Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L021005.699ON44444419200.0
ZYRO0G06666g5.699ON5034973431e-34
TDEL0B022205.699ON4894853085e-30
Skud_9.225.699ON5375202813e-26
Smik_9.235.699ON5275042681e-24
KAFR0D022505.699ON5563412391e-20
Suva_9.435.699ON5133902371e-20
YIL146C (ATG32)5.699ON5293402334e-20
CAGL0H06545g5.699ON4922082202e-18
KLTH0E01122g5.699ON4723581882e-14
SAKL0E14850g5.699ON4703711686e-12
Ecym_40215.699ON4594301597e-11
Kwal_55.197165.699ON4673691588e-11
AFR283W5.699ON4523481543e-10
NCAS0G002605.699ON5103821251e-06
TBLA0E020905.699ON7491511242e-06
KLLA0A00660g5.699ON524398860.052
NOTE: 2 genes in the same pillar as KNAG0L02100 were not hit in these BLAST results
LIST: Kpol_2001.73 TPHA0D04580

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L02100
         (444 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....   744   0.0  
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...   136   1e-34
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...   123   5e-30
Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON} Y...   112   3e-26
Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON} Y...   107   1e-24
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    97   1e-20
Suva_9.43 Chr9 complement(68866..68940,68994..69068,69093..69122...    96   1e-20
YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}  AT...    94   4e-20
CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} simila...    89   2e-18
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    77   2e-14
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...    69   6e-12
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...    66   7e-11
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    65   8e-11
AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic ho...    64   3e-10
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    53   1e-06
TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.6...    52   2e-06
KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON...    38   0.052

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/444 (83%), Positives = 369/444 (83%)

Query: 1   MSGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDELSAM 60
           MSGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDELSAM
Sbjct: 1   MSGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDELSAM 60

Query: 61  ERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTRMARPAMSLQSTSSTLDGVD 120
           ERSASQQTNNGVLSSSDT                  VADTRMARPAMSLQSTSSTLDGVD
Sbjct: 61  ERSASQQTNNGVLSSSDTSEEGEPEQGSPGDGEGGGVADTRMARPAMSLQSTSSTLDGVD 120

Query: 121 DDXXXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVP 180
           DD              FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVP
Sbjct: 121 DDSATVSKSLTSSSNSFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVP 180

Query: 181 EQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQ 240
           EQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQ
Sbjct: 181 EQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQ 240

Query: 241 VQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQE 300
           VQVKNVLRNFTRQR            NNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQE
Sbjct: 241 VQVKNVLRNFTRQRLVSLLHPPVPLSNNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQE 300

Query: 301 QHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGXXXXXXXXXXXXXXXXFNFRHT 360
           QHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAG                FNFRHT
Sbjct: 301 QHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGYYCVSYVVSSSMCVSCFNFRHT 360

Query: 361 DHTLXXXXXXXXXXXXXXXPSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFH 420
           DHTL               PSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFH
Sbjct: 361 DHTLAATTSTAAAAAAAATPSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFH 420

Query: 421 YIDRSQEWHLHDPNRFLQLGYAVI 444
           YIDRSQEWHLHDPNRFLQLGYAVI
Sbjct: 421 YIDRSQEWHLHDPNRFLQLGYAVI 444

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score =  136 bits (343), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 134/497 (26%), Positives = 199/497 (40%), Gaps = 77/497 (15%)

Query: 7   SVLDPHLSVLELLEKSCERGGHAEAPGS--------SRNKGAGQIQLSESWCTVERDE-- 56
           S+LDPHLSVLELL +  +   H    G         +   G G   +S+SW T+ R++  
Sbjct: 25  SILDPHLSVLELLRRPSDTRPHEALKGEVSDIVGNCAGTTGTGNGSISQSWQTIHRNDSC 84

Query: 57  LSAM-ERSASQQTNNGVLSSSDTXXXXXXXXXXXXX-----------XXXXXVADTRMAR 104
           LS + ER  SQ T  G+LSSSDT                             + D R   
Sbjct: 85  LSVVPERCPSQATAAGILSSSDTSEDEPDAVNSPSAVHQQLHATPPQKHTKSLEDYRSLN 144

Query: 105 PAMSL--------------QSTSSTLDGVDDDXXXXXXXXXXXXXXFIMPKLYTTVAGAP 150
             + L                +++  +G +DD              FIMPKL        
Sbjct: 145 VGIPLVLPEDSNNINNNNKNGSTTGSNGEEDDNDTITKSLNSSSNSFIMPKL-------- 196

Query: 151 STVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVVQ 210
              S + +T+ F++ VLGR  +KF   ++P++++H FEL    HD A+     GIL+V Q
Sbjct: 197 ---SLSQKTQKFRILVLGRPGLKFYH-SIPKKYQHMFELPRS-HDPAEFKQYTGILVVFQ 251

Query: 211 EVRELISLLNRVHCAC-PEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNE 269
           E++E++SLLNRV C C P  PV+ V    ++ QV+N+L +  + R            N  
Sbjct: 252 ELKEMVSLLNRV-CQCNPNRPVIPVCQSGQRQQVRNLLESLLKNRLVSLLYPPVVVNNQP 310

Query: 270 ALDKMFHFVDNLARQ---------QEPAGVIHNDPQTTQEQHPDHNEDD------PHRGP 314
            L  MF F+  L++          +EP        ++ Q +     E        PH+  
Sbjct: 311 DLLGMFRFLQELSKTVSDNSDMDAEEPNNGSKRLKRSLQRKKKKFIETSAERNGRPHKKR 370

