Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021105.700ON1200120061520.0
NCAS0G002505.700ON1183121134950.0
KAFR0D022405.700ON1187120734180.0
YIL147C (SLN1)5.700ON1220124334160.0
Smik_9.225.700ON1230125734040.0
Suva_9.415.700ON1219125033930.0
Skud_9.215.700ON1221125033930.0
ZYRO0G06644g5.700ON1166121733580.0
CAGL0H06567g5.700ON1169124031350.0
SAKL0E14872g5.700ON1140120231160.0
Kwal_55.197075.700ON1143120031010.0
Kpol_2001.745.700ON1113119830650.0
KLLA0A00638g5.700ON1155122630500.0
TBLA0I016805.700ON1214123730430.0
TPHA0D045905.700ON1127119230050.0
Ecym_40205.700ON1125120226950.0
AFR284W5.700ON1103121226160.0
TPHA0E002505.700ON106891622310.0
KLTH0E01100g5.700ON117776219810.0
NDAI0F003105.700ON125950217030.0
TDEL0B022105.700ON109546514071e-175
Kpol_1043.685.700ON104244312781e-156
TBLA0E021005.700ON114046610381e-121
ADL388W4.385ON4821601834e-13
NDAI0D034304.385ON5972381721e-11
CAGL0F09097g4.385ON6301461693e-11
KNAG0M001804.385ON6151261693e-11
ZYRO0G00484g4.385ON6471271667e-11
Ecym_74744.385ON4961261648e-11
TDEL0D003204.385ON5471931649e-11
KAFR0B069904.385ON5451261631e-10
NCAS0A064504.385ON6091261622e-10
YHR206W (SKN7)4.385ON6221591622e-10
Smik_8.2964.385ON6251261622e-10
Suva_15.4124.385ON6171591612e-10
Skud_8.2734.385ON6231261603e-10
KLLA0A10219g4.385ON4751261567e-10
SAKL0B12408g4.385ON4651261558e-10
KLTH0D17182g4.385ON4641201504e-09
Kpol_265.24.385ON5491321514e-09
TBLA0A107004.385ON5871271462e-08
TPHA0C001504.385ON5101261442e-08
Kwal_47.167704.385ON4611761423e-08
Ecym_50775.230ON7951481391e-07
ADR343C5.230ON7491481344e-07
KAFR0J007005.230ON6201261291e-06
TDEL0E039805.230ON7301411263e-06
KLTH0B02684g5.230ON5951421254e-06
CAGL0D02882g5.230ON6671471255e-06
Suva_10.845.230ON6951881255e-06
ZYRO0A11154g5.230ON7761461255e-06
KNAG0B051405.230ON6481271246e-06
Smik_12.685.230ON7122141246e-06
YLR006C (SSK1)5.230ON7121991238e-06
Skud_12.725.230ON7021991211e-05
SAKL0B01210g8.34ON15881111193e-05
Kpol_1004.45.230ON7141501158e-05
NCAS0D029005.230ON7621391149e-05
KLLA0E09505g5.230ON635721149e-05
Kwal_33.152885.230ON5871431122e-04
Klac_YGOB_Anc_8.348.34ON1571881086e-04
NDAI0I020005.230ON8901481060.001
SAKL0G12100g5.230ON738721050.001
TPHA0N008505.230ON6701481050.001
Ecym_15088.34ON16941361040.002
TBLA0D031705.230ON7651501020.003
CAGL0K12562g8.34ON1682132940.027
Kpol_1035.408.34ON1517123820.59
KLTH0G18612g8.34ON152487810.98
KAFR0C037201.124ON26860771.5
TPHA0D003608.34ON1536136772.4
TPHA0F023702.66ON42762762.8
TDEL0C005908.34ON1602134772.9
TPHA0N00800singletonON30290744.4
YFL033C (RIM15)8.34ON1770132745.4
KAFR0C035208.34ON145084738.2
Skud_6.388.34ON175899729.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02110
         (1200 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  2374   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1350   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1321   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...  1320   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...  1315   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...  1311   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...  1311   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1298   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...  1212   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1204   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1199   0.0  
Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  1185   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1179   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....  1176   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1162   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...  1042   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...  1012   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   863   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   767   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   660   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...   546   e-175
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   496   e-156
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   404   e-121
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    75   4e-13
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     71   1e-11
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    70   3e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    70   3e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    69   7e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    68   8e-11
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    68   9e-11
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    67   1e-10
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    67   2e-10
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    67   2e-10
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    67   2e-10
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    67   2e-10
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    66   3e-10
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    65   7e-10
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    64   8e-10
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    62   4e-09
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    63   4e-09
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    61   2e-08
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    60   2e-08
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    59   3e-08
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    58   1e-07
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    56   4e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    54   1e-06
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    53   3e-06
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    53   4e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    53   5e-06
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    53   5e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    53   5e-06
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    52   6e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    52   6e-06
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    52   8e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    51   1e-05
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    50   3e-05
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    49   8e-05
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    49   9e-05
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    49   9e-05
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    48   2e-04
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    46   6e-04
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    45   0.001
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    45   0.001
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    45   0.001
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    45   0.002
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    44   0.003
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    41   0.027
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    36   0.59 
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    36   0.98 
KAFR0C03720 Chr3 complement(757451..758257) [807 bp, 268 aa] {ON...    34   1.5  
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    34   2.4  
TPHA0F02370 Chr6 complement(521679..522962) [1284 bp, 427 aa] {O...    34   2.8  
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    34   2.9  
TPHA0N00800 Chr14 (178261..179169) [909 bp, 302 aa] {ON}               33   4.4  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    33   5.4  
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    33   8.2  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    32   9.3  

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 2374 bits (6152), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1155/1200 (96%), Positives = 1155/1200 (96%)

Query: 1    MWFRLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIA 60
            MWFRLRSFTPKPPYRVGIRAQLTM               TTGVYFTSNYKNLRSDRLYIA
Sbjct: 1    MWFRLRSFTPKPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIA 60

Query: 61   AQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSN 120
            AQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSN
Sbjct: 61   AQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSN 120

Query: 121  LFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKN 180
            LFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKN
Sbjct: 121  LFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKN 180

Query: 181  GSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVY 240
            GSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVY
Sbjct: 181  GSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVY 240

Query: 241  TNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAV 300
            TNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAV
Sbjct: 241  TNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAV 300

Query: 301  GYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPI 360
            GYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPI
Sbjct: 301  GYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPI 360

Query: 361  VRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQ 420
            VRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVST         EKAQ
Sbjct: 361  VRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTNNINNNNSNEKAQ 420

Query: 421  PPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVN 480
            PPSDQD         IAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVN
Sbjct: 421  PPSDQDTNTNNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVN 480

Query: 481  LIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETAN 540
            LIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETAN
Sbjct: 481  LIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETAN 540

Query: 541  EAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXX 600
            EAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSG            
Sbjct: 541  EAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLT 600

Query: 601  FSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNR 660
            FSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNR
Sbjct: 601  FSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNR 660

Query: 661  IIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSL 720
            IIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSL
Sbjct: 661  IIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSL 720

Query: 721  NVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSS 780
            NVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSS
Sbjct: 721  NVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSS 780

Query: 781  YDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPF 840
            YDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPF
Sbjct: 781  YDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPF 840

Query: 841  VQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFAN 900
            VQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFAN
Sbjct: 841  VQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFAN 900

Query: 901  VEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKC 960
            VEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKC
Sbjct: 901  VEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKC 960

Query: 961  DRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQS 1020
            DRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQS
Sbjct: 961  DRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQS 1020

Query: 1021 TGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVI 1080
            TGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVI
Sbjct: 1021 TGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVI 1080

Query: 1081 KRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDL 1140
            KRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDL
Sbjct: 1081 KRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDL 1140

Query: 1141 HCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDEREEDSKPVET 1200
            HCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDEREEDSKPVET
Sbjct: 1141 HCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDEREEDSKPVET 1200

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1350 bits (3495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 721/1211 (59%), Positives = 871/1211 (71%), Gaps = 76/1211 (6%)

Query: 2    WFRLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAA 61
            W+ L     KPP+R+GIR QLT+               TTGVYFTSNYKNLRSDRLYIAA
Sbjct: 8    WYVL-----KPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAA 62

Query: 62   QLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNL 121
            QLKSSQIDQNLNYLYYQ YW++SRDTLQ GL NYVAGNK+  NW DS+ V++KFL S+NL
Sbjct: 63   QLKSSQIDQNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNL 122

Query: 122  FSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNG 181
            FS A++YDSSF  VL  TNN TGDLIPE VL +L PL+TN PL SSLET GI+T+PV NG
Sbjct: 123  FSNAQLYDSSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNG 182

Query: 182  SSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYT 241
            S+Y+MSMSLPIFANPSIILTDS+VYGY+T+VMSAEGL +VFNDTTALE+S VAIVS VY 
Sbjct: 183  STYIMSMSLPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYN 242

Query: 242  NATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVG 301
            N + L+AY FVF P+G+ S ++N TF + NN+FL++ALR+GKGG++K T+ FY   +AVG
Sbjct: 243  NESTLNAYHFVFAPYGAPSYVINSTFRIMNNSFLNTALREGKGGSVKKTKFFYTKNIAVG 302

Query: 302  YSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIV 361
            YSP T +  NW+AIV+Q ESVF+SP+TKLAKII+GTVV IGVF  LITFPLAHWAVKPIV
Sbjct: 303  YSPCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIV 362

Query: 362  RLQKATELITESRGLRPTTPTSG--SRANSI---LRDKSSLISFPLHPVSTXXXXXXXXX 416
            RLQKATEL++E RGL+ TTP S   SR++SI   +R      +  +H  S          
Sbjct: 363  RLQKATELMSEGRGLKSTTPGSKNVSRSSSIKHYVRSNIPSTASSVHNFSGDNLSTTTNG 422

Query: 417  EKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYT 476
               Q                + SN   E   +A+      S+S  +D  + LSN SK  T
Sbjct: 423  HLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTD-LSNRSKKLT 481

Query: 477  TAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEA 536
            T+ NLI+ARVP YR LF DELSDLT+TFN MTDALDQHYALLE+RVRARTKQLEAAKIEA
Sbjct: 482  TSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAKIEA 541

Query: 537  ETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXX 596
            ETANEAKT+FIANISHELRTPLNGILGMTAISMEETDI KIR+SLKLIFRSG        
Sbjct: 542  ETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLHILT 601

Query: 597  XXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYG 656
                FSKNVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ VRLSI+L PN+IR+M+L+G
Sbjct: 602  ELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMILFG 661

Query: 657  DSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDS 716
            DSNRIIQIVMNLVSNALKFTPVDGKV+VR+K++G YDE LS + N  KV VK GTE  + 
Sbjct: 662  DSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEFIE- 720

Query: 717  TPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYE-------- 768
            T +  +    +  D  TS  +      +  +  ++ + D ++  SDE    E        
Sbjct: 721  TKAKAILGAPKKDDPKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDEKEDEGEED 780

Query: 769  -----------DNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVI 817
                       + +S++S++TSSYDDA+FN+QFKKT  LY ED++  +G+EL  PKTWVI
Sbjct: 781  NSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELY-EDEDGNLGIELTNPKTWVI 839

Query: 818  SFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESK 877
            + EV+D+GPGID  LQ+SVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M L+S+
Sbjct: 840  AIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMELKSE 899

Query: 878  VGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIV 937
            VGVGS FTFT+PL QTRE+     + PFEDEFN  S+KNR+VKF++A+SL SRKSRSS  
Sbjct: 900  VGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSRKSRSSTT 959

Query: 938  TAGASSH-HSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRN 996
            T   ++  H+V             +    D++  N   + G       E D H    H +
Sbjct: 960  TFSTTNSLHNVQ------------EEKEEDKLGDNEETKDG-----GKEEDAHQERRH-S 1001

Query: 997  RDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTK 1056
             DK++E  +    T+++DRPFLQSTGTATSTR+I                         +
Sbjct: 1002 HDKNNEHNNHLLGTVNMDRPFLQSTGTATSTRTI-------------------------Q 1036

Query: 1057 KTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYN 1116
               +    +KILVAEDNHVNQEVIKRML LEGV++I+LA DGQDAF++VK + ++G  ++
Sbjct: 1037 TVPDAGKKFKILVAEDNHVNQEVIKRMLNLEGVENIELARDGQDAFNEVKAMVEQGEHFD 1096

Query: 1117 LIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR 1176
            +IFMDVQMPKVDGL STKMIR+DLH  +PIVALTAFADDSNIKECL+AGM+GFLSKPIKR
Sbjct: 1097 MIFMDVQMPKVDGLLSTKMIRNDLHYTYPIVALTAFADDSNIKECLEAGMNGFLSKPIKR 1156

Query: 1177 TKLKTILKEFC 1187
             K+KTIL+E+C
Sbjct: 1157 PKVKTILEEYC 1167

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1321 bits (3418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 716/1207 (59%), Positives = 852/1207 (70%), Gaps = 81/1207 (6%)

Query: 4    RLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQL 63
            RL     KPPYR+ IR QL                 TTGVYFTS+YKNLR++RLYIAAQL
Sbjct: 17   RLAHLNTKPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQL 76

Query: 64   KSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFS 123
            KSSQIDQ L YLYYQ YW+++RDTLQ  LAN+VAGNKS +NW  ++SVLEKFL SS+ FS
Sbjct: 77   KSSQIDQTLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFS 136

Query: 124  VARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSS 183
              +VYD +F TVL+ TNN TG+ I  DVL +L PLSTN+PL SSLET GI+T+PV NG+S
Sbjct: 137  AVKVYDENFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTS 196

Query: 184  YLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNA 243
            YLMSMSLP+FANPSIIL+ SRVYGY+T++M+A+GLLSVFNDTTA+E+S VAIVSAVY N 
Sbjct: 197  YLMSMSLPVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQ 256

Query: 244  TKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYS 303
            ++LDAY    PP+G T+S+ +  F L N++FL+ AL+QGKGG++K T   Y   +AVGYS
Sbjct: 257  SELDAYHLALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYS 316

Query: 304  PSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRL 363
            P +  LANWV++V+QAESVF  P+TKL KIIAG VVGI VF ML+T PLA++AVKPIVRL
Sbjct: 317  PCSFELANWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRL 376

Query: 364  QKATELITESRGLRPTTPTSG--SRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQP 421
            +KATE+ITE RGLRPTTP SG  SR +S+ R+KS   S      ST         E +  
Sbjct: 377  KKATEIITEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSRKSTATGNSNSLNENSAS 436

Query: 422  PSDQDXXXXXXXXXI----AVSNIREEHSPHADGVFSGISLSNVS-DRLERLSNTSKHYT 476
             S            +     +S I    +       S  +++ ++ D  +RLS  SKH  
Sbjct: 437  LSSHPMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLI 496

Query: 477  TAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEA 536
            T  NL +ARVP  R LF DELSDLTETFNTMTDALD+HY LLE+RVRARTKQLEAAKI+A
Sbjct: 497  TFTNLTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQA 556

Query: 537  ETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXX 596
            E ANEAKTVFIANISHELRTPLNGILGMTAISMEE DI KIR+SLKLIFRSG        
Sbjct: 557  EAANEAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILT 616

Query: 597  XXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYG 656
                FSKNVL+RTKLEKRNFCITDVALQ+KSIFGKVAKDQHVRLSIILSPN++R+MVLYG
Sbjct: 617  ELLTFSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYG 676

Query: 657  DSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDS 716
            DSNRIIQ+VMNLVSNALKFTPVDGKV V++K+LG YDE  S+     KVYVK GTE T  
Sbjct: 677  DSNRIIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEFTSI 736

Query: 717  TPSLNVKSEGQG-------------KDKFTSDTASKNNTSSDTAYDATPTTDRVAQE--- 760
               L   S+ +              K+K     A+   + SD+   +  TT   +Q+   
Sbjct: 737  PAELAALSKRESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGTTINTSQQRTS 796

Query: 761  SDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFE 820
            S+ED  Y DN S+ S++TSSYDDAIFNSQFKKT +LY ED++  +G EL   KTWV   E
Sbjct: 797  SNED--YVDNISIASTSTSSYDDAIFNSQFKKTPDLY-EDEDGNLGEELSQQKTWVFRIE 853

Query: 821  VEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGV 880
            V D+GPGID  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M LES VG 
Sbjct: 854  VIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTLESTVGS 913

Query: 881  GSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAG 940
            GSKF FT+PLTQTR I     E P+EDEFN KSK NRKVKF +ARS+NSR+SRSS++T+ 
Sbjct: 914  GSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRSSLITSN 973

Query: 941  ASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKD 1000
            +S   +V   +  ++     D S S++    SP+                          
Sbjct: 974  SSRIATVREESRLETRSNHSDVSTSNKNESASPQ-------------------------- 1007

Query: 1001 HERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSE 1060
                  S S ++LDRPFLQSTGTA S+ ++P +++  +       LNV            
Sbjct: 1008 ----PESGSNLNLDRPFLQSTGTAISSANVPTVATLGKT------LNV------------ 1045

Query: 1061 GNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFM 1120
                   LVAEDNHVNQEVIKRML LEGVK+IDLACDGQDAFD VK L+++G  Y++IFM
Sbjct: 1046 -------LVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDNVKSLKERGEFYDMIFM 1098

Query: 1121 DVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLK 1180
            DVQMPKVDGL++TKMIR+DL  + PIVALTAFADDSNIKECLDAGMDGFLSKPIKR +LK
Sbjct: 1099 DVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDAGMDGFLSKPIKRPQLK 1158

Query: 1181 TILKEFC 1187
            TIL E+C
Sbjct: 1159 TILLEYC 1165

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score = 1320 bits (3416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1243 (59%), Positives = 866/1243 (69%), Gaps = 110/1243 (8%)

Query: 12   PPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71
            PP+R+GIR QLT                TTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 
Sbjct: 13   PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 72   LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131
            LNYLYYQ Y++ASRD LQ+ L +YVAGNKS  NW+DS SV++KFL SSNLF VA+VYDSS
Sbjct: 73   LNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132

Query: 132  FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191
            F  VLN TNN TGDLIPEDVL  L PLST+ PLPSSLET GI+T+PV N + YLMSMSLP
Sbjct: 133  FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192

Query: 192  IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251
            IFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE S +AI+SAVY +  K   Y F
Sbjct: 193  IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252

Query: 252  VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311
            VFPP+GS S +  + F + N+TF+SSA R GKGG+LK T +      A+GYSP + NL N
Sbjct: 253  VFPPYGSRSDLPQKVFSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLVN 312

Query: 312  WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371
            WVAIV+Q ESVF+SPATKLAKII GTV+ IGVF +L+T PLAHWAV+PIVRLQKATELIT
Sbjct: 313  WVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELIT 372

Query: 372  ESRGLRPTTPTSGSRANSILRDKSSLISFP------------------------------ 401
            E RGLRP+TP + SRA+S  R  SS  + P                              
Sbjct: 373  EGRGLRPSTPRTISRASSFKRGFSSGFAVPSSLLQFNTAEAGSTTSVSGHGGSGHGSGAA 432

Query: 402  LHPVSTXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNV 461
                S+         EK  PP +++           + N   +     DG  +   L   
Sbjct: 433  FSANSSMKSAINLGNEKMSPPEEENK----------IPNNHTDAKISMDGSLNHDLLGPH 482

Query: 462  SDR---LERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALL 518
            S R    +R SN S   TT+ NL +AR+P YR LF DELSDLTETFNTMTDALDQHYALL
Sbjct: 483  SLRHNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALL 542

