Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L009507.127ON46146124600.0
KAFR0L004707.127ON46546819590.0
Smik_6.4667.127ON47648019260.0
YPL259C (APM1)7.127ON47548019230.0
Suva_16.457.127ON47848019200.0
ZYRO0C05236g7.127ON44746118980.0
Skud_16.197.127ON47648118970.0
TDEL0H028907.127ON44246118880.0
TBLA0A009507.127ON46946818690.0
Kpol_1062.567.127ON45045918480.0
SAKL0F05346g7.127ON44746118470.0
NCAS0E021407.127ON48146018500.0
TPHA0C043207.127ON45446418450.0
NDAI0E036807.127ON44446118270.0
CAGL0K00539g7.127ON45646318210.0
Kwal_55.208437.127ON44146018120.0
KLTH0F12584g7.127ON44146017990.0
ADL017C7.127ON44346017860.0
Ecym_83507.127ON44546017720.0
KLLA0D14311g7.127ON44346017700.0
Ecym_52393.165ON4644795712e-67
KLTH0F06534g3.165ON4664895476e-64
KLLA0C03894g3.165ON4754935372e-62
Kwal_33.141823.165ON4674905206e-60
NDAI0G029203.165ON4865045131e-58
SAKL0C07414g3.165ON4825005121e-58
NCAS0C035803.165ON4915035131e-58
CAGL0C05203g3.165ON4754984953e-56
SAKL0D13090g2.555ON4995364955e-56
TDEL0D045803.165ON4825024797e-54
Kpol_1045.443.165ON4694954742e-53
ABR047W2.555ON4984824763e-53
YOL062C (APM4)3.165ON4915104721e-52
Kwal_26.81462.555ON5055514721e-52
ADR315W3.165ON4923694641e-51
ZYRO0B04840g3.165ON4764964612e-51
Smik_15.963.165ON4915044623e-51
Skud_15.913.165ON4915074562e-50
KLTH0D07502g2.555ON5045454562e-50
Suva_15.1033.165ON4915064519e-50
TPHA0P006603.165ON4734334473e-49
TBLA0F008403.165ON4815024351e-47
KLLA0F25432g2.555ON5075534142e-44
TDEL0B064302.555ON5255644119e-44
Ecym_45912.555ON5015004021e-42
KNAG0K011503.165ON4744893949e-42
TPHA0I023902.555ON5596003891e-40
KAFR0A020602.555ON5405863811e-39
Kpol_1056.132.555ON5415783705e-38
ZYRO0E05874g2.555ON5493493344e-33
Skud_8.262.555ON5963773188e-31
NCAS0A126502.555ON5883773161e-30
CAGL0K03223g2.555ON5983833133e-30
Smik_8.232.555ON6033583124e-30
KAFR0C010203.165ON4284733032e-29
KNAG0C055502.555ON5823633036e-29
Suva_8.332.555ON5963793029e-29
YHL019C (APM2)2.555ON6053663012e-28
TBLA0B067602.555ON6572512203e-18
NDAI0B016102.555ON6722741892e-14
SAKL0A09218g2.522ON4732841605e-11
TDEL0A029702.522ON4963391571e-10
AGL061W2.522ON4114101462e-09
TPHA0C041302.522ON5331811429e-09
KLTH0D06556g2.522ON4561561383e-08
Kwal_26.79572.522ON4561461374e-08
ZYRO0B01738g2.522ON4921881365e-08
KLLA0E18789g2.522ON4971451302e-07
KAFR0D035602.522ON4553401303e-07
TBLA0I006202.522ON6091661303e-07
Kpol_1018.422.522ON5751601251e-06
ZYRO0E09746g3.575ON5381341152e-05
Suva_4.5482.522ON4841451125e-05
KLLA0D11396g3.575ON5361651107e-05
Skud_2.4192.522ON4841451034e-04
YBR288C (APM3)2.522ON4832731027e-04
Smik_7.3713.575ON598115980.002
Skud_6.1423.575ON546122970.003
KNAG0D030003.575ON563162970.003
KLTH0G00528g3.575ON633165960.003
Smik_2.4302.522ON484145960.004
YFR051C (RET2)3.575ON546115960.004
AFR274C3.575ON532165960.004
NCAS0A048702.522ON489352950.004
NCAS0F040103.575ON547165940.007
TDEL0D064303.575ON536157930.009
Kwal_47.192923.575ON538165930.009
TPHA0G037003.575ON539199920.012
Ecym_60073.575ON537140910.013
CAGL0L02145g2.522ON543229910.017
Suva_12.63.575ON546115900.018
SAKL0F00594g3.575ON545165890.023
NDAI0B063203.575ON540114880.030
TBLA0E001403.575ON543134870.045
CAGL0A04741g3.575ON536203870.045
Kpol_507.73.575ON533150830.13
Kpol_380.133.575ON535169820.16
Ecym_72662.522ON517146800.26
NDAI0K019302.522ON612163800.29
KNAG0A069702.522ON50560760.88
CAGL0J08888g7.323ON46561741.7
KAFR0J001303.575ON543103722.4
TBLA0G035308.68ON123292697.1
Kwal_26.94485.28ON551116697.2
TBLA0C071305.7ON38496687.3
TPHA0F012902.242ON56246679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L00950
         (461 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {...   952   0.0  
KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON...   759   0.0  
Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C ...   746   0.0  
YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}  A...   745   0.0  
Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}...   744   0.0  
ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {...   735   0.0  
Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}...   735   0.0  
TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {O...   731   0.0  
TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {O...   724   0.0  
Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON} (1265...   716   0.0  
SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly...   716   0.0  
NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {O...   717   0.0  
TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.1...   715   0.0  
NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {O...   708   0.0  
CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {O...   706   0.0  
Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {...   702   0.0  
KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]...   697   0.0  
ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON} S...   692   0.0  
Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar t...   687   0.0  
KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} simi...   686   0.0  
Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}...   224   2e-67
KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {...   215   6e-64
KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {...   211   2e-62
Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {...   204   6e-60
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...   202   1e-58
SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {...   201   1e-58
NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {O...   202   1e-58
CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly...   195   3e-56
SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weak...   195   5e-56
TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.1...   189   7e-54
Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa] ...   187   2e-53
ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic ho...   187   3e-53
YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON} ...   186   1e-52
Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C...   186   1e-52
ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic ...   183   1e-51
ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly...   182   2e-51
Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {O...   182   3e-51
Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {O...   180   2e-50
KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} simila...   180   2e-50
Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {...   178   9e-50
TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3....   176   3e-49
TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.1...   172   1e-47
KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]...   164   2e-44
TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON} Anc_2...   162   9e-44
Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {O...   159   1e-42
KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {...   156   9e-42
TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.5...   154   1e-40
KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.5...   151   1e-39
Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {O...   147   5e-38
ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} simila...   133   4e-33
Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON} Y...   127   8e-31
NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON} Anc_2...   126   1e-30
CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} simil...   125   3e-30
Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON} Y...   124   4e-30
KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.1...   121   2e-29
KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa] ...   121   6e-29
Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON} Y...   120   9e-29
YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}  AP...   120   2e-28
TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON} Anc_2...    89   3e-18
NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {O...    77   2e-14
SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [142...    66   5e-11
TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {O...    65   1e-10
AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic ho...    61   2e-09
TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {O...    59   9e-09
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    58   3e-08
Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {O...    57   4e-08
ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {...    57   5e-08
KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} simi...    55   2e-07
KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {O...    55   3e-07
TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {O...    55   3e-07
Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON} (1371...    53   1e-06
ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {...    49   2e-05
Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON...    48   5e-05
KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {...    47   7e-05
Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON...    44   4e-04
YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}  ...    44   7e-04
Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON...    42   0.002
Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON...    42   0.003
KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {O...    42   0.003
KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar ...    42   0.003
Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON...    42   0.004
YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}  ...    42   0.004
AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON} S...    42   0.004
NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.5...    41   0.004
NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {O...    41   0.007
TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa] ...    40   0.009
Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]...    40   0.009
TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {O...    40   0.012
Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to ...    40   0.013
CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} simil...    40   0.017
Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)     39   0.018
SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar ...    39   0.023
NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa] ...    39   0.030
TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575...    38   0.045
CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {...    38   0.045
Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON} (49309..50...    37   0.13 
Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}...    36   0.16 
Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]...    35   0.26 
NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2....    35   0.29 
KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa] ...    34   0.88 
CAGL0J08888g Chr10 complement(877386..878783) [1398 bp, 465 aa] ...    33   1.7  
KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.57...    32   2.4  
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...    31   7.1  
Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa] ...    31   7.2  
TBLA0C07130 Chr3 complement(1731931..1733085) [1155 bp, 384 aa] ...    31   7.3  
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    30   9.8  