Query: 315 SKPEGTFKRWLLWGVSISLGIGAGXXXXXXXXXXXXXXXXFNFRHTDHTLXXXXXXXXXX 374
              E    RW+LWGVS++LG+G G                      D             
Sbjct: 371 HNNE-KVNRWVLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDR 429

Query: 375 XXXXXPSGIDHDADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDR-----SQEWH 429
                    + D DS     H L + K +LK+    VKQ + +    ++R       EW 
Sbjct: 430 QELKLG---EMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWP 486

Query: 430 LHD--PNRFLQLGYAVI 444
             D   NR L LGY ++
Sbjct: 487 TSDEHTNRVLALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score =  123 bits (308), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 119/485 (24%), Positives = 201/485 (41%), Gaps = 72/485 (14%)

Query: 7   SVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDELSAM-----E 61
           S+LDPHLSVLELLE++ +          + +       +S SW  + R++  AM     E
Sbjct: 30  SLLDPHLSVLELLERTGDTQRVGRGVEKADDMANTTNSISSSWQAIHRND--AMITGVPE 87

Query: 62  RSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXV------------ADTRMARPAMSL 109
           R +SQ    G+LSSSDT                                D  +  PA   
Sbjct: 88  RCSSQAAAVGILSSSDTSEEEIDPASSPNVAHFTQFHQSQQPPRLPFKLDVPVILPARDQ 147

Query: 110 QSTSSTLDGVDDDX---XXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCFKVAV 166
           + +  T    +DD                 F+MPKL           S + ++   ++ +
Sbjct: 148 EPSGQTQTPDNDDERDDETLTKSLSNSSNSFVMPKL-----------SLSQKSHKLRILI 196

Query: 167 LGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVVQEVRELISLLNRVHCAC 226
           LGR  +KF Q ++P++++H FEL+  + D ++     GILIV QE++E++SLLNRV C C
Sbjct: 197 LGRPGLKFYQ-SIPKRYQHFFELSR-LQDPSEFRQFTGILIVFQELKEMVSLLNRV-CQC 253

Query: 227 -PEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLAR-- 283
            P  PV+ V    +  QV+NVL +  + +            N+  L+ M+ F+ +L++  
Sbjct: 254 APTRPVIPVCQTGQHQQVRNVLESLLKSKLISLLYPPVVISNHSDLNNMYRFLLDLSKTI 313

Query: 284 ------------QQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSI 331
                       ++     I    Q  +++   +++ D  R     E    +W++WG+S+
Sbjct: 314 SDNSEDDEDEEERELLDKKIKKSHQRKKKRAGSYDKTDKPRKRRSKETKINKWIVWGISL 373

Query: 332 SLGIGAGXXXXXXXXXXXXXXXXFNF------RHTDHTLXXXXXXXXXXXXXXXPSGIDH 385
           ++G+G G                 +       R  D+ +                   ++
Sbjct: 374 TVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG---------EY 424

Query: 386 DADSHTTLRHCLSIVKNSLKRATAFVKQAMHKPFHYIDRS-----QEWHLHD-PNRFLQL 439
           D D      H L ++K +LK+    +KQ + K  H  + S     +EW   D  NR L L
Sbjct: 425 DHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNRVLAL 484

Query: 440 GYAVI 444
           GY ++
Sbjct: 485 GYILL 489

>Skud_9.22 Chr9 complement(51263..52876) [1614 bp, 537 aa] {ON}
           YIL146C (REAL)
          Length = 537

 Score =  112 bits (281), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 118/520 (22%), Positives = 199/520 (38%), Gaps = 94/520 (18%)

Query: 2   SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ--------LSESWCTVE 53
           +G    +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  + 
Sbjct: 35  AGEDKGLLDPHLSVLELLGKT----GHSPSPMGHSLVTSIDISSHHYVNDSISGSWQAIH 90

Query: 54  RDELSAM---ERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVAD-------TRMA 103
             +L A    ERS+SQ TN  +LSSSDT                  +         T  +
Sbjct: 91  PLDLGASFVPERSSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGASVTSPS 150

Query: 104 RP--------AMSLQSTSSTLDG-----------------VDDDXXXXXXXXXXXXXXFI 138
           RP        ++ L +   T  G                  ++D              F+
Sbjct: 151 RPFRQLHKVISLPLPAKGRTSYGEQDDDDNNVDDDYDDGAYEEDSGTITKSLTSSTNSFV 210

Query: 139 MPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQ 198
           MPKL           S + +   F++ +LGR    F Q ++P++ +  FEL    HD   
Sbjct: 211 MPKL-----------SLSQKNPVFRLLILGRTGSNFYQ-SIPKEHQSLFELPK-YHDSTA 257

Query: 199 CADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXX 258
                GI+I+ QE+RE++SLLNR+       P++ +    + +QVKNVL++F R +    
Sbjct: 258 FPQYTGIIIIFQELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKL 317

Query: 259 XXXXXXXXNNEALDKMFHFVDNLARQ----------QEPAGVIHNDPQT-----TQEQHP 303
                   N   L KMF  + +L+ +               +IH + ++           
Sbjct: 318 LYPPVVVTNRRDLKKMFQRLQDLSLEYAEDGDNDDEDNDDEIIHTNSRSYYRNKKANSSK 377