Query: 519  EERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIR 578
            EERVRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETD++KIR
Sbjct: 543  EERVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIR 602

Query: 579  NSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHV 638
            NSLKLIFRSG            FSKNVL+RTKLEKR+FCITDVALQIKSIFGKVAKDQ V
Sbjct: 603  NSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRV 662

Query: 639  RLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSE 698
            RLSI L PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG VDVRMK+LG YD+ LSE
Sbjct: 663  RLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSE 722

Query: 699  KYNHNKVYVKPGTEITDSTPSLN------VKSEGQGKDKFTSDTASKNNTSSDTAYDATP 752
            K  + +VY+K GTE+T++  + +      + +  +  D  +S T+  +N  + T  +   
Sbjct: 723  KKQYKEVYIKKGTEVTENLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEIT 782

Query: 753  TTDRVAQES-------DEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEM 805
              + VA ES        E    +D  S++S+TTSSYD+AIFNSQF K     D+++   +
Sbjct: 783  KRNTVANESIYKKVNDREKASNDDVSSIVSTTTSSYDNAIFNSQFNKAPG-SDDEEGGNL 841

Query: 806  GVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA 865
            G  +E PKTWVIS EVED+GPGID  LQESVF PFVQGDQTLSRQYGGTGLGLSICRQLA
Sbjct: 842  GRPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLA 901

Query: 866  GMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMAR 925
             MM G M LESKVGVGSKFTFTLPL QT+EI+FA++E PFEDEFN +S+KNR+VKF +A+
Sbjct: 902  NMMHGTMKLESKVGVGSKFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAK 961

Query: 926  SLNSRKSRSSIVTAGAS----------------SHHSVHTRTPTKSPRLKCD----RSVS 965
            S+ SR+S SS+ T   +                 H +     P      K D      + 
Sbjct: 962  SIKSRQSTSSVATPATNRSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQ 1021

Query: 966  DRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTAT 1025
            ++ +  S   TG  +       + LS  HR+R   HE L + N    LDRPFLQSTGTAT
Sbjct: 1022 EKNIKPSICLTGAEVN----EQNSLSSKHRSR---HEGLGSVN----LDRPFLQSTGTAT 1070

Query: 1026 STRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQ 1085
            S+R+IP   + K++  N+                    + KILV EDNHVNQEVIKRML 
Sbjct: 1071 SSRNIP---TVKDDDKNET-------------------SVKILVVEDNHVNQEVIKRMLN 1108

Query: 1086 LEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFP 1145
            LEG+++I+LACDGQ+AFDKVK+L  KG  YN+IFMDVQMPKVDGL STKMIR DL    P
Sbjct: 1109 LEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLGYTSP 1168

Query: 1146 IVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188
            IVALTAFADDSNIKECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1169 IVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCA 1211

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 749/1257 (59%), Positives = 876/1257 (69%), Gaps = 114/1257 (9%)

Query: 1    MWFRLRS---FTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRL 57
            M  RL S   FTP  P+R+GIRAQLT                TTGVYFTSNYKNLRSDRL
Sbjct: 1    MRLRLPSKSEFTP--PFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRL 58

Query: 58   YIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLG 117
            YIAAQLKSSQIDQ LNYLYYQ Y++ASRD LQ+ L ++VAGNKS  NW+DS SV++KFL 
Sbjct: 59   YIAAQLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLS 118

Query: 118  SSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNP 177
            SSNLF VA+VYDSSFTTVLN TNN TGDLIPEDVL  L PLST+ PLPSSLET GI+T+P
Sbjct: 119  SSNLFYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDP 178

Query: 178  VKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVS 237
            V N + YLMSMSLPIFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE+S VAI+S
Sbjct: 179  VVNNTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIIS 238

Query: 238  AVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLK 297
            A+Y N  K   Y F+FPP+G+ S++    F + NNTF+SSA R GKGG+LK T  F    
Sbjct: 239  ALYNNQGKASGYHFIFPPYGTASTLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKN 298

Query: 298  LAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAV 357
            LA+GYSP +  L NWVA+V+Q ESVF+SPATKLAKII GTV+ IGVF +L+T PLAHWAV
Sbjct: 299  LALGYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAV 358

Query: 358  KPIVRLQKATELITESRGLRPTTPTSGSRANSILRD-------KSSLISF---------- 400
            +PIVRLQKATELITE RGLRP+TP + SRA+S  R         SSL+ F          
Sbjct: 359  QPIVRLQKATELITEGRGLRPSTPRTVSRASSFKRGFGSGFTVPSSLLQFNTGESGSTIS 418

Query: 401  -------------PLHPVSTXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSP 447
                              S+         EK  P  D+            + N   +   
Sbjct: 419  ASGHGGSGHGSGAAFSTESSMKSAINLGNEKLLPSEDEKK----------IPNNNTDAKV 468

Query: 448  HADGVFSGISLSNVSDR---LERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETF 504
              DG  +   L+  S R    +R SN S   TT+ NL +AR+P YR LF DELSDLTETF
Sbjct: 469  SMDGSLNHDLLAPNSLRNNDTDRSSNRSHILTTSANLTEARLPDYRRLFSDELSDLTETF 528

Query: 505  NTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGM 564
            NTMTDALDQHYALLE+RVRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGM
Sbjct: 529  NTMTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGM 588

Query: 565  TAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQ 624
            TAISMEETD++KIRNSLKLIFRSG            FSKNVL+RTKLEKR+FCITDVALQ
Sbjct: 589  TAISMEETDVNKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQ 648

Query: 625  IKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDV 684
            IKSIFGKVAKDQ VRLSI L PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG VDV
Sbjct: 649  IKSIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDV 708

Query: 685  RMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLN-----VKSEGQGKDKFTSDTASK 739
            RMK+LG YD+ LSEK    +V+VK GTEIT+ +   N     + S  +      S T S 
Sbjct: 709  RMKLLGEYDKDLSEKKQFKEVHVKRGTEITEYSEETNKCDIPISSNHRKHVDLESTTTSI 768

Query: 740  NNTSSDTAYDATPTTDRVAQESDEDNMYE---DNESM--------ISSTTSSYDDAIFNS 788
              ++ DT+      T R    +  +N+Y+   D E +        +S+TTSSYDDAIFNS
Sbjct: 769  -TSNRDTSIIQEEITKR--NTAANENIYKRMNDAEKLSSDDVSSIVSTTTSSYDDAIFNS 825

Query: 789  QFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLS 848
            QF K     DED+   +G  +E PKTWVIS EVED+GPGID  LQESVF PFVQGDQTLS
Sbjct: 826  QFNKAPG-SDEDEGGNLGKPIENPKTWVISIEVEDTGPGIDPSLQESVFHPFVQGDQTLS 884

Query: 849  RQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDE 908
            RQYGGTGLGLSICRQLA MM G M LESKVGVGSKFTFTLPL QT+EI+FAN++ PFEDE
Sbjct: 885  RQYGGTGLGLSICRQLANMMNGTMRLESKVGVGSKFTFTLPLPQTKEISFANMDFPFEDE 944

Query: 909  FNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPR-----LKCDRS 963
            FN +S+KNR+VKF +A+S+ SR+S SSI T   +    ++   P    +      + + S
Sbjct: 945  FNPESRKNRRVKFNVAKSIKSRQSTSSIATPATNRSSLINDVLPEIGSKNENQIKRFENS 1004

Query: 964  VSDRVVINSPERTGEN---------ITFRS-ESDDH--LSHMHRNRDKDHERLSASNSTM 1011
               R  +N   R  +          I F S ES +   +   HR+R++       S  ++
Sbjct: 1005 NMKREGVNGIGRIEQKLQEKNVKPFICFSSAESSEKKTVPPKHRSREE-------SLGSV 1057

Query: 1012 SLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAE 1071
            +LDRPFLQSTGTATS+R++P   + ++   ND                    + KILV E
Sbjct: 1058 NLDRPFLQSTGTATSSRNVP---TIQDNDKNDT-------------------SIKILVVE 1095

Query: 1072 DNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLT 1131
            DNHVNQEVIKRML LEG+++I+LACDGQ+AFDKVK+L  KG  YN+IFMDVQMPKVDGL 
Sbjct: 1096 DNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGLL 1155

Query: 1132 STKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188
            STKMIR DL    PIVALTAFADDSNIKECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1156 STKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCA 1212

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/1250 (59%), Positives = 868/1250 (69%), Gaps = 100/1250 (8%)

Query: 1    MWFRLRS---FTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRL 57
            M FRL S   FTP  P+R+ IRAQLT                TTGVYFTSNYKNLRSDRL
Sbjct: 1    MRFRLPSRSVFTP--PFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRL 58

Query: 58   YIAAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLG 117
            YIAAQLKSSQIDQ LNYLYYQ Y++ASRD LQ  L  YVAGNKS  NW+DS S+++KFL 
Sbjct: 59   YIAAQLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLS 118

Query: 118  SSNLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNP 177
            SSNLF VA+VYDSSFTTVLN TNN TGDLIP+D+  +L PLST++ LPSSLET GI+T+P
Sbjct: 119  SSNLFFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDP 178

Query: 178  VKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVS 237
            + N + YLMSMSLPIFANPSIILTDSRVYGY+T++MSAEGL SVFNDTTALE+S VAI+S
Sbjct: 179  ILNSTDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIIS 238

Query: 238  AVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLK 297
            AVY N +K  AY FVFPP+G++SSI    FP+ NNTF+SSA + GKGG+LK T  F    
Sbjct: 239  AVYNNQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKN 298

Query: 298  LAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAV 357
            LA+GYSP +  L NWVA+V+Q ESVF+SP+TKLAKII GTV+ IGVF +L+T PLAHWAV
Sbjct: 299  LALGYSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAV 358

Query: 358  KPIVRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLH-----------PVS 406
            +PIVRLQKATELITE RGLRP+TP + SR +S  R  SS  + P               S
Sbjct: 359  QPIVRLQKATELITEGRGLRPSTPRTVSRTSSFKRGFSSGFAVPSSLLQFNSGEAGSTTS 418

Query: 407  TXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLE 466
                        A   +D             +S + EE     D   + IS+    +   
Sbjct: 419  ASGHGCSGRGSAAVMSTDSSMKSAMNIGNEKLSPLEEEKRTPNDHNNAKISMDGSLNHDL 478

Query: 467  RLSNTSKH------------YTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQH 514
               N  +H             TT+ NL +AR+P YR LF DELSDLTETFNTMTDALDQH
Sbjct: 479  LAPNALRHSDNDRSSSRSHILTTSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQH 538

Query: 515  YALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDI 574
            YALLE+RVRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETD+
Sbjct: 539  YALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDV 598

Query: 575  DKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAK 634
            +KIRNSLKLIFRSG            FSKNVL+RTKLEKR+FCITDVALQIKSIFGKVAK
Sbjct: 599  NKIRNSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAK 658

Query: 635  DQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDE 694
            DQ VRLSI L PN IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG V+VRMK+LG YD+
Sbjct: 659  DQRVRLSISLFPNFIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDK 718

Query: 695  ALSEKYNHNKVYVKPGTEITDSTPSLN----VKSEGQGKDKFTSDTASKNNTSSDTAYDA 750
             LSEK    +V+V+ GTEI +   ++N     KSE   K   +  T +   ++ DT+   
Sbjct: 719  ELSEKKQFKEVHVRKGTEIIEDIGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQ 778

Query: 751  TPTTDRVAQESDEDNMY-----------EDNESMISSTTSSYDDAIFNSQFKKTTNLYDE 799
               T R    +  +N+Y           +D  S++S++TSSYDDAIFNSQF K     D+
Sbjct: 779  EEITKR--NTAANENIYKKTRDREKSSNDDISSIVSTSTSSYDDAIFNSQFNKALG-SDD 835

Query: 800  DDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLS 859
            D+  ++G  +E PKTW IS EVED+GPGID  LQESVF PFVQGDQTLSRQYGGTGLGLS
Sbjct: 836  DEGGDLGKPIENPKTWAISIEVEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLS 895

Query: 860  ICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKV 919
            ICRQLA MM G M LESKVGVGSKFTFTLPL QT+EI+FAN+  PFEDEFN +S++NR+V
Sbjct: 896  ICRQLANMMHGTMKLESKVGVGSKFTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRV 955

Query: 920  KFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLKCDRSVSD---RVVINSPE-R 975
            KF +ARS+ SR+S SSI T  A+       R    +  L+  RS  +   R +IN  E +
Sbjct: 956  KFNVARSIKSRQSASSIATPTAN-------RCGLTNEMLRKSRSNEEEEGRKIINIEEGK 1008

Query: 976  TGEN-----------------ITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFL 1018
             G N                 I+F S   +        R    E + + N    LDRPFL
Sbjct: 1009 EGGNELDEAHQQLQEKNVKNSISFSSADSNEQKSAPSTRHSREESVGSVN----LDRPFL 1064

Query: 1019 QSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQE 1078
            QSTGTATS R+IP +S+                      + + + + KILV EDNHVNQE
Sbjct: 1065 QSTGTATSNRNIPTVSN----------------------SDKSDSSIKILVVEDNHVNQE 1102

Query: 1079 VIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRH 1138
            VIKRML LEG+++I+LACDGQDAFDKVK+L  +G  YN+IFMDVQMPKVDGL STKMIR 
Sbjct: 1103 VIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLSTKMIRR 1162

Query: 1139 DLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188
            DL    PIVALTAFADDSNIKECL++GM+GFLSKPIKR KLKTIL EFC+
Sbjct: 1163 DLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEFCA 1212

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score = 1311 bits (3393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 738/1250 (59%), Positives = 870/1250 (69%), Gaps = 100/1250 (8%)

Query: 1    MWFRLRSFTP-KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 59
            M FRL S +   PP+R+GIRAQLT                TTGVYFTSNYKNLRSDRLYI
Sbjct: 1    MRFRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYI 60

Query: 60   AAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSS 119
            AAQLKSSQ+DQ LNYLYYQ Y++ASRD LQ+ L +YVAGNKS+ NW+DS SV++KFL SS
Sbjct: 61   AAQLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSS 120

Query: 120  NLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVK 179
            NLF VARVYDSSFTTVLN TNN TGDLIPEDVL  L PLST++PLPSSLET GI+T+P+ 
Sbjct: 121  NLFYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIV 180

Query: 180  NGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAV 239
            N + YLMSMSLPIFANPSIILTDSRVYGY+T+VMSAEGL SVFNDTTALE+S VAI+SA 
Sbjct: 181  NNTDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISAT 240

Query: 240  YTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLA 299
            Y    +   Y FVFPP+G+  SI    FP+ NNTF+SS  R GKGG+LK T  F    LA
Sbjct: 241  YNAQGRASGYHFVFPPYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKNLA 300

Query: 300  VGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKP 359
            +GYSP +  L NWVA+V+Q ESVF+SPATKL KIIAGTV+ IGVF +L+T PL HWAVKP
Sbjct: 301  LGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAVKP 360

Query: 360  IVRLQKATELITESRGLRPTTPTSGSRANSILRD-------KSSLISF------------ 400
            IVRLQKATELITE RGLRP+TP + SRA+S  R         SSL+ F            
Sbjct: 361  IVRLQKATELITEGRGLRPSTPRTVSRASSFRRGFSSGFTAPSSLLQFNTGEACSTTSAN 420

Query: 401  -----------PLHPVSTXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHA 449
                        L   S+         EK  P  +++           + N   +     
Sbjct: 421  GHGSSGHGSGVALSTESSMKSAINLGHEKLSPSEEENK----------IPNNHNDVKISM 470

Query: 450  DGVFSGISLSNVSDR---LERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNT 506
            DG  +   L+  S R    +R S+ S   TT+ NL +AR+P Y+ LF DELSDLTETFNT
Sbjct: 471  DGSLNHDLLAPNSLRNNDTDRSSSRSHILTTSANLTEARLPDYKRLFSDELSDLTETFNT 530

Query: 507  MTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTA 566
            MTDALDQHYALLE+RVRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTA
Sbjct: 531  MTDALDQHYALLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGILGMTA 590

Query: 567  ISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIK 626
            ISMEETD++KIRN+LKLIFRSG            FSKNVL+RTKLE+R+FCITDVALQIK
Sbjct: 591  ISMEETDVNKIRNNLKLIFRSGELLLHILTELLTFSKNVLQRTKLERRDFCITDVALQIK 650

Query: 627  SIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRM 686
            SIFGKVAKDQ VRLSI L PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDG VDVRM
Sbjct: 651  SIFGKVAKDQRVRLSISLFPNLIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGTVDVRM 710

Query: 687  KVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKS--EGQGKDKFT---SDTASKNN 741
            K+LG YD+  SEK    +V+VK GTEITD   S++ +      G+ K+    S TAS  +
Sbjct: 711  KLLGEYDKDSSEKRQFKEVHVKKGTEITDVVESIDKRDLPTSLGRRKYVNLESTTASITS 770

Query: 742  TSSDTAYDATPTTDRVAQESD--------EDNMYEDNESMISSTTSSYDDAIFNSQFKKT 793
               ++A     T    A   +        E +  +D  S++S+TTSSYDDAIFNSQF K 
Sbjct: 771  CRDNSAIQEEITKRNTAANENIYKKANDREKSSNDDVSSIVSTTTSSYDDAIFNSQFNKA 830

Query: 794  TNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGG 853
             +  D D+   +G  +E PKTWVIS EVED+GPGI+  LQESVF+PFVQGDQTLSRQYGG
Sbjct: 831  LD-SDSDESGNVGRPIENPKTWVISIEVEDTGPGIEPSLQESVFQPFVQGDQTLSRQYGG 889

Query: 854  TGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKS 913
            TGLGLSICRQLA MM G M LES+VGVGSKFTFTLPL QT+EI+FAN+E PFEDEFN +S
Sbjct: 890  TGLGLSICRQLANMMHGTMKLESQVGVGSKFTFTLPLHQTKEISFANIEFPFEDEFNPES 949

Query: 914  KKNRKVKFRMARSLNSRKSRSSIVTAGASSHH-----SVHTRTPTKSPRLKCDRSVSDRV 968
            KKNR+VKF +A+S+ SR+S SS+ T   +S+       +  R+  +    K    +  + 
Sbjct: 950  KKNRRVKFSVAKSIKSRQSTSSLTTPVTNSNTLANDVLIEARSSDEEEVEKTKNFIKRKE 1009

Query: 969  VIN-------SPER--TGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQ 1019
              N        P+   T  +++F S        +   R    E L + N    +DRPFLQ
Sbjct: 1010 GENENGKAQQQPQEKNTKHSVSFSSAERSSQKTVSSKRRSQEENLGSVN----IDRPFLQ 1065

Query: 1020 STGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNG-AYKILVAEDNHVNQE 1078
            STGTATS+R++P                       T +  + +G + KILV EDNHVNQE
Sbjct: 1066 STGTATSSRNVP-----------------------TVQGGDKDGTSIKILVVEDNHVNQE 1102

Query: 1079 VIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRH 1138
            VI+RML LEG+ +I+LACDGQ+AFDKVK+L  KG  YN+IFMDVQMPKVDGL STKMIR 
Sbjct: 1103 VIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRR 1162

Query: 1139 DLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS 1188
            DL    PIVALTAFADDSNIKECL++GM+GFLSKPIKR KL TIL EFC+
Sbjct: 1163 DLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEFCA 1212

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1298 bits (3358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 717/1217 (58%), Positives = 841/1217 (69%), Gaps = 121/1217 (9%)

Query: 1    MWFRLRSFTP-KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYI 59
            MW R   F   + P R+GIRAQLT                +TGVYFT NYKNLRS+RLY+
Sbjct: 1    MWMRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYM 60