>KNAG0L00950 Chr12 complement(174410..175795) [1386 bp, 461 aa] {ON}
           Anc_7.127 YPL259C
          Length = 461

 Score =  952 bits (2460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/461 (100%), Positives = 461/461 (100%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI
Sbjct: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD
Sbjct: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL
Sbjct: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI
Sbjct: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
           PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM
Sbjct: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF
Sbjct: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY
Sbjct: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN
Sbjct: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461

>KAFR0L00470 Chr12 complement(85772..87169) [1398 bp, 465 aa] {ON}
           Anc_7.127 YPL259C
          Length = 465

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/468 (77%), Positives = 417/468 (89%), Gaps = 11/468 (2%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD KGKPLLSR+Y+DD+PLSAIDKFS+LL+D E+ES ++PPCI+HNGI+Y+FI
Sbjct: 1   MASAVYFCDHKGKPLLSRKYRDDIPLSAIDKFSSLLSDKEEESNLLPPCISHNGIQYMFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+ ALATS+  NI+ +FAFLHK++ VL  YLKTVEEESIRDNF+IIYEL+DEMMD
Sbjct: 61  QHNDLYLAALATSVQANISLIFAFLHKIIDVLDGYLKTVEEESIRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YG+PQITE +MLKKYIT KSFKLEKAHKKKRNAARPP+EL NSVSWR EGIKYKKNEAFL
Sbjct: 121 YGLPQITETKMLKKYITTKSFKLEKAHKKKRNAARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGV-N 239
           DI+ESINMLITQKGQVLRSEI+G V++KSRLSGMPDLKLGINDRGIFTKYLEGNNIG+  
Sbjct: 181 DIIESINMLITQKGQVLRSEIVGNVRVKSRLSGMPDLKLGINDRGIFTKYLEGNNIGIAK 240