Query: 304 DHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAG--XXXXXXXXXXXXXXXXFN----- 356
             +     +   K + +  RW  WGVSI++GI  G                  FN     
Sbjct: 378 KKSFKSNKKPKKKKQRSLTRWFTWGVSITIGISFGCCVTYFATAAYDHQTGKSFNLRSSI 437

Query: 357 ---------FRHTDHTLXXXXXXXXXXXXXXXPSGIDHDADSHTTLRHCLSIVKNSLKRA 407
                    +  T +T                   +  +  S   +   L+++K++  + 
Sbjct: 438 LTSLLSLDSYHDTVNTPATTSTSSGEQFLWFDKGTLQINFHSDGFIMKSLTVIKDTWSKM 497

Query: 408 TAFVKQAMHKPFHYID---RSQEWHLHDPNRFLQLGYAVI 444
             FV  A+ +P ++++   ++ ++ L + NR L LGY ++
Sbjct: 498 NVFVLNALSRPLNFLENLNKNSDFSLDESNRILALGYILL 537

>Smik_9.23 Chr9 complement(51874..53457) [1584 bp, 527 aa] {ON}
           YIL146C (REAL)
          Length = 527

 Score =  107 bits (268), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 116/504 (23%), Positives = 190/504 (37%), Gaps = 84/504 (16%)

Query: 8   VLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ--------LSESWCTVERDELSA 59
           +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  ++  +L A
Sbjct: 41  LLDPHLSVLELLGKT----GHSPSPMGQSLVTSIDISGHQNVNDSISGSWQAIQPLDLGA 96

Query: 60  M---ERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTR--------------- 101
               ER +SQ TN  +LSSSDT                  +   +               
Sbjct: 97  SFIPERCSSQTTNGSILSSSDTSEEEQELLQAPAADIINIIKQGQEGTNVTSSSHPFRQL 156

Query: 102 ---MARPAMSLQSTSSTLDGVDDD--------XXXXXXXXXXXXXXFIMPKLYTTVAGAP 150
              ++ P  S + T      ++DD                      F+MPKL        
Sbjct: 157 HKVISLPIPSREKTPYKEQDINDDEDGAYEEDSVTITKSLTSSTNSFVMPKL-------- 208

Query: 151 STVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGILIVVQ 210
              S + +   F++ +LGR    F Q ++P++++  FEL    HD A      GI+I+ Q
Sbjct: 209 ---SLSQKNPVFRLLILGRTGSNFYQ-SIPKEYQSLFEL-PKYHDSATFPQYTGIIIIFQ 263

Query: 211 EVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEA 270
           E+RE++SLLNR+       P++ +    + +QVKNVL++F R +            N + 
Sbjct: 264 ELREMVSLLNRIVQYSQGKPIIPICQPGQTIQVKNVLKSFLRNKLIKLLFPPVVVTNRKD 323

Query: 271 LDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGP-----------SKPEG 319
           L KMF  + +L+ +         D   T +    +     +               K + 
Sbjct: 324 LKKMFQRLQDLSLEYAEDENEEGDDDETTKSRSYYRYKKANNSKRKSPKSNKKPKKKKQR 383

Query: 320 TFKRWLLWGVSISLGIGAGXXXXXXXXXXXXXXXXFNFRHTDHTLXXXXXXXXXXXXXXX 379
            F  W  WG+SI++GI  G                 +       L               
Sbjct: 384 FFTSWFTWGISITIGISFGCCVTYFVTAAYDHQTVKSLSLRSSLLTSMLSLDSSSDTVNT 443

Query: 380 PSGIDHDADSHT------TLR---HCLSIVKNSLK-------RATAFVKQAMHKPFHYID 423
           P+     +  H       TL+   H   ++  SL        +   FV  A+ +P  +++
Sbjct: 444 PATASPSSSEHFLWFDKGTLQINFHLDGLIMKSLSVIKETWVKMNDFVLHALSRPLSFLE 503

Query: 424 ---RSQEWHLHDPNRFLQLGYAVI 444
              RS ++ + + NR L LGY ++
Sbjct: 504 NLNRSSDFSIDESNRILALGYILL 527

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 76/341 (22%), Positives = 141/341 (41%), Gaps = 41/341 (12%)

Query: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196
           FIMP+L  T           L    F++ ++GR + K  +  +P +F++ F+L    +D+
Sbjct: 224 FIMPRLSLT-----KKERQQLNANEFRILIVGRLSSKLFK-MIPHKFQNLFQLQKS-YDI 276

Query: 197 AQCADRQGILIVVQEVRELISLLNRV-HCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRX 255
            +      IL+V+QE RELISLLNR+      + P++A+ ++D  +Q KNVL+++ R   
Sbjct: 277 NEYQKFTAILVVIQETRELISLLNRISRSEKVKRPLIAICEKDAFLQCKNVLKSYLRNDL 336

Query: 256 XXXXXXXXXXXNNEALDKMFHFVDNLA--------------RQQEPAGVIHNDPQTTQ-E 300
                      N E LD+M  F+   +              +++ P     N P ++   
Sbjct: 337 ITLLYQPFVISNTEELDRMLVFLKETSIKFYEQAYNPKIQIKEKVPNDGNRNAPTSSDLT 396

Query: 301 QHPDHNEDDPHRGPS---------------KPEGT--FKRWLLWGVSISLGIGAGXXXXX 343
              D  ++D HR                  KP+    + +W++WG+S+S+G+G G     
Sbjct: 397 LSKDRVKNDKHRHTKGDGSGGSKKGNEHDRKPKENEEYNKWIIWGISLSIGVGIGYCISY 456

