHILG-----IQMEKDEKVKESSRIISLTKEKELKVSEIESSLTQKQNI-DNSIKSKEV 908

Query: 811  TISELQSKNEALSKQHETLQNQITETENQSKGIQLEHQTIIDRLTSEKTALEEKLNSLSH 870
             I ++ S+ EAL  +  +LQN+  E++N           ++D+L +E+         +S 
Sbjct: 909  NIKDIDSRVEALESRIVSLQNKRDESKN-----------VLDQLKNERDL------QISS 951

Query: 871  SEEKIAEMKGEYDAQIQKIESNLKIQSDTRLNFESA----LTSKEKELTSYAVQI----E 922
             ++ +A++    D + Q I   +       ++FES     L +  KEL S  VQ+    E
Sbjct: 952  KQKNVADVNRLID-RYQTIYKEV-------IDFESKGFNELQTTVKELGSNKVQMQELKE 1003

Query: 923  QLNTEIAKLNSDIAALTEPAEARKTLIKERDSLGQELKLANQRIES----LAAQNS 974
            QL+ ++ ++N +   L +     K L +  + +G  LK   Q IES    L  QN+
Sbjct: 1004 QLDVKMNEVNEEKRKLADSNNEEKNLRQNLELIG--LKSQFQNIESEINRLDVQNA 1057

>Skud_4.196 Chr4 (341072..346450) [5379 bp, 1792 aa] {ON} YDL058W
            (REAL)
          Length = 1792

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query: 783  SESQATLYKDTLERNQNFYNNSTLSFQNTISELQSKNEALSKQHETLQNQITETENQS-- 840
            S +Q   YK  +   +  YN       N I+ +Q KNE + + +E L+ +I E E  S  
Sbjct: 1157 SVAQVEEYKKQISDKEKEYNGKLSELNNEINSVQQKNETICQNNEKLKGEIEEIEKASED 1216

Query: 841  ----KGIQLEHQTI-IDRLTSEKTALEEKL----NSLSHSEEKIAEMKGEYDAQIQKI-- 889
                KG ++E     I+ L   K   E KL     ++    EK+ E++ E DA++ KI  
Sbjct: 1217 QSNLKGSKIEALNAQIEELEESKQITETKLLDSVKNMKTEMEKMRELQKESDAKMVKINE 1276

Query: 890  ----ESNLKIQSDTRLNFESALTSKEKELTSYAVQIEQLNTEIAKLN-SDIAALTEPAEA 944
                +  LK      L  +       KEL     ++  L  +I  LN S+    TE    
Sbjct: 1277 LEEKQEALKHIGIQNLELQKGAEEARKELEDKKTEVNGLLEKITSLNKSNEKTETESTRL 1336

Query: 945  RKTLIKERDSL-GQELKLANQ 964
            +KT  +E+  L GQ  KL N+
Sbjct: 1337 KKTYAEEKTILEGQLEKLRNE 1357

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score = 32.7 bits (73), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 88/197 (44%), Gaps = 39/197 (19%)

Query: 561 VKSDMNAKSELIACKRENLSLTQQISTKQNELDELNSKSAQK----ERDYQLKIAELSVA 616
           V++D    S+ I  K   L   +Q+   QNEL   N + A K    E++Y  K+  L   
Sbjct: 361 VRTDKGYMSKAIYDK---LEYDEQVH--QNELATFNKEQADKYDATEKEYNDKLTLLQSQ 415

Query: 617 ANKCKSWENSFHLLTEEKTQMEQKQRSLFDKIQQESKKLLQLETRNKELEVKISGKELHR 676
            ++ ++      L T+EK ++ + + S         KK+L L   +      IS K +  
Sbjct: 416 IDELQATMEQLRLDTKEKIKVSESELS---------KKMLDLNATH------ISSKNVIF 460

Query: 677 KRSEETLSSKITFLSEENKSLHNDLAFKEEEVKQFIE-------KSEKQIKWYQQNIDEL 729
           K +E   + KI        +  +++  K EEVK  IE       + + +   YQ  +D+L
Sbjct: 461 KETENIKTQKI--------AERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAKLDDL 512

Query: 730 SEQNKNKSNKIIELNDK 746
           + Q  +K  KI ELNDK
Sbjct: 513 TAQLDSKVEKIQELNDK 529

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.123    0.317 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 154,581,689
Number of extensions: 6926343
Number of successful extensions: 66479
Number of sequences better than 10.0: 3149
Number of HSP's gapped: 58801
Number of HSP's successfully gapped: 6676
Length of query: 1608
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1485
Effective length of database: 39,377,481
Effective search space: 58475559285
Effective search space used: 58475559285
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)