Query: 240 IPDPQEHGSGVAESSITNDG-KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFD 298
             D ++      ESSI ++G  KRKTNIELEDLKFHQCVRLSKFENEKII+FIPPDGEFD
Sbjct: 241 NGDDEDADDTNNESSIVSEGSNKRKTNIELEDLKFHQCVRLSKFENEKIISFIPPDGEFD 300

Query: 299 LMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTP 358
           LMNYRL+TSIKPLIWCDVSIQ +   RIEI C+AKAQIKKKS+A NV+ILIPVP+DAD+P
Sbjct: 301 LMNYRLSTSIKPLIWCDVSIQTY---RIEIHCKAKAQIKKKSIATNVEILIPVPEDADSP 357

Query: 359 SFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE------PKVKRPV 412
            FKYSHG IKY+PE++ +LWKI SFPGGKEY+M A+MGLPS+   ++       + K+PV
Sbjct: 358 IFKYSHGKIKYLPEKNLLLWKISSFPGGKEYSMAAQMGLPSISGEDDLNTRVSNQSKKPV 417

Query: 413 QVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           QVKF+IPYFTTSGIQVRYLK+NEPKLQYK+YPWVRYITQSGDDYTIR+
Sbjct: 418 QVKFKIPYFTTSGIQVRYLKVNEPKLQYKTYPWVRYITQSGDDYTIRI 465

>Smik_6.466 Chr6 (768507..769937) [1431 bp, 476 aa] {ON} YPL259C
           (REAL)
          Length = 476

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/480 (75%), Positives = 414/480 (86%), Gaps = 25/480 (5%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD  GKPLLSRRY+DDVPLSAIDKFSTLL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDVPLSAIDKFSTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+VA+ TSLT N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYLVAIVTSLTANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL K+ KKKRNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ ++   NI
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDNDS---NI 237

Query: 241 PDPQEHGSGVAESSITNDGK----------KRKTNIELEDLKFHQCVRLSKFENEKIITF 290
           P      +  ++++   D K          KRK NIELEDLKFHQCVRLSKFENEKIITF
Sbjct: 238 PSAV--SAATSDNNTDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIITF 295

Query: 291 IPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIP 350
           IPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+ILIP
Sbjct: 296 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIP 355

Query: 351 VPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE----- 405
           VPDDADTP+FKYSHGS+KYVPE+SAILWK++SFPGGKEY+M AE+GLPS+ + ++     
Sbjct: 356 VPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISTSKDGSRTI 415

Query: 406 PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 416 PKSNAKLLKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 475

>YPL259C Chr16 complement(51244..52671) [1428 bp, 475 aa] {ON}
           APM1Mu1-like medium subunit of the clathrin-associated
           protein complex (AP-1); binds clathrin; involved in
           clathrin-dependent Golgi protein sorting
          Length = 475

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/480 (75%), Positives = 410/480 (85%), Gaps = 26/480 (5%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF  LL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPILLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLYVVA+ TSL+ N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYVVAIVTSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL K+ KKKRNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGITHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ +    NI
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDD---TNI 237

Query: 241 PDPQEHGS----------GVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITF 290
           P      S           +  SS TN   K+K NIELEDLKFHQCVRLSKFENEKIITF
Sbjct: 238 PSASATTSDNNTETDKKPSITSSSATN---KKKVNIELEDLKFHQCVRLSKFENEKIITF 294

Query: 291 IPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIP 350
           IPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+ILIP
Sbjct: 295 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIP 354

Query: 351 VPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE----- 405
           VPDDADTP+FKYSHGS+KYVPE+SAILWKI+SFPGGKEY+M AE+GLPS+ + E+     
Sbjct: 355 VPDDADTPTFKYSHGSLKYVPEKSAILWKIRSFPGGKEYSMSAELGLPSISNNEDGNRTM 414

Query: 406 PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 415 PKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 474

>Suva_16.45 Chr16 complement(66786..68222) [1437 bp, 478 aa] {ON}
           YPL259C (REAL)
          Length = 478

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/480 (74%), Positives = 412/480 (85%), Gaps = 23/480 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF TLL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDHDGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+VA+ATSL+ N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYLVAIATSLSANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL K+ KKKRNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGISHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ ++   N+
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDSS---NL 237

Query: 241 PDPQEHGSGVAESSITNDGK----------KRKTNIELEDLKFHQCVRLSKFENEKIITF 290
           P      +   ++ +  D K          KRK NIELEDLKFHQCVRLSKFENEKIITF
Sbjct: 238 PPAASTTTSDNKTDVDTDKKPSITSSSTASKRKVNIELEDLKFHQCVRLSKFENEKIITF 297

Query: 291 IPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIP 350
           IPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+ILIP
Sbjct: 298 IPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEILIP 357

Query: 351 VPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE----- 405
           VPDDADTP+FKYSHGS+KYVPE+SAILWK++SFPGGKEY+M AE+GLPS+ +  +     
Sbjct: 358 VPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNGNDGSKTI 417

Query: 406 PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 418 PKNNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 477

>ZYRO0C05236g Chr3 complement(408616..409959) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 447