Query: 344 XXXXXXXXXXXFNFRHTDHTLXXXXXXXXXXXXXXXPSGIDHDADSHTTLRHCLSIVKNS 403
                      + F     ++                   D+D+++       ++ +K S
Sbjct: 457 FGSSPWSSLVQY-FNPESDSISATVPVPLSNESFVLLHDSDNDSETKKYFFKSINFLKYS 515

Query: 404 LKRATAFVKQAMHKPFHYIDRSQEWHLHDPNRFLQLGYAVI 444
           + +    +K  + KP +        +  D +  L LGY +I
Sbjct: 516 INKVKVIIKDTIRKPLNAFSYLNGLNTDDASSLLALGYILI 556

 Score = 37.4 bits (85), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 44/95 (46%), Gaps = 28/95 (29%)

Query: 5   ANSVLDPHLSVLELLEKSCER-----------------------GGHAEAPGSSRNKGAG 41
            NS+LDPHLSVLELLE+  +                          ++EA G S     G
Sbjct: 27  TNSILDPHLSVLELLERGFQNVHEQDDTIMSTTPRDIAVEMATVRLNSEASGVS-TPSVG 85

Query: 42  QIQLSESWCTVERDELSAMERSASQQTNNGVLSSS 76
            I +S+SW T++R +L   E S    +N  VL S+
Sbjct: 86  DI-ISQSWHTIQRRDL---EESLHNNSNKLVLQSA 116

>Suva_9.43 Chr9
           complement(68866..68940,68994..69068,69093..69122,
           69126..70484) [1539 bp, 513 aa] {ON} YIL146C (REAL)
          Length = 513

 Score = 95.9 bits (237), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 99/390 (25%), Positives = 152/390 (38%), Gaps = 76/390 (19%)

Query: 8   VLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQI--------QLSESWCTVERDELSA 59
           +LDPHLSVLELL K+    G + +P       +  I         +S SW T++  +L A
Sbjct: 41  LLDPHLSVLELLGKT----GSSPSPLGQSLVTSIDISNHHNVIDNISGSWQTIQPLDLGA 96

Query: 60  M---ERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVAD-------TRMARPAMSL 109
               ER +SQ TN  +LSSSDT                  +         T  + P   L
Sbjct: 97  SFIPERCSSQTTNGSILSSSDTSEEEQDLLQAPAADIINIIKQGQDGTSVTSPSHPFKQL 156

Query: 110 QSTSST------------------LDGVDD------DXXXXXXXXXXXXXXFIMPKLYTT 145
            +  S                   +D  DD      D              F+MPKL   
Sbjct: 157 HTVISLPMPPRERTFYGEQEDVVCIDNDDDNGMYEEDSVTITKSLTSSTNSFVMPKL--- 213

Query: 146 VAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQGI 205
                   S + +   F++ +LGR    F Q T P++++  FEL    HD        GI
Sbjct: 214 --------SLSRKNPVFRLLILGRTGTNFYQST-PKEYQSLFELPKS-HDSTIFPQYTGI 263

Query: 206 LIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXX 265
           +IV QE+RE++SLLNR+       P++ +    + +QVKNVL++F +             
Sbjct: 264 VIVFQELREMVSLLNRIVEYAQGKPIIPICQPGQTIQVKNVLKSFLKNSLIKLLYPPVVA 323

Query: 266 XNNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHR------------- 312
            N + L KMF  + +L+ +        ++ +   ++         +R             
Sbjct: 324 TNRKDLKKMFQRLQDLSLEYVEDEKNEDEDEDNDDEIIQPYSRSYYRSKKGGSSKKKSSK 383

Query: 313 ----GPSKPEGTFKRWLLWGVSISLGIGAG 338
                  K + +  RW  WGVSI++GI  G
Sbjct: 384 SNKKSKKKKQRSSTRWFTWGVSITIGISFG 413

>YIL146C Chr9 complement(74184..75773) [1590 bp, 529 aa] {ON}
           ATG32Mitochondrial outer membrane protein required to
           initiate mitophagy; recruits the autophagy adaptor
           protein Atg11p and the ubiquitin-like protein Atg8p to
           the mitochondrial surface to initiate mitophagy, the
           selective vacuolar degradation of mitochondria in
           response to starvation; can promote pexophagy when
           placed ectopically in the peroxisomal membrane
          Length = 529

 Score = 94.4 bits (233), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 134/340 (39%), Gaps = 45/340 (13%)

Query: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196
           F+MPKL           S   +   F++ +LGR    F Q ++P++++  FEL    HD 
Sbjct: 203 FVMPKL-----------SLTQKNPVFRLLILGRTGSSFYQ-SIPKEYQSLFEL-PKYHDS 249

Query: 197 AQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXX 256
           A      GI+I+ QE+RE++SLLNR+       PV+ +    + +QVKNVL++F R +  
Sbjct: 250 ATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVLKSFLRNKLV 309

Query: 257 XXXXXXXXXXNNEALDKMFHFVDNLARQQ-EPAGVIHNDPQTTQEQHPDHNEDDPHRGPS 315
                     N   L KMF  + +L+ +  E      ND +    +   +  +       
Sbjct: 310 KLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYCRNKKAENSK 369