Query: 60   AAQLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSS 119
            AAQLKS+QIDQNLNY+YYQCYW++SRDTLQ  LANYVAGNK+ ANW+DS +V++KFL SS
Sbjct: 61   AAQLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSS 120

Query: 120  NLFSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVK 179
             LFSVA +YD++FT VL+ TNN TG+ IPE  L +L+PLS N PLPSSL++ GI+TNPV 
Sbjct: 121  GLFSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVL 180

Query: 180  NGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAV 239
            NG+SYLMSMSLPIFANPSIILT S VYGY+T+VMSA+ L +VF+DTTALE+S VAI+SAV
Sbjct: 181  NGTSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAV 240

Query: 240  YTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLA 299
            Y     L +Y FVF P G  SSIL ET P+ N TFLSSALRQGKGGAL+ T+  Y  K+A
Sbjct: 241  YDQNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVA 300

Query: 300  VGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKP 359
            VGYSP +    NW+A+V Q+E+VF+ PATKL KII+GTVVGIGVF  L+TFPLAHWAVKP
Sbjct: 301  VGYSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKP 360

Query: 360  IVRLQKATELITESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKA 419
            IVRLQKATELITE RGLR ++P +GS   S +  +SS    P +  S+          + 
Sbjct: 361  IVRLQKATELITEGRGLRASSPGAGS---SNVSRRSSFFHRPSNCGSSIRSRVTDNHNE- 416

Query: 420  QPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAV 479
                  D             N    HS  A    SG          E LS+ SK  TT+ 
Sbjct: 417  ---KGHDLHGEQIQHGFFAMNGSINHSLAASIASSGN---------EALSDKSKGLTTSA 464

Query: 480  NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539
            NLI+ARVP YR  F DELS+LT+TFNTMTDALDQHYALLE+RVRART+QLEAAKI+AE A
Sbjct: 465  NLIEARVPVYRRFFSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAA 524

Query: 540  NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXX 599
            NEAKTVFIANISHELRTPLNGILGMTAISMEE DIDKI+NSLKLIFRSG           
Sbjct: 525  NEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELL 584

Query: 600  XFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659
             FSKNVLKRTKLEKRNF +TDVALQIKSIFGKVAKDQ VRLSI L PN+IR+MVL+GDSN
Sbjct: 585  TFSKNVLKRTKLEKRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSN 644

Query: 660  RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719
            RIIQIVMNLVSNALKFTPVDGKV+V M +LG YD   SE  NH KVYV PGTE     P 
Sbjct: 645  RIIQIVMNLVSNALKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-----PK 699

Query: 720  LNVKSEGQG---KDKFT-----SDTASK-NNTSSDTAYDATPT---TDRVAQESDEDNMY 767
             N + +  G   K++F+     +DT+S  +N  SDT  + TP    TD      D D   
Sbjct: 700  GNDEKDKGGIEEKERFSIENTPNDTSSNSSNKHSDT--ETTPGLNDTDEKQASDDMDGGE 757

Query: 768  EDNE-----SMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVE 822
            ED E     S  S++TSSY+D +F+SQFKKT  + D+  E E+GVE++  K WVIS  VE
Sbjct: 758  EDVEDADEVSSFSTSTSSYNDTVFHSQFKKTPKVCDDSSE-ELGVEVKDKKKWVISIVVE 816

Query: 823  DSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGS 882
            D+GPGID  L ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M L+SK+GVGS
Sbjct: 817  DTGPGIDSSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGS 876

Query: 883  KFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGAS 942
            +FTFT+PLTQTREINF ++   FEDEFN  SKKNRKVKF++A+SL S++S+SS++T G  
Sbjct: 877  RFTFTVPLTQTREINFDDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPK 936

Query: 943  SHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHE 1002
            S  S  + +  K      DRSV                                      
Sbjct: 937  SSSSDKSLSQLK--LTDSDRSV-------------------------------------- 956

Query: 1003 RLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGN 1062
                      LDRPFLQSTGTA+S  ++   S+                           
Sbjct: 957  ---------RLDRPFLQSTGTASSNTNLGTTSTIN------------------------- 982

Query: 1063 GAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDV 1122
               KILVAEDN VNQEVIKRML LEGV +I+L CDGQ+A DKVKQL + G  YNLIFMDV
Sbjct: 983  ---KILVAEDNDVNQEVIKRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDV 1039

Query: 1123 QMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTI 1182
            QMPK+DGL STKMIR DL+   PIVALTAFADDSNI+ECLDAGMDGFL+KPIKR +L+ I
Sbjct: 1040 QMPKMDGLLSTKMIRRDLNYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKI 1099

Query: 1183 LKEFCSDE--REEDSKP 1197
            ++EFC D+  +E+D +P
Sbjct: 1100 IEEFCPDKQPQEQDKEP 1116

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score = 1212 bits (3135), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 691/1240 (55%), Positives = 826/1240 (66%), Gaps = 130/1240 (10%)

Query: 4    RLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQL 63
            R R F  KPP+R+GIRAQLT                TTGVYFTSNYKNLRSDRLYIAAQL
Sbjct: 9    RRRRFL-KPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQL 67

Query: 64   KSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFS 123
            KSSQ+DQNLNYLYYQCYW+ASRDTLQ  LA+YVAGNK++ NW +S +V++KFL SSNLF 
Sbjct: 68   KSSQLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFF 127

Query: 124  VARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSS 183
            ++RVYD  F  VLNTTNN TGD +PE +  QL PLST+VPLPSSL TNG++T+PV NG+ 
Sbjct: 128  LSRVYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTD 187

Query: 184  YLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNA 243
            YLMSMSLPIFANPSII +D +VYGY+TVVMSAEGL SVFNDTTALE+S VAIVSA Y+N 
Sbjct: 188  YLMSMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNY 247

Query: 244  TKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYS 303
            TK+D+YRFVFPP+G + SILN TF L++++FL+ A +Q KGG++K T+ FY   +A+GY 
Sbjct: 248  TKIDSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYY 307

Query: 304  PSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRL 363
            P + N  NWVA+V+QAESVF+SP+TKL KII+GTVVGI VF  L+TFPLA WAVKPIVRL
Sbjct: 308  PCSFNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRL 367

Query: 364  QKATELITESRGLRPTTPTSGSRANSI-------LRDKSSLISFPL-------------- 402
            QKATELI E RGLRP    SGSR+ S        + D + +    L              
Sbjct: 368  QKATELIAEGRGLRPAGAGSGSRSGSRTSSMKKDINDLNFISRLSLSEKNHRPAYDSASD 427

Query: 403  --HPVSTXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSN 460
              +             + +  PSD D            +N+ E   P    +F       
Sbjct: 428  SNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLTTSTNLNEARLPDYRRLF------- 480

Query: 461  VSDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEE 520
             SD L  L+NT    T A++        + AL +D                         
Sbjct: 481  -SDELSDLTNTFNAMTDALD-------QHYALLED------------------------- 507

Query: 521  RVRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNS 580
            RVRARTKQLEAAKI+AE ANEAKTVFIANISHELRTPLNGILGMTAISMEETDI KIRNS
Sbjct: 508  RVRARTKQLEAAKIQAEAANEAKTVFIANISHELRTPLNGILGMTAISMEETDIAKIRNS 567

Query: 581  LKLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRL 640
            LKLIFRSG            FSKNVLKRT LEKRNFCITDVALQIKSIFGKVAKDQHVRL
Sbjct: 568  LKLIFRSGELLLHILTELLTFSKNVLKRTALEKRNFCITDVALQIKSIFGKVAKDQHVRL 627

Query: 641  SIILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKY 700
            SI L+PN+IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV+VR+K+LG YDE  ++  
Sbjct: 628  SISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLLGEYDEEATKAD 687

Query: 701  NHNKVYVKPGTEITDSTPSLNVKSEGQG-------KDKFTSDTASKNNTSSDTAYDATPT 753
            N  +++    ++     P   V S   G           ++   S ++  ++  YD    
Sbjct: 688  NFKQIHTIADSDAHQQHP---VSSSPNGVLVKHLSTSSDSNSNLSDSDKYNEKTYDEDDD 744

Query: 754  TDRVAQESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPK 813
               +   SD  +      S++SS+TSSYD+A+FN+QFKKT +LY ED    +G EL   K
Sbjct: 745  EHSITNISDHSDD---LSSLVSSSTSSYDNALFNTQFKKTPDLY-EDSNDGLGTELADQK 800

Query: 814  TWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKML 873
            TWV + EVED+GPGID  L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M 
Sbjct: 801  TWVFAIEVEDTGPGIDPKLHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMK 860

Query: 874  LESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFR-MARSLNSRKS 932
            LESKVGVGSKFTFT+PL QTR I F   ED FEDEFN +SKKNR+VKF+   RSL+SR+S
Sbjct: 861  LESKVGVGSKFTFTVPLKQTRVIKFDEEEDLFEDEFNPESKKNRRVKFKDSTRSLHSRRS 920

Query: 933  RSSIVTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPE-----RTGENITFRSESD 987
            R+S+     ++H      +   S   K    V D  +  SPE     + G+      E+D
Sbjct: 921  RTSV--DRITNHSGDKQSSEGHSTSFKISE-VKDEDIEQSPEPDNLPKVGD------END 971

Query: 988  DHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLN 1047
               S      D   E+       + LDRPFLQSTGTATS+R++P +              
Sbjct: 972  SKASSSSSKSDNIKEK----EEKVHLDRPFLQSTGTATSSRNVPTM-------------- 1013

Query: 1048 VSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQ 1107
                A+ T +       +KILVAEDNHVNQEVIKRML LEG+ +IDLACDGQDAFDKV+ 
Sbjct: 1014 ----ADVTMR-------FKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQS 1062

Query: 1108 LQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMD 1167
            L ++   Y++IFMD+QMPKVDGL STKMIR DL+    IVALTAFADDSNIKEC++AGM+
Sbjct: 1063 LVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMN 1122

Query: 1168 GFLSKPIKRTKLKTILKEFC--------SDEREEDSKPVE 1199
            GFLSKPIKR KLK IL+E+C        S E ++  K VE
Sbjct: 1123 GFLSKPIKRPKLKMILEEYCPNWIEMKKSKENKDGDKKVE 1162

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1204 bits (3116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1202 (55%), Positives = 814/1202 (67%), Gaps = 107/1202 (8%)

Query: 11   KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
            KPP++VGIR QL                 TTGVYFT+NYK+LR+DRL++AAQLKSSQIDQ
Sbjct: 12   KPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSSQIDQ 71

Query: 71   NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
            NLNYLYYQCYW+++RDTLQ  L  Y AGN +  NW +++ VLEKFLGSS+LFSVAR+YDS
Sbjct: 72   NLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVARIYDS 131

Query: 131  SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
            +F TVLN TNN +G+L+PE VLT L PLST+ PL SSL+T+GI+T+PV N + Y+MSMSL
Sbjct: 132  TFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVMSMSL 191

Query: 191  PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250
            PIFA+PSI+LT+S + GY+TVVMSAE L  VFNDTTAL++S VAI+SA Y+N +   +Y 
Sbjct: 192  PIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLPVSYH 251

Query: 251  FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310
            FVFPP G  + I++ +F + N +F+ SA    K G++K T  FY   +AVGYSP      
Sbjct: 252  FVFPPHGVGADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPCLFKQV 311

Query: 311  NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370
             WVA+++Q E+VF+SP+T+L  II GT +GI VF  L+TFPLAHWAVKPIVRLQKATE+I
Sbjct: 312  QWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQKATEII 371

Query: 371  TESRGLRPTTPTS-GSRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQPPSDQDXXX 429
            T  RGLR    ++  SR NS          F   P ST              P ++D   
Sbjct: 372  TARRGLRSYNQSAPASRTNS----------FRKRP-STSSSIGSVFRTITDRPHERDNGH 420

Query: 430  XXXXXXIAVSNIREEHSPHADGVFSGI-----SLSNVSDRLERLSNTSKHYTTAVNLIQA 484
                     SN  +      +   SG        +  S   ++ S  S ++  + NLI A
Sbjct: 421  SNFELHHRTSNSVDSQEARMELEISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDA 480

Query: 485  RVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKT 544
            RVP Y  LF DELS+LT+TFNTMTD LD+HYALLE+RVRARTKQLEAAKIEAE ANEAKT
Sbjct: 481  RVPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKT 540

Query: 545  VFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKN 604
            VFIANISHELRTPLNGILGMTAISM E D+ K++NSLKLIFRSG            FSKN
Sbjct: 541  VFIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKN 600

Query: 605  VLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQI 664
            VL+RTKLE+RNF I DVALQ+KSIFGK+AKDQHV LSIILSPN+IR+M+L+GDSNRIIQI
Sbjct: 601  VLQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQI 660

Query: 665  VMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKS 724
            VMNLVSNALKF+PVDGKV VR+K+LG YD   S+  N+N V++KPGTEI D++ S +  S
Sbjct: 661  VMNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLS 720

Query: 725  --EGQGKDKFTSDTASKNNTSSD------TAYDATPTTDRVAQESDED--------NMYE 768
              E    D      ASK++ S         + D + +  +   E+D D        +   
Sbjct: 721  TLEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDTDTDKRSNSEIS 780

Query: 769  DNESMISSTTSSYDDAIFNSQFKKTTNLYD-EDDESEMGVELETPKTWVISFEVEDSGPG 827
            D+ S++SS  SSYDDAI ++Q +K  +  + ED    +G +LE  KTWVI+ EVED+GPG
Sbjct: 781  DSLSLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAIEVEDTGPG 840

Query: 828  IDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFT 887
            I+  L ESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M LESKVGVGSKFTFT
Sbjct: 841  IEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVGVGSKFTFT 900

Query: 888  LPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSV 947
            +PLTQTRE++F +VE+PFEDEFNA SKKNRKVKF+M ++    KSR S+ T+  S   S 
Sbjct: 901  VPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKMNKNSGGSKSRPSVNTSLNSGTDS- 959

Query: 948  HTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSAS 1007
                                        T E +   SES+                   S
Sbjct: 960  ----------------------------TAEKMAL-SESE------------------VS 972

Query: 1008 NSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKI 1067
              ++ +DRPFLQSTGTATSTRSI  + S   E+P                       +KI
Sbjct: 973  VGSVRVDRPFLQSTGTATSTRSITTVKSL--ERP-----------------------FKI 1007

Query: 1068 LVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKV 1127
            LVAEDN+VNQEV+KRML LEG+ DIDLACDGQ+AFDKVK LQ+    Y +IFMDVQMP+V
Sbjct: 1008 LVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRIIFMDVQMPRV 1067

Query: 1128 DGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC 1187
            DGL STKMIR +L    PIVALTAFADDSNIK CLD+GM+GFLSKPIKR KLK++L EFC
Sbjct: 1068 DGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRPKLKSVLSEFC 1127

Query: 1188 SD 1189
             D
Sbjct: 1128 PD 1129

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1199 bits (3101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/1200 (54%), Positives = 799/1200 (66%), Gaps = 97/1200 (8%)

Query: 13   PYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQNL 72
            P  V IR QLT                 TGVYFTS++K+LR++RL++AAQLKSSQIDQNL
Sbjct: 20   PLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKSSQIDQNL 79

Query: 73   NYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSSF 132
            NYLYYQCYW+++RD LQ  L  Y+AGN S  NW D+ + L+KFLGSSNLFS+ARVYDSSF
Sbjct: 80   NYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLARVYDSSF 139

Query: 133  TTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLPI 192
              VLN +NN +G+LIPE++LTQL PLST+V LPSSLE  G++T+PV NGS YLMSMSLPI
Sbjct: 140  QDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYLMSMSLPI 199

Query: 193  FANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRFV 252
            FANPSIIL+ ++VYGY+TVV+SAEGL SV+NDTTAL+ S V IVS VY +  +L  Y  V
Sbjct: 200  FANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-ELAGYHLV 258

Query: 253  FPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLANW 312
            FPP+     ++NE + + N +FL  A++ GKGG++KSTR F   K+AVGYSP  S LA W
Sbjct: 259  FPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPCNSTLAQW 318

Query: 313  VAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELITE 372
            VAI+ Q E++F+SP+T+LAKII GT + I V   ++TFPL+HWAV+PIVRLQKATE+IT 
Sbjct: 319  VAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQKATEIITA 378

Query: 373  SRGLRPTTPTS--GSRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQPPSDQDXXXX 430
             RGLR    ++    +  S     SS+  F    V           +K  P S ++    
Sbjct: 379  GRGLRSDNSSTLFSHKRTSTAESFSSI--FGTGSVRRSGSVARAGRDKYIPDSSKEVPRG 436

Query: 431  XXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSYR 490
                 I   N           V S    S ++   E  +  S+ Y T+ NLI+ARVP Y+
Sbjct: 437  NSSDAIHEVNQENIEDIEMQKVNSPTPYSMMN---ESQAVKSERYITSTNLIEARVPVYK 493

Query: 491  ALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIANI 550
             LF DELS+LTETFNTMTD LD+HYALLE+RVRART+QLEAAKIEAE ANEAKTVFIANI
Sbjct: 494  RLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFIANI 553

Query: 551  SHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRTK 610
            SHELRTPLNGILGMTAI+M E D  K+++SLKLIFRSG            FSKNVLKRTK
Sbjct: 554  SHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVLKRTK 613

Query: 611  LEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLVS 670
            LE+R+F I D+ALQ++SIFGK+AKDQHV L+I + PN++RSMVL+GDSNRI+QIVMNLVS
Sbjct: 614  LEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVMNLVS 673

Query: 671  NALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKSEGQGKD 730
            NALKFTPVDGKVDV+ ++LG YDE  S+   + +V+V P TE    T S   K E   + 
Sbjct: 674  NALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTE--SRTSSTEAKDEKNAES 731

Query: 731  KFTSDT-----------ASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTS 779
               SDT             + N       ++        + SDED+  ED +S+ S  TS
Sbjct: 732  CVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDTKSIGSGNTS 791

Query: 780  SYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEP 839
            SYDDAIF ++ +K ++    ++E+E G  LE+PK WVIS EV D+GPGID  L ESVFEP
Sbjct: 792  SYDDAIFQTRLRKDSS----NEENEEGRALESPKKWVISMEVHDTGPGIDPALHESVFEP 847

Query: 840  FVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFA 899
            FVQGDQTLSRQYGGTGLGLSICRQLA MM G M L+S+VGVGSKF+FT+PLTQT+E+ F 
Sbjct: 848  FVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPLTQTKELLFE 907

Query: 900  NVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPRLK 959
            +VE+PFEDEFN  SKKN        R +  R  +S+  +   S            SP ++
Sbjct: 908  DVENPFEDEFNPDSKKN--------RKVKFRMGKSNKRSKSRSESSGTEGNG-GNSPGVE 958

Query: 960  CDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQ 1019
                       NSP  TG  ++  S                          + +DRPFLQ
Sbjct: 959  GSGG-------NSP-GTGSEVSVGS--------------------------VRVDRPFLQ 984

Query: 1020 STGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEV 1079
            STGTA ST                 L+  SS A++ K          ILVAEDN+VNQEV
Sbjct: 985  STGTALST----------------TLVTTSSLADRRK----------ILVAEDNNVNQEV 1018

Query: 1080 IKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHD 1139
            IKRML LEG++D++LACDGQDAFDKVK     G  Y+LIFMDVQMP+VDGLT+T+MIR +
Sbjct: 1019 IKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFMDVQMPRVDGLTATRMIRKE 1078