 Score =  735 bits (1898), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/461 (74%), Positives = 411/461 (89%), Gaps = 15/461 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M SAVYFCD KG+P+LSRRY+DD+P+SAIDKF+ LL  LE+ES+VIPPC++H+GI+YLFI
Sbjct: 1   MVSAVYFCDGKGRPILSRRYRDDIPISAIDKFAPLLLQLEEESSVIPPCLSHDGIQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLYVVALATSL  N+A+VFAFLHKLM VL EYLK+VEEES+RDNF+IIYEL+DEMMD
Sbjct: 61  QHNDLYVVALATSLATNVAQVFAFLHKLMEVLEEYLKSVEEESVRDNFIIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KK + A RPP+E+ NSVSWRA  I +KKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKAVKKSKAAPRPPTEVTNSVSWRAPNIVHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+ Q+GQVLRSEIIG +K+KS+LSGMPDLKLGIND+GIF+KY+EG++     
Sbjct: 181 DIVESINMLMNQQGQVLRSEIIGQIKVKSKLSGMPDLKLGINDKGIFSKYVEGDS----- 235

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
            DP         ++   +GKK KTNIELEDLKFHQCVRLSKFENEKIITFIPPDG F+LM
Sbjct: 236 -DPV--------TTAVTEGKK-KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGAFELM 285

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRL+  +KPLIWCDV++QVHS+SRIEI CRA+AQIKK+S+A +V+ILIPVPDDADTPSF
Sbjct: 286 NYRLSMPVKPLIWCDVNVQVHSQSRIEIHCRARAQIKKRSIANSVEILIPVPDDADTPSF 345

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           KY+HGS+K+VP+++AILWKI+SF GGKEY+M A+MGLPS+++ ++PKVKRPVQ+KF+IPY
Sbjct: 346 KYTHGSVKWVPQKNAILWKIRSFTGGKEYSMSAQMGLPSINALDKPKVKRPVQIKFQIPY 405

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           FTTSGIQVRYLKI EPKL YKSYPWVRYITQSGDDYTI++N
Sbjct: 406 FTTSGIQVRYLKITEPKLLYKSYPWVRYITQSGDDYTIKLN 446

>Skud_16.19 Chr16 complement(30298..31728) [1431 bp, 476 aa] {ON}
           YPL259C (REAL)
          Length = 476

 Score =  735 bits (1897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/481 (74%), Positives = 409/481 (85%), Gaps = 27/481 (5%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD  GKPLLSRRY+DD+PLSAIDKF TLL+DLE++S +IPPC+NHNG+EYLFI
Sbjct: 1   MASAVYFCDHNGKPLLSRRYRDDIPLSAIDKFPTLLSDLEEQSNLIPPCLNHNGLEYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+VA+ TSL  N A +F FLHKL+ VL +YLKTVEEESIRDNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYLVAIVTSLRANAAAIFTFLHKLVEVLSDYLKTVEEESIRDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQI E +MLK+YITQKSFKL K+ KKKRNA RPP  L NSVSWR EGI +KKNEAFL
Sbjct: 121 YGIPQICETKMLKQYITQKSFKLVKSAKKKRNATRPPVALTNSVSWRPEGIIHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQKGQVLRSEIIG VK+ S+LSGMPDLKLGIND+GIF+KYL+ ++   N 
Sbjct: 181 DIVESINMLMTQKGQVLRSEIIGDVKVNSKLSGMPDLKLGINDKGIFSKYLDDDS---NT 237

Query: 241 PDPQEHGSGVAESSITNDGK-----------KRKTNIELEDLKFHQCVRLSKFENEKIIT 289
           P P    S     +IT+  K           KRK NIELEDLKFHQCVRLSKFENEKIIT
Sbjct: 238 PPPT---SAATSDNITDTDKKPSITSSSTTSKRKVNIELEDLKFHQCVRLSKFENEKIIT 294

Query: 290 FIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILI 349
           FIPPDG+FDLMNYRL+T+IKPLIWCDV++QVHS SRIEI C+AKAQIK+KS A NV+I+I
Sbjct: 295 FIPPDGKFDLMNYRLSTTIKPLIWCDVNVQVHSNSRIEIHCKAKAQIKRKSTATNVEIII 354

Query: 350 PVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEE---- 405
           PVPDDADTP+FKYSHGS+KYVPE+SAILWK++SFPGGKEY+M AE+GLPS+ +  E    
Sbjct: 355 PVPDDADTPTFKYSHGSLKYVPEKSAILWKLRSFPGGKEYSMSAELGLPSISNDIEGHRA 414

Query: 406 -PK-----VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459
            PK     +K PVQ+KF+IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR
Sbjct: 415 IPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 474

Query: 460 V 460
           +
Sbjct: 475 L 475

>TDEL0H02890 Chr8 complement(481125..482453) [1329 bp, 442 aa] {ON}
           Anc_7.127 YPL259C
          Length = 442

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/461 (75%), Positives = 403/461 (87%), Gaps = 19/461 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S +YFCD KG+P+LSRRY+DD+PLSAID+F+ LL DLE+ES+VIPPC+NH GI+YLFI
Sbjct: 1   MVSGIYFCDIKGRPILSRRYRDDIPLSAIDRFAPLLADLEEESSVIPPCLNHRGIQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           +H DLYVVAL+TSL  N A+VF FLHKL+  LG+YLKTVEEES+RDNFVIIYEL+DEMMD
Sbjct: 61  EHEDLYVVALSTSLATNAAQVFTFLHKLVEALGDYLKTVEEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KK +  ARPP+ L NSVSWRA+GI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAVKKVKATARPPTGLTNSVSWRADGITYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINM++ Q+GQVLRSEIIG V ++SRLSGMPDLKLGIND+GIFT+           
Sbjct: 181 DIVESINMVMNQQGQVLRSEIIGQVIVRSRLSGMPDLKLGINDKGIFTR----------- 229