Query: 316 KPEGT------------FKRWLLWGVSISLGI--GAGXXXXXXXXXXXXXXXXFNFR--- 358
           K                F  W  WG+SI++GI  G                   + R   
Sbjct: 370 KKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTVKSLSLRPSI 429

Query: 359 -----------HTDHTLXXXXXXXXXXXXXXXPSGIDHDADSHTTLRHCLSIVKNSLKRA 407
                       T +T                   +  +  S   +   L+I+K +  + 
Sbjct: 430 LASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLTIIKETWGKM 489

Query: 408 TAFVKQAMHKPFHYID---RSQEWHLHDPNRFLQLGYAVI 444
             FV  A+ KP  +++   +S E+ + + NR L LGY ++
Sbjct: 490 NTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL 529

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/88 (38%), Positives = 46/88 (52%), Gaps = 15/88 (17%)

Query: 2   SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQI--------QLSESWCTVE 53
           +G    +LDPHLSVLELL K+    GH+ +P       +  I         +S SW  ++
Sbjct: 35  TGEDKGLLDPHLSVLELLSKT----GHSPSPMGQNLVTSIDISGNHNVNDSISGSWQAIQ 90

Query: 54  RDELSAM---ERSASQQTNNGVLSSSDT 78
             +L A    ER +SQ TN  +LSSSDT
Sbjct: 91  PLDLGASFIPERCSSQTTNGSILSSSDT 118

>CAGL0H06545g Chr8 (643447..644925) [1479 bp, 492 aa] {ON} similar
           to uniprot|P40458 Saccharomyces cerevisiae YIL146c ECM37
          Length = 492

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/208 (25%), Positives = 108/208 (51%), Gaps = 20/208 (9%)

Query: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196
           F+MPKL  T    PS        +  K+ V+GR + +F Q+ +P ++R  F ++    D 
Sbjct: 195 FVMPKLSLTYK--PS--------QAKKLLVVGRLSKRFHQD-IPREYRQYFHISQS-SDP 242

Query: 197 AQCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXX 256
           ++  +  GI+IV QE++E +++LNR+     + P++ +    ++++VKN+L++F +    
Sbjct: 243 SEFQNYIGIVIVFQELKEFVAMLNRIVQYTDKKPIIPICQPGQRIRVKNILKSFLKNDAI 302

Query: 257 XXXXXXXXXXNNEALDKMF----HFVDNLARQQEPAGVIHNDPQTTQEQ--HPDHNEDDP 310
                     N ++++K+F      V+ L  +++   +  +D   + E   +  +N    
Sbjct: 303 TLWYPPVTIANEKSMEKLFKHTVKLVNKLENEEDVLSLSTSDKSLSDETSGYRKNNRRKK 362

Query: 311 HRGPSKPEGTFKRWLLWGVSISLGIGAG 338
           H G  KP   + +W+ WG+S+++G+  G
Sbjct: 363 HGG--KPSTNYSKWITWGISLTIGVSIG 388

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 37/73 (50%), Gaps = 11/73 (15%)

Query: 2  SGHANSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTV-ERDELSAM 60
          +G  +S+LDPH SV+ELL++  E    +E P  S   G     L ESW  + E D     
Sbjct: 23 NGPESSILDPHHSVMELLQRQME---GSEVPSES---GV----LGESWQQIRESDVGDGG 72

Query: 61 ERSASQQTNNGVL 73
          + +  QQ+N   +
Sbjct: 73 DSNFDQQSNTSAI 85

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 77.0 bits (188), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/358 (20%), Positives = 145/358 (40%), Gaps = 50/358 (13%)

Query: 6   NSVLDPHLSVLELLEK-------SCERGGHAEAPGSSRNKGAGQIQ--LSESWCTVERDE 56
           NS+LDPHLSVL+LL++       S  + G    P + R  G   +   +SESW +++  +
Sbjct: 38  NSILDPHLSVLQLLDRADPPSELSSLKHGEIAKPATPRRSGFESVNCSISESWQSIKHTD 97

Query: 57  LSAMERSA-SQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTRMARPAMSLQSTSST 115
            S +     +   + G+LSSSDT                          P       +S+
Sbjct: 98  CSMVNTQGDATHQHAGILSSSDTSEDEPDAQLSPSPNNFAFPNSATSIFPEAPHNLEASS 157

Query: 116 LDGV----------DDDXXXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCFKVA 165
           L             ++D              F+MPKL           S   Q++ F + 
Sbjct: 158 LREYQNSEIANPREENDNETVTMSLMNSSNSFVMPKL-----------SLIQQSQKFCIL 206

Query: 166 VLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADRQ-----GILIVVQEVRELISLLN 220
           ++G+ A +F ++ +P  +   FE    V D+   + R+      ++++  E +E   LL 
Sbjct: 207 IVGKPAQRFYRD-IPRAYHKMFE----VRDVGHLSPREMNKYSAVMVIFGEPKEGKELLE 261

Query: 221 RVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDN 280
           +V  A     ++AV  R +Q Q+ N+L  +++              +++ + ++  +++ 
Sbjct: 262 KV--AAHNSNIIAVCQRGQQQQISNILNRYSKSNEIRLVYHLTVMSDHQDVHRLLRYLNT 319

Query: 281 LARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAG 338
           L+ + +           T+       +         P+ T  RW++W +S+++G+G G
Sbjct: 320 LSTEVDSG-------YETEVGSRKIRKRRKSSKKRSPQITVNRWVIWSISLTVGVGLG 370