Query: 1140 LHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCS---DEREEDSK 1196
            L    PIVALTAFADDSNIKECLDAGM+GFLSKPIKR K+K ILKE+C    DE+E + K
Sbjct: 1079 LGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIKAILKEYCPRPIDEKEGEVK 1138

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 1185 bits (3065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 664/1198 (55%), Positives = 809/1198 (67%), Gaps = 112/1198 (9%)

Query: 11   KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
            KPPYR+ IRAQLT                TTGVYFT NYK LRS RL IAA+LKSSQIDQ
Sbjct: 10   KPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAAKLKSSQIDQ 69

Query: 71   NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
             LNYL+YQC ++ SRDTLQ  L NY AGNK+  NW++S++V++KFL SS+LF VAR+YD 
Sbjct: 70   TLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDL 129

Query: 131  SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
            +F  V+N TNN TGDLIP +VL++L PLSTN  LPSSL  +GI+T+PV NGS YLMSMSL
Sbjct: 130  NFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSL 189

Query: 191  PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250
            PI  NPSIIL+ SRVYGY+T+VMSA+GL +V+ + TALE S V ++SA+Y +  K+D + 
Sbjct: 190  PILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFH 249

Query: 251  FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310
            FVF       S L E +P+ N T+LSSAL +GK G++K T+  +  +LA+GYSP + +L+
Sbjct: 250  FVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308

Query: 311  NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370
            NWVA+V Q E+VF+SP+TKL KII+GTVV I VF  LITFPL+HWAVKPIVRLQKATELI
Sbjct: 309  NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368

Query: 371  TESRGLRPTTPTSGSRANSILRD-KSSLISFPLHPVSTXXXXXXXXXEKAQPPSDQDXXX 429
            ++ RGL+PT+  S   ++S   + + S+ S     +            + Q   D     
Sbjct: 369  SQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNGSNELQSNDD----- 423

Query: 430  XXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSY 489
                    ++ I E  S +        +  N+       S++ + YTT+ NL+QARVP Y
Sbjct: 424  --------MNEINERSSKNNS------TGDNIKSSDNDSSSSFQRYTTS-NLVQARVPVY 468

Query: 490  RALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIAN 549
                +DELS+LT+TFN MT+ALDQHY LLE+RVRARTKQLEAAKIEAE ANEAKTVFIAN
Sbjct: 469  GRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIAN 528

Query: 550  ISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRT 609
            ISHELRTPLNGILGMTAISMEE D DKI+ +LKLIFRSG            FSKNVLKRT
Sbjct: 529  ISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRT 588

Query: 610  KLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLV 669
             LEKR+FCIT++ALQIKSIFGKVA+DQHV+L IIL PN IRSMVL+GDSNRIIQIVMNLV
Sbjct: 589  NLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLV 648

Query: 670  SNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKSEGQGK 729
            SNALKFTP+DGKVDVR+K+LG YDE  S   ++ +VY+K GTE+    P  N K     +
Sbjct: 649  SNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL----PIGNGKKTDMVR 704

Query: 730  DKFTSDTASKNNTSSDTAYDATPTT-----DRVAQESDEDNMYEDNE---------SMIS 775
             K   + + K+    DTA   +  +     D++  E +E N + DNE         SM +
Sbjct: 705  KKI-QELSEKDCIEGDTASSGSHMSGSSKIDKLI-EDEEKNSFSDNEDTNNDIEILSMTT 762

Query: 776  STTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQES 835
            S+T SYDDA    QFKKT +L  +D E  +GVEL  PKTWVIS EVED+GPGI+  LQE+
Sbjct: 763  SSTRSYDDAALQRQFKKTPDL--DDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEA 820

Query: 836  VFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTRE 895
            VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M LES VGVGSKF FT+PL QTRE
Sbjct: 821  VFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTRE 880

Query: 896  INFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKS 955
            I+F   ++ FEDEFNA+SKKNR++KF++  S              + SH S         
Sbjct: 881  IHFD--DEKFEDEFNAESKKNRRIKFKIYDS--------------SKSHDS--------- 915

Query: 956  PRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASN-STMSLD 1014
                           N  +  G     +S  D   S+   N  KD    S  N S + LD
Sbjct: 916  ---------------NDEDEEG----IKSSRDIDSSN---NEHKDENGTSPDNHSKVRLD 953

Query: 1015 RPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNH 1074
            RPFLQSTGTATS++ IP L +                    K+ +    + +ILVAEDNH
Sbjct: 954  RPFLQSTGTATSSQKIPTLIN--------------------KEDTNIEKSIRILVAEDNH 993

Query: 1075 VNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTK 1134
            VNQEVIKRML LE + +IDLACDGQDAFDKVK L D    Y++IFMDVQMPKVDGL STK
Sbjct: 994  VNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTK 1053

Query: 1135 MIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDERE 1192
            MIR DL+   PIVALTAFA+D NIKECLDAGMDGFL KPIKR KLK IL+E+   E++
Sbjct: 1054 MIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYIDTEKQ 1111

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1179 bits (3050), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1226 (52%), Positives = 807/1226 (65%), Gaps = 134/1226 (10%)

Query: 12   PPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71
            PP+ VG+R QL +               TTGVYFT+NYK++R++RL +AAQLKSSQ+DQN
Sbjct: 20   PPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQLKSSQVDQN 79

Query: 72   LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131
            LNYLYYQ YW+++RDTLQ  L N+ AGN S  NW  ++  LEKFLGSS LFS ARVYD+S
Sbjct: 80   LNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFSAARVYDTS 139

Query: 132  FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191
            F TV+N+TNN +GD IPE+VL +L PLS   PL SSL T GIVT+PV N ++YL+SMSLP
Sbjct: 140  FNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTNYLLSMSLP 199

Query: 192  IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251
            +  NPSIIL  + + GY+TV+ SAE L +V NDT AL++S V+I+SAV+ + + L  Y F
Sbjct: 200  VSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSNSSLTGYHF 259

Query: 252  VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311
            VFPP G++S     TFP+ N TF++ A   GK G++  T +     +AVGYSP T  L N
Sbjct: 260  VFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYSPPTFKLVN 319

Query: 312  WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371
            WVA+V Q E VF+SP  +L KIIAGTV  I VF  L+TFP+AHWAV+PIVRLQKATE+IT
Sbjct: 320  WVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRLQKATEIIT 379

Query: 372  ESRGLRPTTPTSGSRANSIL---RDKSS------LISFPLHPVSTXXXXXXXXXEKAQPP 422
              R L+  + T  S +N+ +   R +S+      +  F                    PP
Sbjct: 380  SGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLNHNYNVFPP 439

Query: 423  SDQDXXXXXXXXXIAVSNIREEHSPHADGVFS------GISLSNVSDRLERLSNTSKHYT 476
            S  D          +VS    +  P   G  +          SN S      S TS+ Y 
Sbjct: 440  SRTDSP--------SVSARNSQTIPRGPGDLTRSATTGSTPFSNDSS-----SYTSERYI 486

Query: 477  TAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEA 536
             + NL++A VP YR  F+DELS+LT+TFNTMTD LD+HYALLEERVRARTKQLEAAKI+A
Sbjct: 487  KSTNLVEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQA 546

Query: 537  ETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXX 596
            E+ANEAKTVFIANISHELRTPLNGILGMTAI+M ETD+ K++NSLKLIFRSG        
Sbjct: 547  ESANEAKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILT 606

Query: 597  XXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYG 656
                FSKNVLKRTKLE+R+F + D+ALQIKSIFGK+AKDQHV+LSI L+PN IR++VL+G
Sbjct: 607  ELLTFSKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWG 666

Query: 657  DSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDS 716
            DSNRIIQIVMNLVSNALKFTPVDGKVDVR+K+LG YD   SE  ++ +V+V PG+E  D 
Sbjct: 667  DSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDD 726

Query: 717  TPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTD----RVAQES-------DEDN 765
                N+ S    +  F S + S N  + D +   T  T     +V  E+       DE +
Sbjct: 727  F-EFNLTSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESS 785

Query: 766  M-----YEDNES-------MISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPK 813
            +     +E+NE        + +ST+SSYDDAIF+SQFKK  +  D D E     +L+ PK
Sbjct: 786  IVLESKHEENEDEKEKMSILSTSTSSSYDDAIFHSQFKKVLSSTDSDTEENTFRDLKVPK 845

Query: 814  TWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKML 873
            TWVIS EVED+G GID  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M 
Sbjct: 846  TWVISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMK 905

Query: 874  LESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRM---ARSLNSR 930
            L+SKVGVGSKF FT+PL QT+EI F   E  FEDEFN  S+KNRKVKF++    +S+ ++
Sbjct: 906  LDSKVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTK 965

Query: 931  KSRSSIVTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHL 990
            KS+SSI        HS              D +VS+R   NS E +  N+          
Sbjct: 966  KSKSSI------DGHS--------------DNNVSERKASNSTENSVGNV---------- 995

Query: 991  SHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSS 1050
                                  +DRPFLQSTGTATSTRSI  ++S               
Sbjct: 996  ---------------------RVDRPFLQSTGTATSTRSISSVAS--------------- 1019

Query: 1051 SAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQD 1110
              E T+        +++LVAEDN+VNQEVIKRMLQLEG+ D+D+ACDGQ+A++KV+++  
Sbjct: 1020 --EVTR--------HRVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILK 1069

Query: 1111 KGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFL 1170
             G  Y++IFMDVQMP+VDGL +TKMIR+DL    PIVALTA+ADDSNIK CL++GMDGFL
Sbjct: 1070 NGESYSMIFMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFL 1129

Query: 1171 SKPIKRTKLKTILKEFCS---DEREE 1193
             KPIKR  LK I+ ++CS    +REE
Sbjct: 1130 PKPIKRPLLKKIIAQYCSKKEKQREE 1155

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 663/1237 (53%), Positives = 825/1237 (66%), Gaps = 111/1237 (8%)

Query: 11   KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
            +PP  +GIR QLT                 TG+YFT NYK++R DRL IAA+LKSSQ+DQ
Sbjct: 12   RPPLAIGIRTQLTALVCFVACVSLIILAVPTGIYFTVNYKHMRVDRLSIAAELKSSQVDQ 71

Query: 71   NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
             LN+LYYQCYW++ RDTLQT +ANY AGNKS + W DSQ V+EKFL SS++FS++R+YD+
Sbjct: 72   TLNFLYYQCYWLSIRDTLQTAMANYFAGNKSSSVWYDSQVVVEKFLSSSDIFSISRLYDA 131

Query: 131  SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
            +F  V+N TNN TG+++P DVL +LLPLS++ PLP+SL ++G++T+PV N ++YLMSMSL
Sbjct: 132  NFNLVMNATNNGTGNVVPNDVLAKLLPLSSSDPLPASLGSSGMLTDPVLNSTTYLMSMSL 191

Query: 191  PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTN-ATKLDAY 249
            PI ANPSIILTDS+VYGY+T++MSAE L+SV+NDTTALE+S VAIVS  Y++ +  L  Y
Sbjct: 192  PILANPSIILTDSKVYGYITIIMSAESLMSVYNDTTALEKSNVAIVSGEYSDYSASLTEY 251

Query: 250  RFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNL 309
             FVFPP+G+T  I++  +PL N +FL  A+   K G++  T+ FY   +A+GYSP + +L
Sbjct: 252  HFVFPPYGATPKIIDIYYPLQNGSFLYDAMNNQKKGSIMKTKFFYNNDVAIGYSPCSFDL 311

Query: 310  ANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATEL 369
             +WVAIV+Q ESVF+SP+TKL +IIAGTVV I VF   +TFPL+HWAVKPIVRLQKATEL
Sbjct: 312  VSWVAIVSQPESVFLSPSTKLTRIIAGTVVAIAVFVCFVTFPLSHWAVKPIVRLQKATEL 371

Query: 370  ITESRGLRPTTPTSGSRANSILRDKSSLIS--FPLHPVSTXXXXXXXXXEKAQPPSDQDX 427
            I E RGLR ++  + SR  S+   + S+ S   P+ P               +    +  
Sbjct: 372  IAEGRGLRSSSNRTLSRNGSLKFGRYSIDSPIIPISPTFLHNNNNHHRNSSNESHDPEKL 431

Query: 428  XXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVP 487
                     + ++       H    F  I  S+      + SNT     + +  ++ +VP
Sbjct: 432  SHLSNDISKSSNSSSTGSRFH----FVCIFFSS-----HKSSNTPPPPMSTI--LETKVP 480

Query: 488  SYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFI 547
             YR LF DELS+LT+TFNTM+DALDQHYALLEERVRARTKQLEAAKIEAE ANEAKTVFI
Sbjct: 481  VYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEAANEAKTVFI 540

Query: 548  ANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLK 607
            ANISHELRTPLNGILGMTAISMEE DID I++SLKLIFRSG            FSKNVL+
Sbjct: 541  ANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTELLTFSKNVLQ 600

Query: 608  RTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMN 667
            RTKLE+R+FCITDVALQIKSIFGKVAKDQHV+LSI L PN IR++VL+GDSNRIIQIVMN
Sbjct: 601  RTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDSNRIIQIVMN 660

Query: 668  LVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTE--------------- 712
            LVSNALKFTP+DGKV VRM +LG YD+  S+  ++ +V+VK GTE               
Sbjct: 661  LVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTEPEENYSKILQKLNTE 720

Query: 713  ---ITDSTPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYED 769
                T S  S + +          +D  S N+ SS+T +D           S  +   +D
Sbjct: 721  KLIATRSARSCDNEERHNELIGEKNDIISNNHQSSNTTFDI----------SIHNRTRDD 770

Query: 770  NESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGID 829
              S++S++TSSYD+ +FN QFKK T L D D+E  +GVE++ PKTWVI  EVED+GPGI 
Sbjct: 771  TLSLLSTSTSSYDETVFNDQFKKITGLQDHDEE-RLGVEIKEPKTWVICIEVEDTGPGIH 829

Query: 830  KGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLP 889
              LQESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M+LESKVG GSKFTFT+P
Sbjct: 830  PALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGSGSKFTFTVP 889

Query: 890  LTQTREINFANVEDP---FEDEFNAKSKKNRKVKFRMARS---------LNSRKSRSSIV 937
            LTQTREI     ED    F+DEFN  SKKNRKVKF +  S         L SRKS+ S+ 
Sbjct: 890  LTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLKSRKSKGSLN 949

Query: 938  TAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNR 997
            ++      +V+          + +    +   INS   +GE +  R     H+S    N 
Sbjct: 950  SSFVGEIQNVN----------EAEEDAYNSKDINS---SGE-LKIR-----HISTSTSN- 989

Query: 998  DKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK 1057
                     +NS  SLDRPFLQSTGTATST  IP L  F      D + N    ++ +KK
Sbjct: 990  ---------NNSIPSLDRPFLQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKK 1040

Query: 1058 TSEGNGAYK----------------------ILVAEDNHVNQEVIKRMLQLEGVKDIDLA 1095
             + G    +                      ILV EDNHVNQEVIKRML+LE + +IDLA
Sbjct: 1041 GNSGGTIIQEGVTQNNSSIIIDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLA 1100

Query: 1096 CDGQDAFDKVKQLQD-----KGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALT 1150
            CDG++A+ KVK++       K + Y+LIFMDVQMP++DGL STK+IR +L    PIVALT
Sbjct: 1101 CDGEEAYTKVKEITSISNPKKKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALT 1160

Query: 1151 AFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC 1187
            AFAD+SNIKECLD GMDGFLSKPIKR KLK IL EFC
Sbjct: 1161 AFADESNIKECLDVGMDGFLSKPIKRPKLKDILNEFC 1197

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1162 bits (3005), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/1192 (53%), Positives = 818/1192 (68%), Gaps = 89/1192 (7%)

Query: 11   KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
            KPPYR+ IRAQLT                T GVYFT+NYKNL++ RLYIAAQLK+SQIDQ
Sbjct: 10   KPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKASQIDQ 69

Query: 71   NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
             LNYLYYQCY+++S +TLQ  L +Y AGN S  NW +S  VLEKFL SS+LFSVAR+YD+
Sbjct: 70   TLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVARLYDT 129

Query: 131  SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
            +F  ++N TNN++G+ +PE V+ +L  LS N+ LPSSLET GI T+PV NGS++LMSMSL
Sbjct: 130  NFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLMSMSL 189

Query: 191  PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250
            PIFANPSIIL+DSR+YGY++V+MSAEGL SVFNDTTALE S V ++SA Y+  T L+ + 
Sbjct: 190  PIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNLEYFN 249

Query: 251  FVFP-PFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNL 309
            F+F   + +     +  + ++N+TF+ + L  GKGGA+K T  F     AVGYS  + +L
Sbjct: 250  FLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSCSFSL 309

Query: 310  ANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATEL 369
             NW+AIVAQ E+ F   ATKL +II+G VV + VF  L+TFPL+HWAV+P++RLQKATE 
Sbjct: 310  VNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQKATER 369

Query: 370  ITESRGLRPTTPTSGSRA--NSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQPPSDQDX 427
            I E RGLRP  PT GS    NS ++ ++SL +   H  S+         +     ++   
Sbjct: 370  IAEGRGLRPPQPTVGSSVSRNSSIKWRNSLEN---HVRSSLGFNANKLSDSGSITANNFK 426

Query: 428  XXXXXXXXIAVSNIR-EEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARV 486
                    I  S+I    +S H+     GI+        + LS++S+ Y T+ NLI+ARV
Sbjct: 427  NNTSSSNSITSSHIYGNNNSSHSS---MGINPD------DDLSSSSQKYKTSANLIEARV 477

Query: 487  PSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVF 546
            P Y  L +DELS+LT+TFNTMTDALDQHY LLEERVRARTKQLEAAKI+AE+ANEAKTVF
Sbjct: 478  PVYWRLLQDELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVF 537

Query: 547  IANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVL 606
            IANISHELRTPLNGILGMTAISMEE D+DKIR +LKLIFRSG            FSKNVL
Sbjct: 538  IANISHELRTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVL 597

Query: 607  KRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVM 666
            +RTKLEKR+FCIT+VALQIKSIFGK+AKDQHV+LSIIL PN++RS VL+GDSNRIIQ+VM
Sbjct: 598  QRTKLEKRDFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVM 657

Query: 667  NLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEI--------TDSTP 718
            NLVSNALKFTPVDG VDVR+ +LG YDE  S+  ++ KVYVK GTE+        T+   
Sbjct: 658  NLVSNALKFTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENN 717

Query: 719  SLNVKSEGQ-GKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISST 777
             ++ KSE +   D+  + T SK+    DTA  +    +   + S+ D M     S+++++
Sbjct: 718  DISRKSETELNNDENETHTISKD----DTADSSIKIGNEDVEISEVDKM--GMASLVTTS 771

Query: 778  TSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVF 837
            + SYDD     Q  K+T+L  +DDE+++GVEL+  KTWVIS EV+D+G GID  LQESVF
Sbjct: 772  SKSYDDTALMKQLIKSTDL--DDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVF 829

Query: 838  EPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREIN 897
            EPFVQGDQ LSRQYGGTGLGLSIC+QL+ MM G M LES+VGVGSKF FTLPL QTREI+
Sbjct: 830  EPFVQGDQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREIS 889

Query: 898  FANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKSPR 957
              + ++ F DEFNA SKKNRKVKF+                +G+SS  S+ TR       
Sbjct: 890  IPD-DELFNDEFNAVSKKNRKVKFKF---------------SGSSSAKSIKTRNS----- 928

Query: 958  LKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPF 1017
                               G ++  R  +    S    + ++D+ R     S++ L+RPF
Sbjct: 929  ------------------IGSSLNNRHSTTSIDSSSSDSDEEDNVR----PSSVRLNRPF 966