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
            DP+       ES +T    K+K++ ELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM
Sbjct: 230 -DPE-----TGESQVT--AGKKKSSAELEDLKFHQCVRLSKFENEKIITFIPPDGEFELM 281

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           +YRLTT +KPLIWCDV++QVHSKSRIEI CRAKAQIKKKSVA NV+ILIPVPDDADTPSF
Sbjct: 282 SYRLTTPVKPLIWCDVNVQVHSKSRIEIHCRAKAQIKKKSVANNVEILIPVPDDADTPSF 341

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHGSIK+VPE++AILWKI+SF GGKEY+M A+MGLPS++  E+PK KRPVQVKF+IPY
Sbjct: 342 RYSHGSIKWVPEKNAILWKIRSFYGGKEYSMAAQMGLPSINGVEKPKFKRPVQVKFQIPY 401

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           FTTSGIQVRYLKINEPKLQYKSYPWVRYITQ+GDDYTIR+N
Sbjct: 402 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQNGDDYTIRLN 442

>TBLA0A00950 Chr1 complement(210799..212208) [1410 bp, 469 aa] {ON}
           Anc_7.127 YPL259C
          Length = 469

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/468 (76%), Positives = 410/468 (87%), Gaps = 7/468 (1%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S++ FCD KGK LLSR+Y+DD+PL+AID F+TLL  LE+ES+V+PPC+ HNGI YLFI
Sbjct: 1   MVSSISFCDSKGKQLLSRKYRDDIPLTAIDNFATLLMKLEEESSVVPPCLTHNGIHYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+VAL TSL+ N ++VF FLHKL+ V+ EYLK VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYIVALTTSLSTNASQVFTFLHKLVEVMSEYLKDVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KKKRNAARPP  L NSVSWR EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPQALTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQ+GQVLRSEIIG VK++SRLSGMPDLKLGIND+GIF+KYLE  +   N 
Sbjct: 181 DIVESINMLMTQQGQVLRSEIIGEVKVRSRLSGMPDLKLGINDKGIFSKYLESTSSNSNS 240

Query: 241 PDPQEHGSGVAESSI------TNDGKKRKT-NIELEDLKFHQCVRLSKFENEKIITFIPP 293
            D   +    ++SS        ++G  RKT N+ELEDLKFHQCVRLSKFENEKIITFIPP
Sbjct: 241 NDDNSNEVNSSKSSTPQPSTGQDEGSSRKTSNVELEDLKFHQCVRLSKFENEKIITFIPP 300

Query: 294 DGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPD 353
           DG F+LM+YRLTT IKPLIWCDV+I VHSKSR+EI CRAKAQIKKKS+A NV+ILIPVPD
Sbjct: 301 DGNFELMSYRLTTPIKPLIWCDVNIHVHSKSRVEIHCRAKAQIKKKSIANNVEILIPVPD 360

Query: 354 DADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQ 413
           DADTPSF+YSHGSIK+VPE++AILWKI+SF GGKEY+M A++GLPS+D  E+PK+KRPVQ
Sbjct: 361 DADTPSFRYSHGSIKWVPEKNAILWKIRSFAGGKEYSMAAQLGLPSIDDNEKPKLKRPVQ 420

Query: 414 VKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           +KF+IPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSGDDYTIR+N
Sbjct: 421 IKFQIPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGDDYTIRLN 468

>Kpol_1062.56 s1062 (126558..127910) [1353 bp, 450 aa] {ON}
           (126558..127910) [1353 nt, 451 aa]
          Length = 450

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/459 (76%), Positives = 405/459 (88%), Gaps = 9/459 (1%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S VYFCD  GKP+LSRRY+DD+PLSAIDKFS +L + E+ES+V+PPC+ + GI YLFI
Sbjct: 1   MVSGVYFCDASGKPILSRRYRDDIPLSAIDKFSQILLEHEEESSVVPPCLLYQGIHYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QH+D+YVVAL TS   NIA++F FLH+L+ VLG+YLK+VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHSDIYVVALTTSYQTNIAQIFMFLHQLVSVLGDYLKSVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KKKRNAARPP  L NSVSWR EGIKYKKNEA+L
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLIKAAKKKRNAARPPVALTNSVSWRQEGIKYKKNEAYL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DI+ESINML+ Q+GQVLRSEIIG VK+KSRLSGMPDLKLGIND+GIF+KYLE      N 
Sbjct: 181 DIIESINMLMNQQGQVLRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKYLE------NE 234

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
            D  +    + + S TN    +K+NIELEDLKFHQCVRLSKFENEKIITFIPPDGEF+LM
Sbjct: 235 EDFSKPVQIINDDSTTNG---KKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFELM 291

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRLTT IKPLIWCD++IQVHSKSRIEI CRAKAQIKKKS+A NV+ILIPVPDDADTP+F
Sbjct: 292 NYRLTTPIKPLIWCDINIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADTPTF 351

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           KYSHGSIK++PE++AILWK++SF GGKEY+M A++GLPS+D  E PKVKRPVQ+KF+IPY
Sbjct: 352 KYSHGSIKWLPEKNAILWKLRSFAGGKEYSMTAQLGLPSVDGIEPPKVKRPVQIKFQIPY 411