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 78/371 (21%), Positives = 151/371 (40%), Gaps = 59/371 (15%)

Query: 1   MSGHANSVLDPHLSVLELLEKS-CERGGHAEAPGS-----------------SRNKGAGQ 42
           M     S+LDPH SVL+LLE++ CE+        S                  R   A  
Sbjct: 24  MPFQKRSILDPHFSVLQLLERNGCEQEEDVNQASSQIPVELKSAFNRPLSPHKRYPEALN 83

Query: 43  IQLSESWCTVERDELSAM----ERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVA 98
             +S+SW +++  + S +    + S+SQ    G+LSSSDT                    
Sbjct: 84  QSISDSWQSIKMVDYSILNSLHDTSSSQAV--GILSSSDTSEEELDHLNSPSPSSQQVFP 141

Query: 99  DTRMARPAMSLQSTSSTLD--------GV--DDDXXXXXXXXXXXXXXFIMPKLYTTVAG 148
           +     P +S Q+ +  L         GV  +DD              F+MP+L      
Sbjct: 142 NG----PPISFQTQAGVLTASATLPNPGVLEEDDNETVTVSLAASSNSFVMPQL------ 191

Query: 149 APSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLA-QCADRQGILI 207
                S + ++  F++ V+G+ A KF    VP+ ++  F++       A + +    ++I
Sbjct: 192 -----SLSQRSHRFEILVVGKPARKFWN-NVPKMYQKMFDIGDFESISAPKVSHYTAVMI 245

Query: 208 VVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXN 267
           + Q+ +E+  +L+ +        ++ +  R ++ Q+ ++L  F + +            N
Sbjct: 246 IFQDTKEVSFILDSLVTKLDGKAIIPICQRGQKQQLASLLEPFVKAKKIRLMFQPTVMSN 305

Query: 268 NEALDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLW 327
           ++ + K+  ++  L+ + +           T E H    +          +GT  RW++W
Sbjct: 306 HQEIHKLLRYLHRLSTEIDSG-------YETDETHLKVRKRKKTHKKKS-KGTSNRWVIW 357

Query: 328 GVSISLGIGAG 338
           G+S+++G+G G
Sbjct: 358 GLSLTVGVGIG 368

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score = 65.9 bits (159), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 99/430 (23%), Positives = 166/430 (38%), Gaps = 60/430 (13%)

Query: 7   SVLDPHLSVLELLE-KSCER-GGHAEAPGSSRNKGAGQIQ--------LSESWCTVERDE 56
           S+LDPHLSVLE+LE K   +  G  E  G+SR  G  Q +        +SESW +++  +
Sbjct: 26  SILDPHLSVLEILEGKELNKVEGPHELSGASRVSGK-QFEGERVLHHSISESWQSIKSTD 84

Query: 57  LSAMER----SASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVA-DTRMARPAMSLQS 111
              + R    S  QQ+  G+LSSSDT                   A D+R+   A   Q+
Sbjct: 85  YLFLSRANDTSLQQQSAVGILSSSDTSEEEQDIHPSPPPPNSASSAFDSRIINIAG--QA 142

Query: 112 TSSTLDGV-----DDDXXXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCF--KV 164
            S+TL  +     DDD               +MPKL             +L  R    KV
Sbjct: 143 FSATLSHLRSEDEDDDGETVTVSLPNTMTSLVMPKL-------------SLSDRIIESKV 189

Query: 165 AVLGRGAVKFCQETVPEQFRHRFELTA--GVHDLAQCADRQGILIVVQEVRELISLLNRV 222
            ++G+ A KF   ++P+ ++  FE+ +   + D         I+++  ++     LL+R+
Sbjct: 190 LIVGQPARKFWF-SIPKSYQKMFEICSLSVLRDKDVDEKYSTIMVIFHDMGLAPELLDRI 248

Query: 223 HCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLA 282
                   ++ +  + ++  + ++L+ +                N+    ++   +  L+
Sbjct: 249 CNKVVRPRIIPICQKGQKQHLSSLLKQYVSGNRIKLFCNPIVMSNHHEKHRLLKHLHQLS 308

Query: 283 RQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPSKPEGTFKRWLLWGVSISLGIGAGXXXX 342
              +       + + T E           R PSKP  TF+ W++W  SI++GIG G    
Sbjct: 309 SGSDSG----YETEVTVEPVKKLPRKAKKR-PSKP-STFRDWVVWTASITIGIGIGCCVS 362

Query: 343 XXXXXXXXXXXXFNFRHTDHTLXXXXXXXXXXXXXXXPSGIDHDADSHTTLRHCLSIVKN 402
                             D T                P G   D  SH    H  S+ K 
Sbjct: 363 LMVSTRYAFLVPRQLAVDDIT-----------SSPLSPEGT--DKSSHNLFLHAYSLCKT 409

Query: 403 SLKRATAFVK 412
           SLK+  + ++
Sbjct: 410 SLKKLASSLR 419

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 76/369 (20%), Positives = 143/369 (38%), Gaps = 70/369 (18%)

Query: 6   NSVLDPHLSVLELLEKS-----CERGGHAEAPGS-----SRNKGAGQIQLSESWCTVERD 55
           NS+LDPHLSVL+LLE++      +   H++ P       S ++  G+  +S+SW ++   
Sbjct: 29  NSILDPHLSVLQLLERNEVHSEPQEFRHSDIPSPHLLSRSSSEPMGR-SISDSWQSIRHT 87