Query: 1018 LQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQ 1077
            LQSTGTATST+++P L++  ++K  + +LN            + +  Y ILVAEDNHVNQ
Sbjct: 967  LQSTGTATSTQNVPTLNAHTDDKSKNKVLN------------KMDLIY-ILVAEDNHVNQ 1013

Query: 1078 EVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIR 1137
            EVIKRML+LEG+ +IDLA DGQDAFDK K L +    Y++IFMDVQMP++DGL +TKMIR
Sbjct: 1014 EVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPRLDGLAATKMIR 1073

Query: 1138 HDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD 1189
             +L+   PIVAL+AF  + N+KECLD GM+ FLSKPIKR  LK ILK++  D
Sbjct: 1074 EELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKYIED 1125

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score = 1042 bits (2695), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1202 (50%), Positives = 776/1202 (64%), Gaps = 136/1202 (11%)

Query: 4    RLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQL 63
            R+R    +PPY+ G+  QLT+               TTGVYFT+NYK+LR+DRL +AAQL
Sbjct: 17   RIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQL 76

Query: 64   KSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFS 123
             S+QI+Q LN +YYQCYW++SRD++Q  L +Y  GN S  N  +++ VL KFL SSN   
Sbjct: 77   TSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSIF 136

Query: 124  VARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSS 183
               +YDS+F  VL+ + NSTG++I +D+L  LLPLS+N PLPSS+  +G+++NPV NGSS
Sbjct: 137  RTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGSS 196

Query: 184  YLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNA 243
            + MSMSLP+ A  SI+   S   GY+T+VMSA+ + SV     AL  S V++++ VY   
Sbjct: 197  FFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDEN 256

Query: 244  TKLDAYRFVFPP-FGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGY 302
              L++Y+ +FPP       +L   FP+ NN+FL +A      G++  T  FY   +AVGY
Sbjct: 257  NILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVGY 316

Query: 303  SPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVR 362
            +  +  L NWVA+VAQ E+VF+SP+TKL KII GTV+GI  F  ++TF +A+WAVKPIVR
Sbjct: 317  AACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIVR 376

Query: 363  LQKATELITESRGLRPTTPTSG--------SRANS------ILRDKSSLISFPLHPVSTX 408
            LQKATELI   RGLR    +S         +R+NS       LR+   L   P  P +  
Sbjct: 377  LQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRKTPPSPYTPM 436

Query: 409  XXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPH-ADGVFSGISLSNVSDRLER 467
                       +P                 S I  E+S   A  +   +  S+ S+R++ 
Sbjct: 437  H-------SHVEPNP---------------SGIGREYSVDIARAIGIEVPSSHPSERVD- 473

Query: 468  LSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTK 527
                   +TT+ N I+ RVP YR LF DELS+LT+TFN+MTD LD+HYALLE+RVRARTK
Sbjct: 474  ------AFTTSANWIETRVPVYRRLFSDELSELTDTFNSMTDELDRHYALLEDRVRARTK 527

Query: 528  QLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRS 587
            QLEAAKI+AE+ANEAKT+FIANISHELRTPLNGILGMTAI+M E D++K++NSLKLIFRS
Sbjct: 528  QLEAAKIQAESANEAKTMFIANISHELRTPLNGILGMTAIAMAENDMEKVQNSLKLIFRS 587

Query: 588  GXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPN 647
            G            FSKN+LKR KLE+RNF + DVALQ+KSIFGK+AKDQ+V+ SI L PN
Sbjct: 588  GELLLHILTELLTFSKNILKRNKLEQRNFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPN 647

Query: 648  MIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYV 707
            +IR MVL+GDSNRIIQIVMNLVSNALKFTPVDGKV +R+K+LG YDE  SEK N+ +V++
Sbjct: 648  LIRKMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFI 707

Query: 708  KPGTEITDSTPSLNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMY 767
            K GTEI+D T           K+ F + T  K  + S  + D T  T    QE  +    
Sbjct: 708  KQGTEISDET-----------KNVFDTITEEKYVSCSGESTDDTIET---GQEGAQKPDK 753

Query: 768  EDNESMISSTTSSYDDAIFNSQFKKTTNLY--DEDDESEMGVELETPKTWVISFEVEDSG 825
             DN S++SS TSSYDDAIF+S+FKK   +   DE D S +G + E  K WVIS EVED+G
Sbjct: 754  ADNISVVSSGTSSYDDAIFHSRFKKIPAVLDVDEGDLSSIG-KSEKKKVWVISIEVEDTG 812

Query: 826  PGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFT 885
            PGID  LQESVF+PFVQGDQTLSRQYGGTGLGLSICRQL+ MMKG M L S+VGVGSKF 
Sbjct: 813  PGIDPSLQESVFKPFVQGDQTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFI 872

Query: 886  FTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHH 945
            FT+PL QT  +   + ED FEDEFNA+SK NR+VKF++ +   SR+S  S+         
Sbjct: 873  FTVPLRQTGTVEDLDDEDLFEDEFNAQSKINRRVKFKLNKGGKSRQSSLSV--------- 923

Query: 946  SVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLS 1005
                                       PE +G         D  L+ M R          
Sbjct: 924  ---------------------------PEISG-------VPDSPLNSMGR------SESE 943

Query: 1006 ASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAY 1065
             S S++ +DRPFLQSTGTATSTRSIP + S +                           +
Sbjct: 944  LSVSSVRVDRPFLQSTGTATSTRSIPTVGSLESN-------------------------F 978

Query: 1066 KILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMP 1125
            K+LVAEDN+VNQEVIKRMLQLEG+ DI+LACDG++A +KV  L ++   YN++FMDVQMP
Sbjct: 979  KVLVAEDNNVNQEVIKRMLQLEGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMP 1038

Query: 1126 KVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKE 1185
            K+DGL +T+ IR +L+  +PIVALTAFADDSNIK CL++GMDGFLSKPIKR KL+ IL E
Sbjct: 1039 KMDGLIATRNIRKELNYTYPIVALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLE 1098

Query: 1186 FC 1187
            +C
Sbjct: 1099 YC 1100

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score = 1012 bits (2616), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 589/1212 (48%), Positives = 747/1212 (61%), Gaps = 142/1212 (11%)

Query: 2    WFRLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAA 61
            + R R    KPP++ G+R QLT+               TTGVYFTSNY+ LR+DRL++AA
Sbjct: 5    YLRKRLAVLKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAA 64

Query: 62   QLKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNL 121
            +L SSQ+DQ+L  LYYQC  ++++DT+Q  L++Y AGN+S  NW+++  +L  FL  S  
Sbjct: 65   RLMSSQVDQSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKT 124

Query: 122  FSVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLST-----NVPLPSSLETNGIVTN 176
            F +A +YD  +  VL+  NN T   + E+ L +L PL       N  L   +ET  +  N
Sbjct: 125  FYIAYLYDEMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVET--LPYN 182

Query: 177  PVKNGSSYLMSMSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIV 236
               N    LMSM+LP+ A  S I+    V G++T+VMSA+ + +V NDT+ L  S V+I+
Sbjct: 183  KTLN----LMSMTLPVEA--STIIGRGNVVGFLTIVMSADPITAV-NDTSVLGESMVSIL 235

Query: 237  SAVYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRL 296
            + +  +   L  YRFVFPP  +  S+    +P+ N +FL  A        + ST  FY  
Sbjct: 236  TGIPNDKGNLVKYRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHF 295

Query: 297  --------KLAVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLI 348
                    K+AVGYS       +WVA+V+Q ESVF+SPA KL KII GTV+G+ VF  ++
Sbjct: 296  GALGHDFKKVAVGYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIV 355

Query: 349  TFPLAHWAVKPIVRLQKATELITESRGLRPTTPT--SGSRANSILRDKS--SLISFPLHP 404
            TF LA WAVKPIVRLQKATE I   RGLR    +  S S+  SI R  S  S  S P   
Sbjct: 356  TFILASWAVKPIVRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPREL 415

Query: 405  VSTXXXXXXXXXEKAQPPSDQDXXXXXXXXXIAVSNIREEHSPHADGVFSGISLSNVSDR 464
                        E     S                   E +  H      G + +N+   
Sbjct: 416  FEKKHHVSPFVTENHAANSGSCSSMSD----------HERYLHHIARYHDGETSTNI--- 462

Query: 465  LERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRA 524
               LS+  K  T+A N I  RVP YR LF DELS+LT+TFNTMTD LD+ Y +LE+RVRA
Sbjct: 463  ---LSDHEKGSTSATNWIDTRVPVYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRA 519

Query: 525  RTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLI 584
            RTKQLEAAKI+AE ANEAKTVFIANI HELRTPLNGILGMTAI+M E D +KI+NSLKLI
Sbjct: 520  RTKQLEAAKIQAEAANEAKTVFIANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLI 579

Query: 585  FRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIIL 644
            FRSG            FSKNVLKRTKLE+R+F I D+ALQ+KSIFGK+AKDQHV+LSI L
Sbjct: 580  FRSGELLLHILTELLTFSKNVLKRTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYL 639

Query: 645  SPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNK 704
             PN IR+MVL+GDSNRIIQIVMNLVSNALKFTPVDGKVDVR+K++G YD A SE  N ++
Sbjct: 640  MPNAIRTMVLWGDSNRIIQIVMNLVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSE 699

Query: 705  VYVKPGTEITDST----PSLNVKSEGQGKDKFTS-DTASKNNTSSDTAYDATPTTDRVAQ 759
            VY+ PGTE+T+S+    P++  + E   +++ T+ DT  +    S+T  DA         
Sbjct: 700  VYILPGTEVTNSSVNNIPTVVEEEEKACEEEPTADDTPERKKKDSETVDDA--------- 750

Query: 760  ESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKT---TNLYDEDDESEMGVELETPKTWV 816
                     D  S+ SS  +SYDDA+ ++Q KK     +L D D+   M  +LE P++WV
Sbjct: 751  ---------DAISISSSVATSYDDAVLHAQLKKIPTFIDLEDSDNNVTMS-KLEKPRSWV 800

Query: 817  ISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLES 876
            I  EV+D+GPGI+  L ESVF+PFVQGDQTLSRQYGGTGLGLSICRQLA MMKG M LES
Sbjct: 801  IVIEVQDTGPGIEPSLHESVFKPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLES 860

Query: 877  KVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSI 936
            KVG GSKFTFT+PL QT  + F + +  FEDEFN  SKKNRKVKF++ RS  SRK + + 
Sbjct: 861  KVGSGSKFTFTVPLQQTGTVKFNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMN- 919

Query: 937  VTAGASSHHSVHTRTPTKSPRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRN 996
             + GA S                        +  ++ E  G     +SES+         
Sbjct: 920  NSNGAGS------------------------IAESAIESFG-----KSESE--------- 941

Query: 997  RDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTK 1056
                     AS  ++ +DRPFLQSTGTATSTRS+P LSS                     
Sbjct: 942  ---------ASFGSVRVDRPFLQSTGTATSTRSVPTLSS--------------------- 971

Query: 1057 KTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYN 1116
                   + +ILVAEDN+VNQEVIKRML LEG  +IDLACDG+DA+ KV  L ++G  Y+
Sbjct: 972  ----AESSLRILVAEDNNVNQEVIKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYD 1027

Query: 1117 LIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR 1176
            LIFMDVQMP++DGL +TK++R  LH ++PIVALTAFADDSNIKECL++GM+ FL+KPIKR
Sbjct: 1028 LIFMDVQMPRMDGLLTTKLLRQKLHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKR 1087

Query: 1177 TKLKTILKEFCS 1188
              LK IL E  S
Sbjct: 1088 PMLKKILLEHTS 1099

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1068

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/916 (50%), Positives = 603/916 (65%), Gaps = 46/916 (5%)

Query: 12  PPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71
           PPY + +RAQL                 +TGVYFT+NYK+LR+++L+IAAQLKSSQ+DQ+
Sbjct: 12  PPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQLKSSQLDQS 71

Query: 72  LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131
           LNYLYYQ  W    D L   L  Y +GNK+  NW++S S +  FL SS++FS A +YD++
Sbjct: 72  LNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFSRATIYDTN 131

Query: 132 FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191
           F  + N +NN TG  IP+D++ QL PLS++  LP+S+ T G +T+PV N S+YLMS+SLP
Sbjct: 132 FMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSNYLMSLSLP 191

Query: 192 IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKL-DAYR 250
           IF NPSIIL+DSRVYGYVT++  A  +++VFNDTTALE S VAI+SA Y N+T   D Y 
Sbjct: 192 IFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNSTTYADGYH 251

Query: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310
           FVFPP+GS +S+++  +PL+NN+FL  A  +   G++ ST  FY   +AVGYS  T +LA
Sbjct: 252 FVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGYSTCTFSLA 311

Query: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370
           NWVA+V+Q ESVF S   KL KII+GTVVGI      +TF ++++ VKPI++L++ATELI
Sbjct: 312 NWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIKLKQATELI 371

Query: 371 TESRGLRPTTPTSGSRANSILRDKSSLISFPLHPVSTXXXXXXXXXEKAQPPSDQDXXXX 430
           +  RGLRP       R +    + S+  +  L  +           EK+ P   +D    
Sbjct: 372 SRGRGLRPYYENLSDRTSQ--DNTSTRTTIDLSDLD----GYTNEKEKSLPTCTEDERSK 425

Query: 431 XXXXXIAVSNIREEHSPHADGVFSGI-SLSNVSDRLERLSNTSKHYTTAVNLIQARVPSY 489
                 ++SNI  +       +F+ +  +   S R   LS TS ++    +    RVP +
Sbjct: 426 ------SLSNIASK------SIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVH 473

Query: 490 RALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIAN 549
                DEL++L ETFN M D+LD+H  LLEERV+ARTK+LEAAKI AE  NEAKTVFIAN
Sbjct: 474 STYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIAN 533

Query: 550 ISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXXXFSKNVLKRT 609
           ISHELRTPLNGILGMTAI++EE D +K++ SLKLI+RSG            FSKNVL++T
Sbjct: 534 ISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKT 593

Query: 610 KLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLV 669
           KLEK +FCI D+ALQIKSIFGK+AKDQ V  SI++SPN+IR+MV +GDSNRIIQ++MNLV
Sbjct: 594 KLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLV 653

Query: 670 SNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEIT---DSTPSLNVKSEG 726
           SNALKFTP+DG VDVR+K+LG YDE  S   N++KVY+K GT  T   D+ P+  +    
Sbjct: 654 SNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDNDAIPTEPISD-- 711

Query: 727 QGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTSSYDDAIF 786
             K  F   ++S ++  S      T   D +  E   D+          ST S Y +   
Sbjct: 712 --KISFAGGSSSIHDYCS-----KTDENDNIKTEIKSDD----------STISDYSEENI 754

Query: 787 NSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQT 846
              + +  N   E     +GV +  PK WVIS +VED+GPGI   LQ+SVFEPFVQGDQT
Sbjct: 755 MGSYYENKNPGQE----LLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPFVQGDQT 810

Query: 847 LSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFE 906
           LSRQYGGTGLGLSICRQLA +M G M L+S  G+GSKFTFT+PL Q R+I F+  E  FE
Sbjct: 811 LSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSETEKAFE 870

Query: 907 DEFNAKSKKNRKVKFR 922
           DEFN  SKKNRKV F+
Sbjct: 871 DEFNFNSKKNRKVNFK 886

 Score =  161 bits (408), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 120/171 (70%), Gaps = 10/171 (5%)

Query: 1026 STRSIPHLSSFKEEKPN---DPLLNVSSSAEQTKKT----SEGN---GAYKILVAEDNHV 1075
            ++R IP  ++ K +  N      LN  + ++  K T    SE N     +K+L+ EDN V
Sbjct: 891  TSRGIPSKAAEKNDDANTNGQTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMV 950

Query: 1076 NQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKM 1135
            NQEVIKR+L+LE +K I+ A DGQ+A D VK+   +  ++++IFMD+QMP VDG T+T++
Sbjct: 951  NQEVIKRLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRV 1010

Query: 1136 IRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            IR++L+  +PIVALTAFADDSN KEC ++GM+ FL+KPIKR +LK I+KEF
Sbjct: 1011 IRNELNYPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  767 bits (1981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/762 (53%), Positives = 528/762 (69%), Gaps = 32/762 (4%)

Query: 11  KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
           KPP+ + IR QLT                 TGVYFTS++K++R++RLY+A+QLK+SQIDQ
Sbjct: 18  KPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKASQIDQ 77

Query: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
           NL YLYYQCY++++RD LQ  L  Y+AGN +  NW D+ + L+KFLGSSNLFS+ARVYDS
Sbjct: 78  NLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLARVYDS 137

Query: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
           SF  VLN +NN++G+L+PE VLTQL PLSTNV LPSSLE  G++T+PV N + YLMSMSL
Sbjct: 138 SFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLMSMSL 197

Query: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250
           PIFANPSIIL+ S+VYGY+TVV+SAEGL +VFNDTTALE S V +VS VY N  +L  Y 
Sbjct: 198 PIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVYDN-RELAGYH 256

Query: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310
            VFPP+G  S I+++ + + N++FL  A +Q KGG++KST   Y   +A+GYSP +S+L 
Sbjct: 257 LVFPPYGMPSDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPCSSDLV 316

Query: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370
            WVAI+ Q ES F+ P+T+LA+II GT V I V    +TFPL+HWAV+PIVRLQKATE+I
Sbjct: 317 QWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQKATEII 376

Query: 371 TESRGLRPTTPTSGSRANSILRDKSS-LISFPLHPVSTXXXXXXXXXEKAQ--PPSDQDX 427
           T  RGLR     +GS   S  R  ++   S  LHP S           K +  P S +  
Sbjct: 377 TAGRGLRSD---NGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAKGT 433

Query: 428 XXXXXXXXIAVSNI--------REEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAV 479
                   I    I        ++ HSP    +FS           E+ S  S+ Y T+ 
Sbjct: 434 LNKNDFEEIQPDGIENNEDAALQKVHSPTPGSLFS-----------EQRSARSERYITST 482

Query: 480 NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539
           NLI+ARVP+Y  LF DELS+LTETFNTMTD LD+HYALLE+RVRART+QLEAAKIEAE A
Sbjct: 483 NLIEARVPTYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGA 542

Query: 540 NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXX 599
           NEAKTVFIANISHELRTPLNGILGMTAI+M E D+ K+++SLKLIFRSG           
Sbjct: 543 NEAKTVFIANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELL 602

Query: 600 XFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659
            FSKNVLKRTKLE+R+F + ++ALQ++SIFGK+AKDQHV L+I + PN++R+MVL+GDSN
Sbjct: 603 TFSKNVLKRTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSN 662

Query: 660 RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719
           RI+QIVMNLVSNALKFTPVDG+V+V+  +LG YDE+ +     ++  V P  E    + +
Sbjct: 663 RIVQIVMNLVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAVVPIQESEKESST 722

Query: 720 LNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQES 761
           L    +G  KD       +++ +SS+  +  +P+T   +  S
Sbjct: 723 LGPTEKGGIKD------VTESASSSNATWPPSPSTSETSNGS 758

 Score =  218 bits (554), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 129/173 (74%), Gaps = 5/173 (2%)

Query: 753 TTDRVAQESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETP 812
           T +   +E   +N  ED  S+ S   SSYDDAIF+S+ +K  +  +ED     G  LE P
Sbjct: 809 TNNETQREDSNENQNEDARSIESENASSYDDAIFHSRLRKGNSGENED-----GRPLEHP 863