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459
           FTTSGIQVRYLKINEPKLQYKS+PWVRYITQSGDDYTIR
Sbjct: 412 FTTSGIQVRYLKINEPKLQYKSFPWVRYITQSGDDYTIR 450

>SAKL0F05346g Chr6 (413830..415173) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|Q00776 Saccharomyces cerevisiae
           YPL259C APM1 medium subunit of the clathrin- associated
           protein complex
          Length = 447

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/461 (72%), Positives = 394/461 (85%), Gaps = 14/461 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MAS +YFCD KGK +LSRRYKDD+P +AIDKF  LL + E ES+VIPPC+ HNGI+YLF+
Sbjct: 1   MASCIYFCDSKGKKILSRRYKDDIPTNAIDKFPMLLVEREQESSVIPPCLAHNGIQYLFV 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLYV+ +  SL+ N+A++FAFL+K++ VL EY+K VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVLTMTRSLSTNVAQLFAFLYKVVEVLTEYVKVVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL K+ KK +N  RPP  L NSVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLMKSAKKSKNVIRPPIALTNSVSWRPEGIMYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D+VESINMLITQ+GQVLRSEI+G VK+KS LSGMPDLKLG+ND+GIF+ ++ G      +
Sbjct: 181 DVVESINMLITQQGQVLRSEILGKVKVKSHLSGMPDLKLGLNDKGIFSNHVSGG-----V 235

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
            D  +  S            K+K NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM
Sbjct: 236 EDEADDLSATG---------KKKANIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM 286

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           +YRLTT IKPLIWCD+ IQVHSKSRIE+ CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 287 SYRLTTPIKPLIWCDIKIQVHSKSRIEVHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 346

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHGSIK+ PE++AILWKIKSFPGGKEY+M A++GLPS+  +EEP +KRPVQVKF+IPY
Sbjct: 347 RYSHGSIKWAPEKNAILWKIKSFPGGKEYSMAAQLGLPSVSDFEEPVMKRPVQVKFQIPY 406

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           FTTSGIQVRYLKINEPK+QY+SYPWVRYITQSGDDYTIR+N
Sbjct: 407 FTTSGIQVRYLKINEPKMQYQSYPWVRYITQSGDDYTIRMN 447

>NCAS0E02140 Chr5 complement(410049..411494) [1446 bp, 481 aa] {ON}
           Anc_7.127
          Length = 481

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/460 (75%), Positives = 410/460 (89%), Gaps = 11/460 (2%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASAVYFCD KG PLL+RRY+DD+P+SAI+KF TLL+DLE+E+ ++PPC+++NG++YLFI
Sbjct: 32  MASAVYFCDSKGYPLLARRYRDDIPISAIEKFPTLLSDLEEETNLVPPCLSYNGMQYLFI 91

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHND+Y+VA+A S++ N A++FAFL+KL+ VLG YLKTVEEESIRDNFVIIYEL+DE MD
Sbjct: 92  QHNDVYLVAIANSMSANAAQIFAFLYKLVDVLGNYLKTVEEESIRDNFVIIYELLDETMD 151

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KKKRNAARPP  L NSVSWR+  IKYKKNEAFL
Sbjct: 152 YGIPQITETKMLKQYITQKSFKLVKAAKKKRNAARPPEALTNSVSWRSADIKYKKNEAFL 211

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DI+ESINML+TQKGQ+LRSEIIG VK+KSRLSGMPDLKLGIND+GIF+K+++ +++    
Sbjct: 212 DIIESINMLMTQKGQILRSEIIGEVKVKSRLSGMPDLKLGINDKGIFSKHMDDDSLN--- 268

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
                 G+ VA S  T D  K+K NIELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM
Sbjct: 269 ----NEGASVASS--TTD--KKKNNIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 320

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRL+TSIKPLIWCD++IQVHS+SRIEI CRAKAQIKKKS A NVQI+IPVP+DADTP F
Sbjct: 321 NYRLSTSIKPLIWCDMNIQVHSQSRIEIHCRAKAQIKKKSTATNVQIIIPVPEDADTPEF 380

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           KYSHGSIKYVPE++ I+WKI+SFPGGKEY+M A+M LPS+ + EE K KRPVQ+KF+IPY
Sbjct: 381 KYSHGSIKYVPEKNVIIWKIRSFPGGKEYSMSAQMQLPSIGNIEEHKAKRPVQIKFQIPY 440

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQV+YLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 441 FTTSGIQVKYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 480

>TPHA0C04320 Chr3 (932871..934235) [1365 bp, 454 aa] {ON} Anc_7.127
           YPL259C
          Length = 454

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/464 (73%), Positives = 400/464 (86%), Gaps = 14/464 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S +YFCD+ GKP+L+RRY+DD+ ++AID FS LL  LE+E+ VIPPCI H GI YLFI
Sbjct: 1   MVSGIYFCDNAGKPILARRYRDDISINAIDNFSQLLLQLEEETGVIPPCIMHKGIHYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           +H+D+YVVAL TS   N+A++F FLH+L+ VL EY+K V EES+RDNFVIIYEL+DEMMD
Sbjct: 61  KHSDIYVVALTTSYQTNVAQIFMFLHQLVEVLEEYVKIVVEESVRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKL--EKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEA 178
           +GIPQITE +MLKKYITQKSFKL      KKK+NAARPP+EL NSVSWR EGI YKKNEA
Sbjct: 121 FGIPQITETKMLKKYITQKSFKLIKTSTSKKKKNAARPPAELTNSVSWRPEGITYKKNEA 180