Query: 56  ELSAMER-SASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTRMARPAMSLQSTSS 114
           + S +     +     G+LSSSDT                      +   P  S      
Sbjct: 88  DYSILNLIGETSHQPAGILSSSDTSEDEPDHFLSPSPNEYAFANGAKTVFPEASHAPEGP 147

Query: 115 TL----DGV--------DDDXXXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCF 162
           +L    D V        D+D              F+MPKL           S A   R F
Sbjct: 148 SLATLQDSVYEHSNVAEDNDNETVTLSLINSSNSFVMPKL-----------SLAQPLRKF 196

Query: 163 KVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDLAQCADR-QGILIVVQEVRELISLLNR 221
            + ++G+ A +F ++ +P  ++  FE+        +  D+   I+++  + +   SLL  
Sbjct: 197 SILIVGKPAQRFYRD-IPRAYQKMFEVCDAESFKTRDVDQFSAIMVIFTDPKNGQSLLEM 255

Query: 222 VHCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNL 281
           V      +  +AV  R +Q Q+ N+L  F++              +++ + ++  ++  L
Sbjct: 256 VTGRSSNI--IAVCQRGQQQQISNLLNRFSKTHHLRLIYHLTVMSDHQDVHRLLRYLYTL 313

Query: 282 ARQQEPAGVIHNDPQTTQEQHPDHNEDDPHRGPS------------KPEGTFKRWLLWGV 329
           + + +                   +E D   GP             +      RW++W +
Sbjct: 314 SNEID-------------------SEYDTEVGPRKVRKRRKSYKKRETPAAVNRWVIWSI 354

Query: 330 SISLGIGAG 338
           S+++G+G G
Sbjct: 355 SLTVGVGIG 363

>AFR283W Chr6 (945526..946884) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL146C (ECM37)
          Length = 452

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 71/348 (20%), Positives = 134/348 (38%), Gaps = 41/348 (11%)

Query: 6   NSVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQ------LSESWCTVERDE--- 56
             +LDPHLSVLE+L++    G      G+    G  +++      +SESW  ++R +   
Sbjct: 29  KGILDPHLSVLEMLDRQDGDGAGQVEEGAVMTVGKRRVERSLHHSISESWQAIKRSDYSF 88

Query: 57  LSAMERSASQQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTRMARPAMSLQSTSSTL 116
           LS      +  ++ G+LSSSDT                     + +A P   L       
Sbjct: 89  LSGTHEVGAMHSSVGILSSSDTSEEEAEMRPSAHGTVHL---GSSLASPMRQLLVEEDNS 145

Query: 117 DGVDDDXXXXXXXXXXXXXXFIMPKL-YTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFC 175
              +DD               +MPKL  +   G P            ++ ++G+ A KF 
Sbjct: 146 CAEEDDCQTVTISMPSSSTSLVMPKLSLSQRLGEP------------QLLLVGQPARKFW 193

Query: 176 QETVPEQFRHRFEL-TAGVHDLAQCADRQ-GILIVVQEVRELISLLNRVHCACPEVPVVA 233
             T+P+ ++  F++   G+        R   +++V  ++ +   LL+ +    P   V+ 
Sbjct: 194 L-TIPKCYQKLFDVKNLGMVTRWDVGQRYLAVMVVFHDIAQAPELLDGLCEKAPCPTVIP 252

Query: 234 VYDRDRQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLARQQEPAGVIHN 293
           V  + ++  +  +L+ +T ++            N+    ++   + NL           N
Sbjct: 253 VCQKGQKSTLAALLKRYTARKCIRVYCSPIIMSNHHEKHRLLKHLHNLC----------N 302

Query: 294 DPQTTQEQHPDHNEDDPHRGPSKPEG---TFKRWLLWGVSISLGIGAG 338
           + ++  E          HR P K +      + W +W  S ++GIG G
Sbjct: 303 ESESGYETELTVKSKKQHRRPRKKDAGPVALRHWAIWTASFTIGIGIG 350

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 81/382 (21%), Positives = 144/382 (37%), Gaps = 72/382 (18%)

Query: 7   SVLDPHLSVLELLEKSCERGGHAEAPGSSRNKGAGQIQLSESWCTVERDELSAMERSA-S 65
           S+LDPHLSVLE+LE+   +        SSR        +S SW  +E    S    SA S
Sbjct: 37  SLLDPHLSVLEMLER---KDNDTVMEASSR--------ISRSWQNIESPADSKQLLSAKS 85

Query: 66  QQTNNGVLSSSDTXXXXXXXXXXXXXXXXXXVADTR-----------MARPAMSLQSTSS 114
            Q +N V   S +                     ++           +  P  +  +   
Sbjct: 86  SQVSNLVSILSSSSDTSDEEVDRINSLNSAGEGSSKNYNNPSPLQNPIYLPEFTDVTAGD 145

Query: 115 TLDGVDDDXXXXXXXXXXXXXXFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKF 174
             DG+                 F+MP          S  S+  Q R F++ + GR    F
Sbjct: 146 NDDGIASTITKSLTSSSTISNSFVMP--------TLSLSSSQSQQRKFQILIFGRLGPSF 197