Query: 813 KTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKM 872
           +   I+ EV+D+GPGI+  LQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLA MM G M
Sbjct: 864 RRLAIAMEVQDTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSM 923

Query: 873 LLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMAR 925
            L+SKVGVGSKFTFT+PLTQT+E+ F   E+PFEDEFN  SKKNRKVKF++++
Sbjct: 924 SLDSKVGVGSKFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKVSK 976

 Score =  213 bits (543), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 106/181 (58%), Positives = 129/181 (71%), Gaps = 26/181 (14%)

Query: 1007 SNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYK 1066
            S  ++ +DRPFLQSTGTA STRS+                           TS  N   K
Sbjct: 1005 SVGSVRVDRPFLQSTGTALSTRSV-------------------------TTTSVANKC-K 1038

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +LVAEDN+VNQEVIKRML LEG+ D+DLACDGQDAFDKVK   + G  Y+LIFMDVQMP+
Sbjct: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098

Query: 1127 VDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            VDGL++T+MIR++L    PIVALTA+ADD NIKEC+DAGM+GFL+KPI+R K+K IL E+
Sbjct: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158

Query: 1187 C 1187
            C
Sbjct: 1159 C 1159

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/502 (68%), Positives = 392/502 (78%), Gaps = 24/502 (4%)

Query: 462  SDRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEER 521
            SD  E  S  S H TT+ NLI+ARVP YR LF DELSDLT+TFNTMTDALDQHYALLE+R
Sbjct: 508  SDHTE-FSTKSGHLTTSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDR 566

Query: 522  VRARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSL 581
            VRARTKQLEAAKIEAE ANEAKTVFIANISHELRTPLNGILGMTAISMEETDI KIR+SL
Sbjct: 567  VRARTKQLEAAKIEAERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSL 626

Query: 582  KLIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLS 641
            KLIFRSG            FSKNVLKRT LEKR+FCITDVALQIKSIFGKVAKDQ V+LS
Sbjct: 627  KLIFRSGELLLHILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLS 686

Query: 642  IILSPNMIRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYN 701
            I L+PN IR+MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV+V++K++G YDEALS K N
Sbjct: 687  ITLTPNTIRTMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNN 746

Query: 702  HNKVYVKPGTEI----------TDSTPSL-----NVKSEGQGKDKFTSDTASKNNTSSDT 746
              +VYVK GTE+           +S PS      N  S   GKD   S+T+ ++  S+D 
Sbjct: 747  FKEVYVKQGTELLGCSNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADD 806

Query: 747  AYDATPTTDRVAQES--DEDNMYE------DNESMISSTTSSYDDAIFNSQFKKTTNLYD 798
              D    T     E+  D +N+ E      DN S++S++TSSYDDAIFNSQFKK+  LYD
Sbjct: 807  LDDEKIATKDAENENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYD 866

Query: 799  EDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGL 858
            +D+ ++ GV +E PKTWVI   VED+GPGIDK LQESVF+PFVQGDQTLSRQYGGTGLGL
Sbjct: 867  DDENNDAGVLIEDPKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGL 926

Query: 859  SICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRK 918
            SICRQLA MM G M L+S+VGVGS FTFT+PL QTREINF ++E PFEDEFN +S+KNRK
Sbjct: 927  SICRQLANMMHGTMKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRK 986

Query: 919  VKFRMARSLNSRKSRSSIVTAG 940
            VKF++ARS+ S+KSR+S VT G
Sbjct: 987  VKFKLARSIRSKKSRASTVTFG 1008

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/385 (71%), Positives = 316/385 (82%), Gaps = 2/385 (0%)

Query: 8   FTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQ 67
           F  KPP+R+GIRAQLT                TTGVYFT+NYKNLRSDRLYIAAQLKSSQ
Sbjct: 7   FVLKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQ 66

Query: 68  IDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARV 127
           IDQ LNYLYYQCY+V+SRDTLQ  L NYVAGNKS+ NW DS S+L+KFL SSNLFSVA+V
Sbjct: 67  IDQTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKV 126

Query: 128 YDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMS 187
           YD+SFTTVLN TNN TGD IP+ +L +LLPLSTN+PL SSLET GI+T+PV N S+YLMS
Sbjct: 127 YDASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMS 186

Query: 188 MSLPIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLD 247
           MSLPIFANPS+IL +SRVYGY+TVVMSAEGL +VFNDTTALE+S VAIVSAVY N + L 
Sbjct: 187 MSLPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALT 246

Query: 248 AYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTS 307
           AYRFVF P G+ S I+N T+ L N +FLSSALR+GKGG+LKST+ FY   +A+GYSP T 
Sbjct: 247 AYRFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTF 306

Query: 308 NLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKAT 367
           +  NWVA+V+QAESVF+SP+TKLAKIIAGTVV IGVF  ++TFPLAHWAVKPIVRLQKAT
Sbjct: 307 SFVNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKAT 366

Query: 368 ELITESRGLRPTTPTSG--SRANSI 390
           ELI+E RGL+ T P S   SR NS+
Sbjct: 367 ELISEGRGLKSTNPDSRSVSRNNSL 391

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
           Anc_5.700 YIL147C
          Length = 1095

 Score =  546 bits (1407), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 306/465 (65%), Positives = 348/465 (74%), Gaps = 22/465 (4%)

Query: 469 SNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQ 528
           S+ ++ Y T+ NL++ARVP YR  F DE S+LT+TFNTMT+ALDQHYALLE+RVRARTKQ
Sbjct: 442 SDRTRKYMTSSNLVEARVPVYRIFFSDEFSELTDTFNTMTNALDQHYALLEDRVRARTKQ 501

Query: 529 LEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSG 588
           LEAAK+EAE ANEAKTVFIANISHELRTPLNGILGMTAISMEE DIDKI++SLKLIFRSG
Sbjct: 502 LEAAKVEAEAANEAKTVFIANISHELRTPLNGILGMTAISMEERDIDKIQSSLKLIFRSG 561

Query: 589 XXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNM 648
                       FSKNVL+RTKLEKR+F ITDVA+QIKSIFGKVAKDQ V+ SI L PN 
Sbjct: 562 ELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAVQIKSIFGKVAKDQRVKFSITLFPNQ 621

Query: 649 IRSMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVK 708
           IR MVLYGDSNRIIQIVMNLVSNALKFTPVDGKV VRM++LG YD+  SE  +   VYV 
Sbjct: 622 IRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVSVRMRLLGEYDKQRSENEDFKAVYVI 681

Query: 709 PGTEITDST---PSLNV--KSEGQGKDKFTSDTASKNNTSSDTAY----DATPTTDRVAQ 759
            GTE  +     P +    K E   K+K +     +  ++SD+      D TP + R   
Sbjct: 682 DGTEPREDGLIPPPVKQFEKQEDLEKEKISEKHNEEEASTSDSEKTNLDDKTPDSKR--- 738

Query: 760 ESDEDNMYEDNESMISSTTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISF 819
            SD D    D  S+IS +TSSYDD IF++QFKK T+        E G  LE PK W IS 
Sbjct: 739 -SDAD----DQVSLISISTSSYDDTIFHTQFKKHTS----SSGDENGHLLEHPKNWAISV 789

Query: 820 EVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVG 879
           EVED+GPGID  L ESVFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M L+SK+G
Sbjct: 790 EVEDTGPGIDPSLHESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMKLDSKLG 849

Query: 880 VGSKFTFTLPLTQTREINFANVEDPFEDEFNAKSKKNRKVKFRMA 924
           VGSKFTFTLPLTQTREI F + E+ FEDEFN  SKKNRKVKF++A
Sbjct: 850 VGSKFTFTLPLTQTREIEFED-ENAFEDEFNPLSKKNRKVKFKVA 893

 Score =  506 bits (1304), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 244/370 (65%), Positives = 300/370 (81%)

Query: 12  PPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQN 71
           PP+R+ IR QLT                TTGVYFTSNYK+LRS+RLY+AAQLKSSQIDQN
Sbjct: 13  PPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSSQIDQN 72

Query: 72  LNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDSS 131
           LNYLYYQCYW++S+ TLQT LANYV+GNK+DANW+DS SVL+KFL SS LFSVARVYD+ 
Sbjct: 73  LNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVARVYDAD 132

Query: 132 FTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSLP 191
           F TVLN TNN TGD++ +DVL +L+PLS+N+ LP+SLE+ G++T+PV NG+SYLMSMSLP
Sbjct: 133 FQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLMSMSLP 192

Query: 192 IFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYRF 251
           I+ANPSIILT+SRVYGYVT++MSA+ L SV++D TALE+S V IVSA+Y     L +YRF
Sbjct: 193 IYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGLGSYRF 252

Query: 252 VFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLAN 311
           VF P+G+T  IL+ET+P+NNN+FLS+ALRQGK G+ + T LFY    AVGYSP +    N
Sbjct: 253 VFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCSFKFVN 312

Query: 312 WVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELIT 371
           WVAI++Q+E+VF+ P+T+L KII G VVGIG F  + TFPLAHWAV+PIVRLQKATE+IT
Sbjct: 313 WVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKATEIIT 372

Query: 372 ESRGLRPTTP 381
           E RGLR  TP
Sbjct: 373 EGRGLRSGTP 382

 Score =  231 bits (590), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 119/189 (62%), Positives = 139/189 (73%), Gaps = 29/189 (15%)

Query: 1011 MSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVA 1070
            +SLDRPFLQSTGTA+S++++  +S            NV             N +Y+ILVA
Sbjct: 934  VSLDRPFLQSTGTASSSKNVTVVS------------NV-------------NKSYRILVA 968

Query: 1071 EDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGL 1130
            EDNHVNQEVIKRML LEG+  IDLA DGQDAFDKVK LQ+KG  Y LIFMDVQMPKVDGL
Sbjct: 969  EDNHVNQEVIKRMLTLEGIDRIDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGL 1028

Query: 1131 TSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDE 1190
             +TKMIR DL   +PIVALTAFADDSNI+ CL+AGM+GFLSKPIKR KLKTI+ ++C D 
Sbjct: 1029 LATKMIRKDLDYQYPIVALTAFADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHD- 1087

Query: 1191 REEDSKPVE 1199
               DSK V+
Sbjct: 1088 ---DSKVVD 1093

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
           (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  496 bits (1278), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 261/443 (58%), Positives = 322/443 (72%), Gaps = 33/443 (7%)

Query: 480 NLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETA 539
           NL   +VP+ R   KDELS+LTET+  MTDALD+H  LLE RV+ RTKQLEAAKIEAE+A
Sbjct: 450 NLADFQVPASRRFVKDELSELTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESA 509

Query: 540 NEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGXXXXXXXXXXX 599
           NEAKTVFIAN++HELRTPLNGILGMTAI+MEETD+++I++SLKLI+RSG           
Sbjct: 510 NEAKTVFIANVTHELRTPLNGILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELL 569

Query: 600 XFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSN 659
            FSKNVLK+TKLEK +FC+ D+ALQI+SIFGK++KDQHV+LSI + PN +RSMVL+GD N
Sbjct: 570 TFSKNVLKQTKLEKTHFCVIDLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQN 629

Query: 660 RIIQIVMNLVSNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPS 719
           RI+Q++MNLVSNALKFTPVDGK+ V +K+LG YD+  S   N+  VY+K   EI +S   
Sbjct: 630 RILQVIMNLVSNALKFTPVDGKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSN-- 684

Query: 720 LNVKSEGQGKDKFTSDTASKNNTSSDTAYDATPTTDRVAQESDEDNMYEDNESMISSTTS 779
                 G       +  +SK+  S             VA     DN+   N+S+ S T  
Sbjct: 685 ------GDKIKPLMTLISSKDTMS-------------VA-----DNI--SNKSVASDTER 718

Query: 780 SYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQESVFEP 839
           S ++ I++++FK  +N  D DD   +GV L+  + WVIS EVED+GPGI+  LQ+SVFEP
Sbjct: 719 STNNTIYSNKFKNGSNFQDTDD--AIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEP 776

Query: 840 FVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTREINFA 899
           FVQGDQTLSRQYGGTGLGLSICRQLA +M G M LES+VGVGSKF FT+PL QTREI F 
Sbjct: 777 FVQGDQTLSRQYGGTGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFN 836

Query: 900 NVEDPFEDEFNAKSKKNRKVKFR 922
             E  FEDEFN  SKKNR+VKF+
Sbjct: 837 GNELVFEDEFNINSKKNREVKFQ 859

 Score =  406 bits (1043), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/365 (53%), Positives = 253/365 (69%)

Query: 11  KPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70
           K PY+V +R QLT                +TGVYFT NY++LR  +LYIAA+LKSSQIDQ
Sbjct: 11  KAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQIDQ 70

Query: 71  NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130
            +N LYYQC W+  RD +++ L +Y AGN+S  NW  +  VL  FL SS +F    +YDS
Sbjct: 71  TINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYDS 130

Query: 131 SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190
            F  +LN TNN T D IP+DVL+ LLPLS    LPS L T G++T+PV N S+YLMSMSL
Sbjct: 131 QFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMSL 190

Query: 191 PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250
           PI ANPS+ L+DSRV+GY+TVVMSAE + +V NDTTALE+S VA++S+  TN T    Y 
Sbjct: 191 PIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEYH 250

Query: 251 FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310
           FVFPP G++  I+N  +P+ N+TFLS A    +GG++  ++  Y   +A+GY P +  LA
Sbjct: 251 FVFPPHGASDDIVNTAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFGLA 310

Query: 311 NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370
           NWV  V+Q E VF+S + KL KIIAGTV+ I VF  +ITFPL+ W+V+PIVRLQKATE+I
Sbjct: 311 NWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATEVI 370

Query: 371 TESRG 375
           ++  G
Sbjct: 371 SKRDG 375

 Score =  179 bits (455), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 76/123 (61%), Positives = 101/123 (82%)

Query: 1065 YKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQM 1124
            +K+L+ EDN VNQ V+ RML+LEG+++  +ACDGQ+A +K+K++Q +G  Y L+ MD+QM
Sbjct: 917  FKLLIVEDNKVNQLVVIRMLKLEGIENFTIACDGQEAVEKIKEIQSRGEYYGLVLMDIQM 976

Query: 1125 PKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILK 1184
            PKVDG+T+TK+IR +L  D PIVALTAFADDSNI+ C  +GMDGFL+KPIKR +LK IL 
Sbjct: 977  PKVDGITATKIIRQELKYDKPIVALTAFADDSNIQACYKSGMDGFLAKPIKREQLKGILT 1036

Query: 1185 EFC 1187
            EFC
Sbjct: 1037 EFC 1039

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
           YIL147C
          Length = 1140

 Score =  404 bits (1038), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 233/466 (50%), Positives = 304/466 (65%), Gaps = 32/466 (6%)

Query: 463 DRLERLSNTSKHYTTAVNLIQARVPSYRALFKDELSDLTETFNTMTDALDQHYALLEERV 522
           +RL R  + S H + +    + +VP YR LF DEL++LT+TFN M++ALD+HYALLE+RV
Sbjct: 463 NRLRRNVSVSTHVSLS-EFDEIQVPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRV 521

Query: 523 RARTKQLEAAKIEAETANEAKTVFIANISHELRTPLNGILGMTAISMEETDIDKIRNSLK 582
             RTKQLEAAK++AE ANEAKTVFIANISHELRTPLNGILGMT+ S+EE DI KI++ LK
Sbjct: 522 HQRTKQLEAAKVQAEAANEAKTVFIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLK 581

Query: 583 LIFRSGXXXXXXXXXXXXFSKNVLKRTKLEKRNFCITDVALQIKSIFGKVAKDQHVRLSI 642
           LIFRSG            FSKNVL +TKLE R F I ++  QIK+IF K+ + Q V+L I
Sbjct: 582 LIFRSGELLLNILTELLTFSKNVLNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFI 641

Query: 643 ILSP-NMIRSMVLYGDSNRIIQIVMNLVSNALKFTP-VDGKVDVRMKVLGLYDEALSEKY 700
            L P   ++S++ YGDSNRI+Q++MNL+SNA+KFTP V+GKV+V M +LG YDE  S+  
Sbjct: 642 RLLPKKFLKSLLFYGDSNRILQVLMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTE 701

Query: 701 NHNKVYVKPGTEITDSTPSLNVKSEGQGK-----------DKFTSDTASKNNTSSDTAYD 749
           N++KV +KP T+I   +  L +KS+ + K               S     N     + Y 
Sbjct: 702 NYSKVCIKPSTQIVTESGEL-IKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYS 760

Query: 750 ATPTTDRVAQESDEDNMYEDNESMISSTTSS--------YDDAIFNSQFKKTTNLYDEDD 801
            T T  R       D+    N S +++++ S        YD+ +FN   K+     D D 
Sbjct: 761 HTNT--RTHTHPGADSRRNSNVSTVNNSSISLDSESSKMYDNLMFNRLIKREG---DGDI 815

Query: 802 ESEMGVE-LETPKTWVISFEVEDSGPGIDKGLQESVFEPFVQGDQTLSRQYGGTGLGLSI 860
                +E +E  K WVI FEV D+GPGID+ L +SVF+PFVQGDQTLSRQYGGTGLGLSI
Sbjct: 816 NDIKALEQIEGNKKWVIRFEVIDNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSI 875

Query: 861 CRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQ---TREINFANVED 903
           C+QL  MMKG + LES++G GSKF +T+PL Q   T++ N  N ED
Sbjct: 876 CKQLCEMMKGTLELESELGKGSKFIYTIPLLQVGGTKKDNDDNEED 921

 Score =  364 bits (935), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 185/379 (48%), Positives = 252/379 (66%), Gaps = 4/379 (1%)

Query: 3   FRLRSFTPKPPYRVGIRAQLTMXXXXXXXXXXXXXXXTTGVYFTSNYKNLRSDRLYIAAQ 62
            ++   T KPPYR  +RAQLT+                TGVYFT++YK+L  +RLYIA+Q
Sbjct: 10  LKMNKQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQ 69

Query: 63  LKSSQIDQNLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLF 122
           LKSSQIDQ LNYLYYQCYWVASR+T+QT + +   G  + +  ++SQSVL+KF+G+S+LF
Sbjct: 70  LKSSQIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLF 129

Query: 123 SVARVYDSSFTTVLNTTNNSTGDLIPEDVLTQLLPLS-TNVPLPSSLETNGIVTNPVKNG 181
               +YD +  +++N+TNN +G  +   +L++LLPLS TN  +P  +   GI+T+P+ N 
Sbjct: 130 YYTMIYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNS 189

Query: 182 SSYLMSMSLPI---FANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSA 238
           + YLMSMSLPI   ++  + I   S +YGY+TVVMSAE L SVFNDT  L  S  A++SA
Sbjct: 190 TKYLMSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSA 249

Query: 239 VYTNATKLDAYRFVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKL 298
           +YTN T    + FVFPPF    SI++E   + N TF   A  + K G+ K  +L  +   
Sbjct: 250 IYTNDTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNY 309

Query: 299 AVGYSPSTSNLANWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVK 358
           A+GY+P+   L  WVA+VA  +  F S + KL KII GTVVGI VF  LI+ PL++WAV+
Sbjct: 310 AIGYAPTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQ 369

Query: 359 PIVRLQKATELITESRGLR 377
           PIVRLQ+A+ELIT+ RGLR
Sbjct: 370 PIVRLQRASELITKRRGLR 388

 Score =  166 bits (420), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 80/124 (64%), Positives = 98/124 (79%)

Query: 1066 KILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMP 1125
            K+LVAEDN VNQEVIKRML+LE + DI+LA DG +AF+KVK+      +Y++IFMD+QMP
Sbjct: 1016 KVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQMP 1075