Query: 179 FLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGV 238
           FLDI+ESINML+TQ+GQVLRSEI+GAV+++SRLSGMPDLKLGINDRGIF+ YLE NN+  
Sbjct: 181 FLDIIESINMLVTQQGQVLRSEIVGAVRVRSRLSGMPDLKLGINDRGIFSNYLEENNV-- 238

Query: 239 NIPDPQEHGSGVAESSITNDG-KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEF 297
                     G + S+   +G + +K  IELEDLKFHQCVRLSKFENEKIITFIPPDGEF
Sbjct: 239 ---------DGSSSSTPIPEGVEDKKPQIELEDLKFHQCVRLSKFENEKIITFIPPDGEF 289

Query: 298 DLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADT 357
           DLMNYRLTT IKPLIWCDV+IQVHSKSRIEI CRAKAQIKKKS+A NV+ILIPVPDDADT
Sbjct: 290 DLMNYRLTTPIKPLIWCDVNIQVHSKSRIEIHCRAKAQIKKKSIANNVEILIPVPDDADT 349

Query: 358 PSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFE 417
           P F+YSHGSIK++PE++AILWK++SF GGKEY+M A++ LPS+D  E PKV+RPVQVKF+
Sbjct: 350 PQFRYSHGSIKWLPEKNAILWKLRSFAGGKEYSMSAQLHLPSVDGVEPPKVRRPVQVKFQ 409

Query: 418 IPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           IPYFTTSGIQVRYLK+NEPKLQYKSYPWVRYITQSG+DYTIR+N
Sbjct: 410 IPYFTTSGIQVRYLKVNEPKLQYKSYPWVRYITQSGEDYTIRLN 453

>NDAI0E03680 Chr5 complement(794613..795947) [1335 bp, 444 aa] {ON}
           Anc_7.127
          Length = 444

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/461 (75%), Positives = 402/461 (87%), Gaps = 19/461 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASA+YFCD KG+PLLSR+Y+DD+PL+AIDKF++LL DLE+ES+VIPPC+ +N  +YLFI
Sbjct: 1   MASAIYFCDIKGRPLLSRKYRDDIPLTAIDKFASLLADLEEESSVIPPCLTYNNTQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QH+D+Y+VA+   L  NIAEVFAFL+K++ VLG+YLKTVEEESIRDN+VIIYEL+DE+MD
Sbjct: 61  QHSDIYLVAITNLLRTNIAEVFAFLYKIIDVLGDYLKTVEEESIRDNYVIIYELLDELMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKSFKL KA KKK+NAARPPS L +SVSWR+EGIKYKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSFKLVKAAKKKQNAARPPSALTDSVSWRSEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DIVESINML+TQKGQ+LRSEI+G VKIKSRLSGMPDLKLGIND+GIF+K L  ++     
Sbjct: 181 DIVESINMLMTQKGQILRSEILGVVKIKSRLSGMPDLKLGINDKGIFSKQLTEDDTN--- 237

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
                           N   K++  IELEDLKFHQCVRLSKFE EKIITFIPPDG+F+LM
Sbjct: 238 ---------------NNATSKKQNKIELEDLKFHQCVRLSKFETEKIITFIPPDGDFELM 282

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRL+TSIKPLIWCD+++QVHS SRIEI CRAKAQIKKKS A NV+ILIPVP+DADTP+F
Sbjct: 283 NYRLSTSIKPLIWCDMNVQVHSNSRIEIHCRAKAQIKKKSTATNVEILIPVPEDADTPNF 342

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDS-YEEPKVKRPVQVKFEIP 419
           KYSHGSIK+VPE+SAILWKI+SFPGGKEY+M AE+ LPS  S  EE + K+PVQVKF+IP
Sbjct: 343 KYSHGSIKWVPEKSAILWKIRSFPGGKEYSMAAELCLPSTSSKSEEVQNKKPVQVKFQIP 402

Query: 420 YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR+
Sbjct: 403 YFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRL 443

>CAGL0K00539g Chr11 complement(64028..65398) [1371 bp, 456 aa] {ON}
           highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259c Clathrin coat assembly protein
          Length = 456

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/463 (76%), Positives = 412/463 (88%), Gaps = 9/463 (1%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MASA+YFCD+KG+PLLSR+Y+DD+P SAID+F  LL++ E+E+ +IPPCI HNGI++LFI
Sbjct: 1   MASAIYFCDNKGRPLLSRKYRDDIPFSAIDRFPILLSNFEEETNLIPPCIEHNGIQFLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY+VA+ATS++ N A +F+FLHK++ VL EYLK VEEESIRDNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYLVAIATSISCNAALIFSFLHKVIEVLSEYLKAVEEESIRDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITEP+MLK+YITQKSFKL+KA KKKRNAARPP+ L NSVSWR EGIK+KKNEAFL
Sbjct: 121 YGIPQITEPKMLKQYITQKSFKLKKAAKKKRNAARPPTSLTNSVSWRPEGIKHKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           DI+ESINML+TQKGQVLRSEIIG VK+KS+LSGMPDLKLGIND+G+F+KYLEG+  GV I
Sbjct: 181 DIIESINMLMTQKGQVLRSEIIGEVKVKSKLSGMPDLKLGINDKGLFSKYLEGDENGVPI 240