Query: 175 CQETVPEQFRHRFELTAGVHDLA--QCADRQGILIVVQEVRELISLLNRVHCACPEVPVV 232
            + T+P+Q+++ F +   ++ L   +  +    LI+ +E++EL+SLLNR+        V 
Sbjct: 198 YR-TIPKQYQYLFHVPNQLNTLTRNEMDNFTAFLIIFEELKELVSLLNRISEELSFKKVP 256

Query: 233 AVYDRD----RQVQVKNVLRNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLAR----- 283
                     ++++VK++L+ F +              +  AL KMF  + ++++     
Sbjct: 257 PPIIPICQPGQKIKVKSILKYFLKNNFVTLLSPIIIINDERALLKMFKTMQSISKTVISA 316

Query: 284 -------------QQEPA---GVIHNDPQTTQEQHPDHNEDDPHRGP----------SKP 317
                          +P+    VI  D +T +E      +    +            S  
Sbjct: 317 SSSTTSSDNEEEESSDPSMNDKVI--DVKTIKESMMSSQKKKNKKKHHNNRRKEHVRSSS 374

Query: 318 EGTFK-RWLLWGVSISLGIGAG 338
              FK +W++W +S+++G G G
Sbjct: 375 TSFFKNKWVVWSISLTVGAGMG 396

>TBLA0E02090 Chr5 (508537..510786) [2250 bp, 749 aa] {ON} Anc_5.699
           YIL146C
          Length = 749

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/151 (20%), Positives = 70/151 (46%), Gaps = 13/151 (8%)

Query: 137 FIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELTAGVHDL 196
           FIMPKL  T              R F++ +LG        + +P  +++ FEL     D 
Sbjct: 336 FIMPKLSWTNTF-----------RKFRILILGSNQNLTFYQNIPTSYKYLFELPPNNFDY 384

Query: 197 AQCADRQGILIVVQEVRELISLLNRV-HCACPEVPVVAVYDRDRQVQVKNVLRNFTRQRX 255
                  GI IV+ ++ +  S+LN++   +  + P++ + ++ +  +VKN+L+ + + + 
Sbjct: 385 -NFKHYAGIAIVIHDLTDFKSILNKIDKYSMNKKPIIPICEKGQINEVKNILKPYIKTKD 443

Query: 256 XXXXXXXXXXXNNEALDKMFHFVDNLARQQE 286
                      N + ++ ++  +++L++  E
Sbjct: 444 LSLLYPPIVGTNRDGMNTLYLHLNDLSKNVE 474

>KLLA0A00660g Chr1 complement(64397..65971) [1575 bp, 524 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 524

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 77/398 (19%), Positives = 134/398 (33%), Gaps = 94/398 (23%)

Query: 7   SVLDPHLSVLELL--EKSC-------ERGGHAEAPGSSRNKGAGQIQ-------LSESWC 50
           S+LDPH SV++LL  ++SC       +     +  G S N     I        L++SW 
Sbjct: 40  SILDPHDSVMDLLNGQQSCAFDSRLIQNQDLIDRKGKSNNIDHNDINTHTHSKGLTDSWQ 99

Query: 51  TVERDELSAMERSASQQTNN-----------GVLSSSDTXXXXXXXXXXXXXXXXXXVAD 99
            ++RDE S +        +N           GVLSS  +                    +
Sbjct: 100 AIDRDEYSFLNAGNHNNYHNTSNGDFNQQFGGVLSSDTSEEEVEINAAPSPNLSASQQHN 159

Query: 100 TRMARPAMSL----QSTSSTL-----DG--------------------VDDDXXXXXXXX 130
             +A P  S     Q  S T      DG                     +D+        
Sbjct: 160 QFLAYPLSSTGFGDQGNSETTVHQFSDGDPVKSTKTGQFSKAELGAGTGEDETIMVNLGH 219

Query: 131 XXXXXXFIMPKLYTTVAGAPSTVSTALQTRCFKVAVLGRGAVKFCQETVPEQFRHRFELT 190
                 F+MPKL           S +   + FK+ +L  G           ++ HR    
Sbjct: 220 SWAGSFFVMPKL-----------SLSESMKRFKILILSDGDSANSFYNRLSRY-HRLMFD 267

Query: 191 AGVHDLA---QCADRQGILIVVQEVRELISLLNRVHCACPEVPVVAVYDRDRQVQVKNVL 247
            G  + A   +       +I+  + +++ ++LNR+     +  ++ +  + ++  V   +
Sbjct: 268 VGKLNEASKEEALKYTAFMIIFSDSKKVTTILNRMWKKYGDFTLIPICQKGQKQSVTEKV 327

Query: 248 RNFTRQRXXXXXXXXXXXXNNEALDKMFHFVDNLARQQEPAGVIHNDPQTTQEQHPDHNE 307
           + F                 N    K+  +   ++   E  G++ +      E   D+  
Sbjct: 328 KTFA----------------NSNKIKLMSYPVVISDHYEIHGLLRHLHSLYVEVDSDYET 371

Query: 308 D-----DPHRGPSKPEG--TFKRWLLWGVSISLGIGAG 338
           D      P +G  K       KRW  W +SI+LG+G G
Sbjct: 372 DIPKKTKPRKGAKKKPAPHLAKRWWFWPISIALGVGIG 409

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.132    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 37,233,538
Number of extensions: 1301625
Number of successful extensions: 3019
Number of sequences better than 10.0: 17
Number of HSP's gapped: 3034
Number of HSP's successfully gapped: 33
Length of query: 444
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 331
Effective length of database: 40,524,141
Effective search space: 13413490671
Effective search space used: 13413490671
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)