Query: 1126 KVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKE 1185
            K+DGL ST  IR +L  +  IVALTAFAD+SNIKEC DAGMDGF+ KPIKR  L T+L+E
Sbjct: 1076 KMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLLEE 1135

Query: 1186 FCSD 1189
            F  D
Sbjct: 1136 FQQD 1139

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 80/160 (50%), Gaps = 8/160 (5%)

Query: 1031 PHLSSFKEEKPND-PLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGV 1089
            PH+S      P   PL   + S E+    +     + +L+ ED+ V  ++  + L+  G 
Sbjct: 283  PHVSPLGTVAPTSIPLAQATPSKEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLRKYGC 342

Query: 1090 KDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVAL 1149
              +++  DG  A + V++ Q     Y+L+ MD+ MP +DG T+T +IR       PI+A+
Sbjct: 343  -SVEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPNLDGATATSVIR-SFDNQTPIIAM 395

Query: 1150 TAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD 1189
            T   +D ++   L  GM+  L+KP  +  L ++L  +  D
Sbjct: 396  TGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYLKD 435

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 70.9 bits (172), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 114/238 (47%), Gaps = 27/238 (11%)

Query: 978  ENITFRSESDDHLSHMHRNRDKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFK 1037
            E ++ ++ +D  + H     +   +++  +++T +   P LQ+T    ST +   L   +
Sbjct: 330  EPVSIQTPTDKQIQHQPAPHN---QQIRNNHNTTAATTPLLQNTLPLISTPAGGILP-LQ 385

Query: 1038 EEKPNDPLLNVSS-----------SAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQL 1086
            EE  N    +VSS           +++    T E    Y +L+ ED+ V+ ++  + L+ 
Sbjct: 386  EENINTTGHSVSSISKSDVDIKQENSQSPTATEELRKGYHVLLVEDDAVSIQLCSKFLRK 445

Query: 1087 EGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPI 1146
             G   +++  DG  A   ++       RY+L+ MD+ MP +DG T+T +IR +   + PI
Sbjct: 446  SGCT-VEVVTDGLAAISILEAF-----RYDLVLMDIVMPNLDGATATSIIR-NFDKETPI 498

Query: 1147 VALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD-----EREEDSKPVE 1199
            +A+T   +D ++   L  GM   L+KP  R  L ++L    S      ER++   P++
Sbjct: 499  IAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLLSMLIRHLSKRIPLCERQQSEPPIQ 556

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/146 (28%), Positives = 75/146 (51%), Gaps = 11/146 (7%)

Query: 1048 VSSSAEQTKKTSEGN----GAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFD 1103
            +SS++  T K  + N      + +L+ ED+ V+ ++  + L+  G   + +  DG  A  
Sbjct: 384  ISSNSSSTTKEVDQNIVLRKGFHVLLVEDDSVSIQLCSKFLRKYGCT-VQVVTDGLSAIS 442

Query: 1104 KVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLD 1163
             +++      RY+L+ MD+ MP +DG T+T ++R       PI+A+T   +D ++   L 
Sbjct: 443  NLEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLITYLQ 496

Query: 1164 AGMDGFLSKPIKRTKLKTILKEFCSD 1189
             GM+  L+KP  R  L +IL     D
Sbjct: 497  HGMNDILAKPFTRNDLHSILIRHLKD 522

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 69.7 bits (169), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ ++ ++  + L+  G   + +  DG  A   ++      SRY+L+ MD+ 
Sbjct: 402  GFHVLLVEDDAISIQLCSKFLRKYGCT-VQVVTDGLSAITTLE-----NSRYDLVLMDIV 455

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T +IR       PI+A+T   DD ++   L  GM+  L+KP  R  L ++L
Sbjct: 456  MPNLDGATATSIIR-SFDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDLHSML 514

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 515  IRYLKD 520

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 68.6 bits (166), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 70/127 (55%), Gaps = 9/127 (7%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V  ++  + L+  G   +++  DG  A   +++      RY+L+ MD+ 
Sbjct: 375  GFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLAAISTLEKF-----RYDLVLMDIV 428

Query: 1124 MPKVDGLTSTKMIR-HDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTI 1182
            MP +DG T+T ++R  D+H   PI+A+T   +D ++   L  GM+  L+KP  +  L ++
Sbjct: 429  MPNLDGATATSIVRSFDIHT--PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSM 486

Query: 1183 LKEFCSD 1189
            L  +  D
Sbjct: 487  LIRYLRD 493

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 67.8 bits (164), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V  ++  + L+  G   +++  DG  A + V++ Q     Y+L+ MD+ 
Sbjct: 328  GFCVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAIETVEKFQ-----YDLVLMDIV 381

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T +IR       PI+A+T   +D ++   L  GM+  L+KP  +  L ++L
Sbjct: 382  MPNLDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 440

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 441  IRYLKD 446

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 67.8 bits (164), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 90/193 (46%), Gaps = 19/193 (9%)

Query: 998  DKDHERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKK 1057
            D D    S    TM L  P    +G A    S+P L+     KP   L         T  
Sbjct: 277  DLDTAAASMVPGTMPLAAPS-HPSGAAPGDLSLP-LAHITASKPPGGL--------DTND 326

Query: 1058 TSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNL 1117
            TS     + +L+ ED+ V  ++  + L+  G   +++  DG  A   +++      RY+L
Sbjct: 327  TSVLKEGFHVLLVEDDAVCIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDL 380

Query: 1118 IFMDVQMPKVDGLTSTKMIR-HDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKR 1176
            + MD+ MP +DG T+T ++R  D H   PI+A+T   +D ++   L  GM+  L+KP  +
Sbjct: 381  VLMDIVMPNLDGATATSIVRSFDNHT--PIIAMTGNIEDQDLITYLQHGMNDILAKPFTK 438

Query: 1177 TKLKTILKEFCSD 1189
              L ++L  +  D
Sbjct: 439  DDLHSMLIRYLKD 451

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 67.4 bits (163), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ ++ ++  + L+  G   +++  DG  A   +++      RY+L+ MD+ 
Sbjct: 352  GFHVLLVEDDAISIQLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIV 405

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T +IR       PI+A+T   +D ++   L  GM+  L+KP  R  L ++L
Sbjct: 406  MPNLDGATATSIIR-SFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDLHSML 464

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 465  IRYLKD 470

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V+  +  + L+  G   +++  DG  A   +++      RY+L+ MD+ 
Sbjct: 380  GFHVLLVEDDAVSIRLCSKFLRKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIV 433

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T +IR +     PI+A+T   +D ++   L  GM+  L+KP  +  L ++L
Sbjct: 434  MPNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSML 492

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 493  IRYLKD 498

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 1031 PHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVK 1090
            P  S+   + PN P  N  +   Q    +   G + +L+ ED+ V+ ++  + L+  G  
Sbjct: 344  PATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKG-FHVLLVEDDAVSIQLCSKFLRKYGCT 402

Query: 1091 DIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALT 1150
             + +  DG  A   +++      RY+L+ MD+ MP +DG T+T ++R     + PI+A+T
Sbjct: 403  -VQVVSDGLSAISTLEKY-----RYDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 455

Query: 1151 AFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD 1189
                + ++   L  GM+  L+KP  R  L +IL  +  D
Sbjct: 456  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKD 494

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V+ ++  + L+  G   + +  DG  A   +++      RY+L+ MD+ 
Sbjct: 378  GFHVLLVEDDAVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIV 431

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R     + PI+A+T    + ++   L  GM+  L+KP  R  L +IL
Sbjct: 432  MPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSIL 490

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 491  IRYLKD 496

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/159 (27%), Positives = 79/159 (49%), Gaps = 8/159 (5%)

Query: 1031 PHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVK 1090
            P  S+   + PN P  N  +   Q    +   G + +L+ ED+ V+ ++  + L+  G  
Sbjct: 345  PTTSTVSLQMPNLPDENSLTPNAQGNAVTLRKG-FHVLLVEDDAVSIQLCSKFLRKYGCT 403

Query: 1091 DIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALT 1150
             + +  DG  A   +++      RY+L+ MD+ MP +DG T+T ++R     + PI+A+T
Sbjct: 404  -VQVVTDGLSAISTLEKF-----RYDLVLMDIVMPNLDGATATSIVR-SFDNETPIIAMT 456

Query: 1151 AFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSD 1189
                + ++   L  GM+  L+KP  R  L +IL  +  D
Sbjct: 457  GNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYLKD 495

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V+ ++  + L+  G   + +  DG  A   +++      RY+L+ MD+ 
Sbjct: 378  GFHVLLVEDDVVSIQLCSKFLRKYGCT-VQVVTDGLSAISTLEKF-----RYDLVLMDIV 431

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R     + PI+A+T    + ++   L  GM+  L+KP  R  L +IL
Sbjct: 432  MPNLDGATATSIVR-SFDNETPIIAMTGNIMNQDLITYLQHGMNDILAKPFTRDDLHSIL 490

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 491  IRYLKD 496

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 64.7 bits (156), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 68/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V  ++  + L+  G   +++  DG  A   +++      R++L+ MD+ 
Sbjct: 328  GFHVLLVEDDSVCIQLCSKFLRKYGCS-VEVVTDGLSAISTLEK-----QRFDLVLMDIV 381

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R     + PI+A+T   DD ++   L  GM+  L+KP  +  L ++L
Sbjct: 382  MPNLDGATATSIVR-SFDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSML 440

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 441  IRYLKD 446

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 64.3 bits (155), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V  ++  + L   G   +++  DG  A   +++      RY+L+ MD+ 
Sbjct: 306  GFHVLLVEDDSVCIQLCSKFLLKYGCS-VEVVTDGLSAISTLEKF-----RYDLVLMDIV 359

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R       PI+A+T   +D ++   L+ GM+  L+KP  +  L ++L
Sbjct: 360  MPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDLHSML 418

Query: 1184 KEFCSD 1189
              +  D
Sbjct: 419  IRYLKD 424

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 64/120 (53%), Gaps = 7/120 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ +  ++  + L   G   +++  DG  A   +++      RY+L+ MD+ 
Sbjct: 304  GFHVLLVEDDSICIQLCSKFLMKYGCT-VEVVTDGLSAISTLEKF-----RYDLVLMDIV 357

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R       PI+A+T   +D ++   L  GM+  L+KP  +  L ++L
Sbjct: 358  MPNLDGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 416

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 70/132 (53%), Gaps = 7/132 (5%)

Query: 1058 TSEGNGAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNL 1117
            ++E    + +L+ ED+ V+ ++  + L+  G   + +  DG  A   +++      R++L
Sbjct: 375  SNELKKGFHVLLVEDDDVSIQLCSKFLRKYGCT-VQVVTDGLAAISILEKF-----RFDL 428

Query: 1118 IFMDVQMPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRT 1177
            + MD+ MP +DG T+T +IR +     PI+A+T   +  ++   L  GM+  L+KP  R 
Sbjct: 429  VLMDIVMPNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRK 487

Query: 1178 KLKTILKEFCSD 1189
             L +IL  +  D
Sbjct: 488  DLYSILIRYLKD 499

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 60.8 bits (146), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 67/127 (52%), Gaps = 7/127 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V  ++  + L+  G   + +  DG  A   ++       R++L+ MD+ 
Sbjct: 415  GFHVLLVEDDEVCIQLCSKFLRKYGCT-VRVVTDGLTAISVLEN-----HRFDLVLMDIV 468

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T ++R +     PI+A+T   +D ++   L  GM+  L+KP  +  L ++L
Sbjct: 469  MPNLDGATATSIVR-NFDNYTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLHSML 527

Query: 1184 KEFCSDE 1190
              +  D+
Sbjct: 528  VRYLRDK 534

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 67/126 (53%), Gaps = 7/126 (5%)

Query: 1064 AYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQ 1123
             + +L+ ED+ V+ ++  + L   G   + +  DG  A   +++      R++L+ MD+ 
Sbjct: 349  GFNVLLVEDDEVSIQLCSKFLIKYGCT-VQVVTDGLAAISTLEKY-----RFDLVLMDIV 402

Query: 1124 MPKVDGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            MP +DG T+T +IR +   + PI+A+T   +  ++   L  GM+  L+KP  R  L ++L
Sbjct: 403  MPNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRRDLYSML 461

Query: 1184 KEFCSD 1189
              +  +
Sbjct: 462  TRYLKN 467

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 59.3 bits (142), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/176 (23%), Positives = 84/176 (47%), Gaps = 12/176 (6%)

Query: 1008 NSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKI 1067
            N+TM    P +Q+T +   +  +P L   K   P  P     + +            + +
Sbjct: 250  NATMPTTHP-IQNTQSPQMSSVVPPLPIRKTINPGQP----PAPSNMILDHPILRPGFHV 304

Query: 1068 LVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKV 1127
            L+ ED+ +  ++  + L ++    +++  DG  A   +++      R++L+ MD+ MP +
Sbjct: 305  LLVEDDSICIQLCSKFL-MKYACTVEVVTDGLSAISTLEKF-----RFDLVLMDIVMPNL 358

Query: 1128 DGLTSTKMIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTIL 1183
            DG T+T ++R       PI+A+T   +D ++   L  GM+  L+KP  +  L ++L
Sbjct: 359  DGATATSIVR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSML 413

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 58.2 bits (139), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +   ++A +G +A +K +Q        +LI MD+Q+P 
Sbjct: 551  VLIVEDNIINQAILVSFLKRHRIS-YEIAKNGAEAVEKWRQ-----GGIHLILMDLQLPL 604

Query: 1127 VDGLTSTKMIR-------------------HDLHCDFP---------IVALTAFADDSNI 1158
            + GL +TK IR                    D   D           IVALTAF+  ++ 
Sbjct: 605  LSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRSPVIIVALTAFSSHADR 664

Query: 1159 KECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            +E L AG + +L+KP+    L + + E+
Sbjct: 665  REALVAGCNDYLTKPVNLDWLSSKITEW 692

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 56.2 bits (134), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +   ++A +G +A +K +    KG   +LI MD+Q+P 
Sbjct: 511  VLIVEDNIINQAILSSFLRKHKIS-YEIAKNGVEAVEKWR----KGG-IHLILMDLQLPL 564

Query: 1127 VDGLTSTKMIRH----------DLHCD------------------FPIVALTAFADDSNI 1158
            + G+ + K IR+            HC+                    IVALTAF+  ++ 
Sbjct: 565  LSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVIIVALTAFSSHADR 624

Query: 1159 KECLDAGMDGFLSKPIKRTKLKTILKEF 1186
             E L AG + +L+KP+    L   + E+
Sbjct: 625  NEALVAGCNDYLTKPVNLDWLSNKITEW 652

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 68/126 (53%), Gaps = 13/126 (10%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A   V+  ++ G   +LIFMD+Q+P 
Sbjct: 477  VLIVEDNVINQAILGGFLRKHKIS-YKVAKNGKEA---VEMWKNGG--LHLIFMDLQLPV 530

Query: 1127 VDGLTSTKMIRHDLHCDFP------IVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLK 1180
            + G+ + K IR D   + P      IVALTA     + +  L +G + +L+KP+    L 
Sbjct: 531  LSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHWLS 589

Query: 1181 TILKEF 1186
              + E+
Sbjct: 590  KKITEW 595

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 53.1 bits (126), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 67/141 (47%), Gaps = 28/141 (19%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ +++  L+   +    +A +GQ+A D+ K+        +LIFMD+Q+P 
Sbjct: 503  VLIVEDNVINQAILRSFLKKHKIS-YKVAKNGQEAVDRWKE-----GGIDLIFMDLQLPV 556

Query: 1127 VDGLTSTKMIRHDLH---------------------CDFPIVALTAFADDSNIKECLDAG 1165
              G+ + K IR DL                          IVA TA    ++ +E L +G
Sbjct: 557  FSGMDAAKKIR-DLEKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSG 615

Query: 1166 MDGFLSKPIKRTKLKTILKEF 1186
             + +L+KP+    L   + E+
Sbjct: 616  CNDYLTKPVNLHWLSKKINEW 636

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 52.8 bits (125), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 66/142 (46%), Gaps = 28/142 (19%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +LV EDN +NQ ++   L+   +    +A +G +A D+ K+        +LI MD++MP 
Sbjct: 408  VLVVEDNMINQAILSSFLRKHKIH-YKVAKNGVEAVDRWKE-----GGMHLILMDLEMPL 461

Query: 1127 VDGLTSTKMIRH--------------------DLHCDFP--IVALTAFADDSNIKECLDA 1164
            + G+ + K IR                      L C  P  IVALTA    ++  E L A
Sbjct: 462  LSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEALLA 521

Query: 1165 GMDGFLSKPIKRTKLKTILKEF 1186
            G + +L+KP+    L   + E+
Sbjct: 522  GCNDYLTKPVNLDWLTRKITEW 543

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/147 (25%), Positives = 66/147 (44%), Gaps = 33/147 (22%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A DK K+        +LIFMD+Q+P 
Sbjct: 465  VLIVEDNVINQAILGSFLRKNKIS-YKIAKNGKEAVDKWKE-----GNLHLIFMDLQLPV 518

Query: 1127 VDGLTSTKMIRH---------------------------DLHCDFPIVALTAFADDSNIK 1159
            + G+ + K IR                              +    IVALTA     + +
Sbjct: 519  LSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQEDKR 578

Query: 1160 ECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            E L +G + +L+KP+    L   + E+
Sbjct: 579  EALISGCNDYLTKPVNLLWLSKKITEW 605

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 83/188 (44%), Gaps = 44/188 (23%)

Query: 1031 PHLS----SFKEEKPNDPLLNVSSSAEQTKKTSEGN-GAYKILVAEDNHVNQEVIKRMLQ 1085
            PH S     F    P DPL N+ ++      TSE       +L+ EDN +NQ ++   L+
Sbjct: 453  PHYSIYNAPFAVSSPPDPLPNLFTT------TSEKVFPKINVLIVEDNVINQAILGSFLR 506

Query: 1086 LEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIR-------- 1137
               +    LA +GQ+A +  K+        +LIFMD+Q+P + G+ + K IR        
Sbjct: 507  KHKIS-YKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVLSGIEAAKQIRDFEKQNGI 560

Query: 1138 ---HDLHCDFP----------------IVALTAFADDSNIKECLDAGMDGFLSKPIKRTK 1178
                 L+  +P                IVALTA     + ++ L +G + +L+KP+    
Sbjct: 561  GIQKSLNNSYPNHEKLPCKKFSQAPVIIVALTASNSQMDKRKALVSGCNDYLTKPVNLHW 620

Query: 1179 LKTILKEF 1186
            L   + E+
Sbjct: 621  LSKKITEW 628

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 66/146 (45%), Gaps = 32/146 (21%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +GQ+A D  ++        +LIFMD+Q+P 
Sbjct: 567  VLIVEDNVINQTILSSFLRKHKIF-YKVAKNGQEAIDVWRE-----GGIHLIFMDLQLPV 620

Query: 1127 VDGLTSTKMIRH--------------------------DLHCDFPIVALTAFADDSNIKE 1160
            + G+ + K IR                            ++    IVA TA    S+ KE
Sbjct: 621  LSGIDAAKKIRELEREHGIGIQKSRKTPHIESNKINKDQINAPVIIVAFTASKSQSDKKE 680

Query: 1161 CLDAGMDGFLSKPIKRTKLKTILKEF 1186
             L +G + +L+KP+    L   + E+
Sbjct: 681  ALISGCNDYLTKPVNLHWLSNKINEW 706

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 13/127 (10%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A D  K+        +LIFMD+Q+P 
Sbjct: 519  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 572

Query: 1127 VDGLTSTKMIRH-------DLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKL 1179
            + G+ + K IR          +    IVALTA     + ++ L +G + +L+KP+    L
Sbjct: 573  LSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTKPVNLHWL 632

Query: 1180 KTILKEF 1186
               + E+
Sbjct: 633  SKKITEW 639

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 97/214 (45%), Gaps = 43/214 (20%)

Query: 1001 HERLSASNSTMSLDRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSE 1060
             E+    N+T S   P L ++ T   + S+ + + F    P DPL N+ ++      TSE
Sbjct: 447  EEQRRKDNATPS--SPILTNSQTPHYSNSL-YNAPFTVSSPPDPLPNLFTT------TSE 497

Query: 1061 GN-GAYKILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIF 1119
                   +L+ EDN +NQ ++   L+   +    LA +GQ+A +  K+        +LIF
Sbjct: 498  KVFPKINVLIVEDNVINQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE-----GGLHLIF 551

Query: 1120 MDVQMPKVDGLTSTKMIR--------------HDLHCDFP-------------IVALTAF 1152
            MD+Q+P + G+ + K IR              ++ H +F              IVALTA 
Sbjct: 552  MDLQLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVIIVALTAS 611

Query: 1153 ADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186
                + ++ L +G + +L+KP+    L   + E+
Sbjct: 612  NSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 52.0 bits (123), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 90/199 (45%), Gaps = 41/199 (20%)

Query: 1016 PFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGN-GAYKILVAEDNH 1074
            P L S+ T   + S+ + + F    P DPL N+ ++      TSE       +L+ EDN 
Sbjct: 461  PILTSSQTPHYSNSL-YNAPFAVSSPPDPLPNLFTT------TSEKVFPKINVLIVEDNV 513

Query: 1075 VNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTK 1134
            +NQ ++   L+   +    LA +GQ+A +  K+        +LIFMD+Q+P + G+ + K
Sbjct: 514  INQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVLSGIEAAK 567

Query: 1135 MIR--------------HDLHCDFP-------------IVALTAFADDSNIKECLDAGMD 1167
             IR              ++ H +               IVALTA     + ++ L +G +
Sbjct: 568  QIRDFEKQNGIGIQKSLNNSHSNLEKGTSKRFSQAPVIIVALTASNSQMDKRKALLSGCN 627

Query: 1168 GFLSKPIKRTKLKTILKEF 1186
             +L+KP+    L   + E+
Sbjct: 628  DYLTKPVNLHWLSKKITEW 646

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (45%), Gaps = 41/199 (20%)

Query: 1016 PFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGN-GAYKILVAEDNH 1074
            P L ++ T   + S+ + + F    P DPL N+ ++      TSE       +L+ EDN 
Sbjct: 450  PILINSQTPQYSGSL-YKTPFTVSSPPDPLPNLFTT------TSEKVFPKINVLIVEDNV 502

Query: 1075 VNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTK 1134
            +NQ ++   L+   +    LA +GQ+A +  K+        +LIFMD+Q+P + G+ + K
Sbjct: 503  INQAILGSFLRKHKIS-YKLAKNGQEAVNIWKE-----GGLHLIFMDLQLPVLSGIEAAK 556

Query: 1135 MIR--------------HDLHCDFP-------------IVALTAFADDSNIKECLDAGMD 1167
             IR              ++ H +F              IVALTA     + ++ L +G +
Sbjct: 557  QIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQAPVIIVALTASNSQMDKRKALLSGCN 616

Query: 1168 GFLSKPIKRTKLKTILKEF 1186
             +L+KP+    L   + E+
Sbjct: 617  DYLTKPVNLHWLSKKITEW 635

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 61/111 (54%), Gaps = 9/111 (8%)

Query: 1089 VKDID-LACD--GQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRH--DLHCD 1143
            VKD++ L C   G  A D++ +    G +++LI   +++PK+  +   K++RH    +C+
Sbjct: 1456 VKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHTNSANCN 1515

Query: 1144 FPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDEREED 1194
             PIVA+TA+  ++   +      D  L KP+   +++ ++ ++   + +ED
Sbjct: 1516 TPIVAVTAYYGEAESTQVF----DDVLEKPVGIEQIRCLIAKYALQKSQED 1562

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 68/150 (45%), Gaps = 36/150 (24%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A DK K+        +LIFMD+Q+P 
Sbjct: 513  VLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWKE-----GGLHLIFMDLQLPV 566

Query: 1127 VDGLTSTKMIR-HDLH-----------------------------CDFPIVALTAFADDS 1156
            + G+ + K IR ++ H                                 IVA TA    +
Sbjct: 567  LSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNSLT 626

Query: 1157 NIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            + +E L +G + +L+KP+    L   + E+
Sbjct: 627  DKREALISGCNDYLTKPVNLHWLSKKITEW 656

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 64/139 (46%), Gaps = 25/139 (17%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A D  K+        +LIFMD+Q+P 
Sbjct: 547  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 600

Query: 1127 VDGLTSTKMIR-------------------HDLHCDFPIVALTAFADDSNIKECLDAGMD 1167
            + G+ + + IR                   +       IVALTA     + +  L +G +
Sbjct: 601  LSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTKAPVIIVALTASNSQDDKRNALISGCN 660

Query: 1168 GFLSKPIKRTKLKTILKEF 1186
             +L+KP+    L   + E+
Sbjct: 661  DYLTKPVNLHWLSKKITEW 679

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+  G+    +A DG +A +K K+    G  + LI MD+Q+P 
Sbjct: 396  VLIVEDNAINQAILALFLRKNGIS-YKVAKDGVEAIEKWKE----GDSH-LILMDLQLPL 449

Query: 1127 VDGLTSTKMIRH 1138
            + GL +TK IR 
Sbjct: 450  LSGLEATKKIRE 461

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 66/143 (46%), Gaps = 29/143 (20%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +LV EDN +NQ ++   L+   +    +A +G +A D+ K+        +LI MD++MP 
Sbjct: 421  VLVVEDNMINQTILSSFLRKHKIS-YKVAKNGIEAVDRWKE-----GGMHLILMDLEMPL 474

Query: 1127 VDGLTSTKMIR-----HDLHCDFP------------------IVALTAFADDSNIKECLD 1163
            + G+ + K IR     + +    P                  IVALTA    S+  E L 
Sbjct: 475  LSGIDAAKEIRRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALL 534

Query: 1164 AGMDGFLSKPIKRTKLKTILKEF 1186
            AG + +L+KP+    L   + E+
Sbjct: 535  AGCNDYLTKPVNLDWLTRKITEW 557

>Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp,
            1571 aa] {ON} ANNOTATED BY YGOB -
          Length = 1571

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 48/88 (54%), Gaps = 8/88 (9%)

Query: 1112 GSRYNLIFMDVQMPKVDGLTSTKMIRH--DLHCDFPIVALTAFADDSNIKECLDAGMDGF 1169
            G +++LI   +++PK+  +   K+IRH   ++C  PIVALT +  D+   +      D  
Sbjct: 1481 GVKFDLIITAMKLPKLGAIDIAKLIRHTNSVNCTTPIVALTVYYHDAKESKVF----DDV 1536

Query: 1170 LSKPIKRTKLKTILKEFC--SDEREEDS 1195
            L KP+   +L+ ++ ++     + EED+
Sbjct: 1537 LEKPVSVEQLRKLVSKYALLKSQNEEDT 1564

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 66/148 (44%), Gaps = 39/148 (26%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A D  K+        +LIFMD+Q+P 
Sbjct: 672  VLIVEDNVINQAILGSFLRKHKIS-YKVAKNGKEAVDIWKE-----GGLHLIFMDLQLPV 725

Query: 1127 VDGLTSTKMIRHDLHCDFP----------------------------IVALTAFADDSNI 1158
            + G+ + + IR     DF                             IVALTA     + 
Sbjct: 726  LSGIEAARQIR-----DFEKEKGIGIQENNLKQKIIPASNINQAPVIIVALTASNSLDDK 780

Query: 1159 KECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            ++ L +G + +L+KP+    L   + E+
Sbjct: 781  RKALLSGCNDYLTKPVNLHWLSKKITEW 808

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A DK KQ        +LI +D+Q+P 
Sbjct: 464  VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWKQ-----GGIHLILLDLQLPI 517

Query: 1127 VDGLTSTKMIRH 1138
            + G+ +TK IR+
Sbjct: 518  LSGIEATKEIRN 529

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/148 (24%), Positives = 66/148 (44%), Gaps = 34/148 (22%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ EDN +NQ ++   L+   +    +A +G++A +K K+        +LIFMD+Q+P 
Sbjct: 473  VLIVEDNVINQTILASFLRKHKIS-YRIAKNGREAVEKWKE-----GGIHLIFMDLQLPV 526

Query: 1127 VDGLTSTKMIRHD----------------------------LHCDFPIVALTAFADDSNI 1158
            + G+ + K IR                              L     +VA TA    ++ 
Sbjct: 527  MSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTDK 586

Query: 1159 KECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            +E L +G + +L+KP+    L   + E+
Sbjct: 587  REALVSGCNDYLTKPVNLHWLSKKITEW 614

>Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} similar to
            Ashbya gossypii ACR218W
          Length = 1694

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 68/136 (50%), Gaps = 19/136 (13%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +L+ E   +++  + R L+L G   + +        D++ +    G R++LI   +++PK
Sbjct: 1564 VLLCEPIPIHRYRLARDLELLGCSVVAVGTG-----DEIVRRATSGVRFDLIITTLKLPK 1618

Query: 1127 VDGLTSTKMIRH--DLHCDFPIVALTAFADD--SNIKECLDAGMDGFLSKPIKRTKLKTI 1182
            +  +   +++RH   ++C+ PIVA+     D  SNI        D  L +PI   +L+ +
Sbjct: 1619 IGAIDIARLLRHTTSINCNTPIVAVAVNYHDVGSNI-------FDDVLERPIGVEQLRKM 1671

Query: 1183 LKEFC---SDEREEDS 1195
            + ++    S ++ ED+
Sbjct: 1672 VSKYALLKSQQQHEDT 1687

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 63/150 (42%), Gaps = 36/150 (24%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            IL+ EDN +NQ ++   L+   +    +A +G++A DK K+        +LIFMD+Q+P 
Sbjct: 567  ILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWKE-----GGIHLIFMDLQLPV 620

Query: 1127 VDGLTSTKMIRH------------------------------DLHCDFPIVALTAFADDS 1156
            + G  + K IR                                      IVA TA    +
Sbjct: 621  LSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAFTASNSLA 680

Query: 1157 NIKECLDAGMDGFLSKPIKRTKLKTILKEF 1186
            + +  L AG + +L+KP+    L   + E+
Sbjct: 681  DKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 40.8 bits (94), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 67/132 (50%), Gaps = 13/132 (9%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            ILV E   +++  + R L+  G   + +      A D++    + G +++LI   +++PK
Sbjct: 1544 ILVCEPIPIHRYRVTRDLESVGCTVVSVG-----AGDELVSRANSGVKFDLIVTALKLPK 1598

Query: 1127 VDGLTSTKMIRH--DLHCDFPIVALTAFADDSNIKECLDAGM-DGFLSKPIKRTKLKTIL 1183
            +  +   K+I+H   ++   PI+A+T F       E + A + D  L KPI   +++ ++
Sbjct: 1599 LGAIDIVKLIKHTNGINSRTPIIAITNF-----YHEAISAKVFDDVLEKPIMLDEIRHLV 1653

Query: 1184 KEFCSDEREEDS 1195
             ++   + +E+S
Sbjct: 1654 AKYALKKSQEES 1665

>Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556)
            [4554 bp, 1517 aa] {ON}
            (101912..102910,102960..102968,103011..106556) [4554 nt,
            1518 aa]
          Length = 1517

 Score = 36.2 bits (82), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 58/123 (47%), Gaps = 14/123 (11%)

Query: 1080 IKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRH- 1138
            I R     G++ +        A D++ +    G +++LI   +++PK+  +   K+++H 
Sbjct: 1394 IHRYCTTSGLESLGCTVVAVGAGDELVRRATSGVKFDLIITALRIPKLGAVDIVKLLKHT 1453

Query: 1139 -DLHCDFPIVALTAF---ADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFC--SDERE 1192
              ++   PIVA T +   A ++N+           L KPI    L+ ++ ++     +R+
Sbjct: 1454 NGINSTTPIVAATCYFEEASNTNV-------FSDVLEKPISIQTLRKLISKYALIKSQRQ 1506

Query: 1193 EDS 1195
            E+S
Sbjct: 1507 EES 1509

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 35.8 bits (81), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 50/87 (57%), Gaps = 9/87 (10%)

Query: 1114 RYNLIFMDVQMPKVDGLTSTKMIR--HDLHCDFPIVALTAFADDSNIKECLDAGMDGFLS 1171
            +++LIF  +++PK+  +   K++R  + ++    I+A+TA+  ++  + C     D  L 
Sbjct: 1433 KFDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QAC---AFDEVLE 1488

Query: 1172 KPIKRTKLKTILKEFC---SDEREEDS 1195
            +P+   +L+++L ++    S E EE+S
Sbjct: 1489 RPVSVQQLRSLLLKYSLKKSQESEENS 1515

>KAFR0C03720 Chr3 complement(757451..758257) [807 bp, 268 aa] {ON}
           Anc_1.124 YJL210W
          Length = 268

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 3/60 (5%)

Query: 158 LSTNVPLPSSLETNGIVTNPVKNGSSYL-MSMSLPIFANPSIILTDSRVYGYVTVVMSAE 216
           LS N  L  + +T G  TN +KNG S   +    P   NP  IL   ++Y YV  V S E
Sbjct: 191 LSNNFLLMQARKTGGPTTNVIKNGKSVCPLCNEFP--TNPYKILCCGKIYCYVCAVKSLE 248

>TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1536

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 32/136 (23%), Positives = 66/136 (48%), Gaps = 19/136 (13%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            IL+ E   +++  I + L+  G   + +A     A D++      G +++LI   +++PK
Sbjct: 1406 ILLCEPIPIHRYYITKDLETLGCTVVSVA-----AGDELISRATSGIKFDLIITALKLPK 1460

Query: 1127 VDGLTSTKMIRH--DLHCDFPIVALTAF---ADDSNIKECLDAGMDGFLSKPIKRTKLKT 1181
            +  +   K+++H   ++   P+VA+T++   A ++NI             KPI    LK 
Sbjct: 1461 LGAVDIVKLLKHTNGINSFTPVVAVTSYYHEATNANI-------FSDVFEKPITLDVLKK 1513

Query: 1182 ILKEFC--SDEREEDS 1195
            ++ ++     + EEDS
Sbjct: 1514 LVSKYALLKSQMEEDS 1529

>TPHA0F02370 Chr6 complement(521679..522962) [1284 bp, 427 aa] {ON}
            Anc_2.66 YNL187W
          Length = 427

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 34/62 (54%), Gaps = 10/62 (16%)

Query: 1014 DRPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTK-KTSEGNGAYKILVAED 1072
            + PFL +T      RS+ H  ++K E     L++  S     K ++ EGNG Y+IL++E+
Sbjct: 234  EYPFLDNT------RSVFHFGTYKNEIG---LIDTRSEQINIKYRSKEGNGVYQILMSEN 284

Query: 1073 NH 1074
             H
Sbjct: 285  EH 286

>TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON}
            Anc_8.34 YFL033C
          Length = 1602

 Score = 34.3 bits (77), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 27/134 (20%), Positives = 67/134 (50%), Gaps = 15/134 (11%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +LV E   +++  + + L+  G   I +      A D++      G +++LI   +++PK
Sbjct: 1470 VLVCEPIPIHRYRVTKDLESLGCTVISVG-----AGDELVSRATSGVKFDLIITALKLPK 1524

Query: 1127 VDGLTSTKMIRH--DLHCDFPIVALTAFADDSNIKECLDAGM-DGFLSKPIKRTKLKTIL 1183
            +  +   ++++H   ++   P+VA+T +      +E +   + D  L KP+   +L+ I 
Sbjct: 1525 LGAVDIVRLLKHTNSINATTPVVAVTNY-----YQEAVSGNVFDDVLEKPVAYDQLRKIA 1579

Query: 1184 KEFCSD--EREEDS 1195
             ++  +  +++ED+
Sbjct: 1580 AKYTLEKVQQQEDT 1593

>TPHA0N00800 Chr14 (178261..179169) [909 bp, 302 aa] {ON} 
          Length = 302

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 11/90 (12%)

Query: 1017 FLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVA---EDN 1073
             L+S  T T   +I  +   KE+KP    LN   SA+++ K      +YK   +   E+ 
Sbjct: 53   LLRSDHTITYKNTIRFID--KEDKPEMKHLNTKHSAQKSAK------SYKFKYSNNYENE 104

Query: 1074 HVNQEVIKRMLQLEGVKDIDLACDGQDAFD 1103
            HVN+     +++L+G++ IDL  +    +D
Sbjct: 105  HVNKNNKTPIMELDGIQSIDLNLNLTSNYD 134

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 1067 ILVAEDNHVNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPK 1126
            +LV E   +++  + + L+  G   + +      A D++      G  ++LI   +++PK
Sbjct: 1637 VLVCEPIPIHRYRVTKDLENLGCTVVSVG-----AGDELVSRATSGVSFDLIMTALKLPK 1691

Query: 1127 VDGLTSTKMIRH--DLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILK 1184
            +  +   ++++     +   PIVA+T +  ++      D      L KP+K  +LK ++ 
Sbjct: 1692 LGAIDIVQLLKQTNGANSTTPIVAITNYFQEAATSRVFD----DVLEKPVKLDELKKLVA 1747

Query: 1185 EFCSDEREEDSK 1196
            ++   + +ED +
Sbjct: 1748 KYALKKSQEDEE 1759

>KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8.34
            YFL033C
          Length = 1450

 Score = 32.7 bits (73), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 21/84 (25%), Positives = 45/84 (53%), Gaps = 8/84 (9%)

Query: 1114 RYNLIFMDVQMPKVDGLTSTKMIR--HDLHCDFPIVALTAFADDS-NIKECLDAGMDGFL 1170
            +++LI   +++P V      K+++  + ++ D PIVA T +  D+ N K       D  +
Sbjct: 1357 KFDLIVTTLRLPNVYATDIIKLVKRANCVNSDTPIVAATNYYQDAVNTK-----FFDDVV 1411

Query: 1171 SKPIKRTKLKTILKEFCSDEREED 1194
             KP+ R KL+ ++ ++   + +E+
Sbjct: 1412 EKPLSREKLRKLVSKYALKKSQEE 1435

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 32.3 bits (72), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 50/99 (50%), Gaps = 8/99 (8%)

Query: 1101 AFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTKMIRH--DLHCDFPIVALTAFADDSNI 1158
            A D++      G  ++LI   +++PK+  +   +++R     +   PIVA+T +      
Sbjct: 1654 AGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQTNGANSTTPIVAITNY-----F 1708

Query: 1159 KECLDAGM-DGFLSKPIKRTKLKTILKEFCSDEREEDSK 1196
            +E + + + D  L KP+   +LK ++ ++   + +ED +
Sbjct: 1709 QEAITSKVFDDVLEKPVNLDELKKLVAKYALKKSQEDEE 1747

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 121,023,350
Number of extensions: 5350454
Number of successful extensions: 22059
Number of sequences better than 10.0: 338
Number of HSP's gapped: 23023
Number of HSP's successfully gapped: 418
Length of query: 1200
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1079
Effective length of database: 39,606,813
Effective search space: 42735751227
Effective search space used: 42735751227
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 72 (32.3 bits)