Query: 241 -PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDL 299
            PD     S V ES      KKR  N+ELEDLKFHQCVRLSKFENEK ITFIPPDG+F+L
Sbjct: 241 APD----DSSVDES---KPKKKRSNNMELEDLKFHQCVRLSKFENEKQITFIPPDGDFEL 293

Query: 300 MNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPS 359
           M+YRL+T+IKPLIWCDV+I+ HSKSRIEI CRAKAQIKKKS A NV+ILIPVP+DADTP 
Sbjct: 294 MSYRLSTAIKPLIWCDVNIKTHSKSRIEIFCRAKAQIKKKSTATNVEILIPVPEDADTPV 353

Query: 360 FKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEP-KVKRPVQVKFEI 418
           FKYSHGSIKYVPE++AILWKI++FPG KEY+M AEMGLPS ++ EE  K+KRPVQVKF+I
Sbjct: 354 FKYSHGSIKYVPEKNAILWKIRTFPGDKEYSMAAEMGLPSTNAGEESEKLKRPVQVKFQI 413

Query: 419 PYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRVN 461
           PYFTTSGIQVRYLKI E  LQYKSYPWVRYIT+SGDDYTIR++
Sbjct: 414 PYFTTSGIQVRYLKIEEKNLQYKSYPWVRYITKSGDDYTIRLS 456

>Kwal_55.20843 s55 complement(580157..581482) [1326 bp, 441 aa] {ON}
           YPL259C (APM1) - medium subunit of the
           clathrin-associated protein complex [contig 138] FULL
          Length = 441

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/460 (71%), Positives = 390/460 (84%), Gaps = 20/460 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MAS +YFCD+ GK +LSRRY+DDVP SAI++F  LL + E ES+V+PPC+ HNG++Y+FI
Sbjct: 1   MASCIYFCDNTGKVILSRRYRDDVPPSAIERFPALLLEAEQESSVVPPCLTHNGLQYMFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHND+YV+ ++ SL++N+A+VF+FL+KL+ VL EYLKTVEEESIRDNFVIIYEL+DEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYLKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKS+KL K+ KK +N  RPP++L  SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSVKKSKNVVRPPAQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D+ ESINMLIT  GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT    GNN     
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTSEEGGNN----- 235

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
               E GSG            +K+NIELEDL+FHQCVRLSKFENEKII+FIPPDG+FDLM
Sbjct: 236 ---AEGGSG------------KKSNIELEDLQFHQCVRLSKFENEKIISFIPPDGDFDLM 280

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRL+T IKPLIWCD  IQVHS+SRIEI CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 281 NYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 340

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHGS+KYVPE+SAILW+IK+F GGKEY+  A++GLPSM   E PK KRP+QVKF+IPY
Sbjct: 341 RYSHGSLKYVPEKSAILWRIKTFNGGKEYSFAAQLGLPSMTDVEVPKAKRPIQVKFQIPY 400

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQVRYLK++EPKLQY+SYPWVRYITQSGDDYTIR 
Sbjct: 401 FTTSGIQVRYLKVHEPKLQYQSYPWVRYITQSGDDYTIRT 440

>KLTH0F12584g Chr6 complement(1053944..1055269) [1326 bp, 441 aa]
           {ON} highly similar to uniprot|Q00776 Saccharomyces
           cerevisiae YPL259C APM1 medium subunit of the clathrin-
           associated protein complex
          Length = 441

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/460 (71%), Positives = 389/460 (84%), Gaps = 20/460 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MAS +YFCD+KGK +LSRRY+DDVP SAI+KF +LL + E ES+++PPC+ HNG++YLFI
Sbjct: 1   MASCIYFCDNKGKVILSRRYRDDVPPSAIEKFPSLLLEAEQESSIVPPCLTHNGVQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHND+YV+ ++ SL++N+A+VF+FL+KL+ VL EY+KTVEEESIRDNFVIIYEL+DEM+D
Sbjct: 61  QHNDIYVLTMSRSLSINVAQVFSFLYKLVEVLAEYVKTVEEESIRDNFVIIYELLDEMLD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           YGIPQITE +MLK+YITQKS+KL K+ KK +N  RPPS+L  SVSWR EGI YKKNEAFL
Sbjct: 121 YGIPQITETKMLKQYITQKSYKLIKSAKKSKNVIRPPSQLTKSVSWRPEGITYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D+ ESINMLIT  GQVLRSEI+G V ++SRLSGMPDLKLG+ND+GIFT            
Sbjct: 181 DVTESINMLITASGQVLRSEILGKVNVRSRLSGMPDLKLGLNDKGIFTS----------- 229

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
                     A SS   +GKK  +NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM
Sbjct: 230 -------VESASSSEATEGKK--SNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM 280

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           NYRL+T IKPLIWCD  IQVHS+SRIEI CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 281 NYRLSTPIKPLIWCDAKIQVHSQSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 340

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHGS+KYVPE+SAILWKIK+F GGKEY+  A++GLPSM   E P+ KRP+QVKF+IPY
Sbjct: 341 RYSHGSLKYVPEKSAILWKIKTFNGGKEYSFAAQLGLPSMTDAEVPRAKRPIQVKFQIPY 400

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQVRYLKINEPKLQY+SYPWVRYITQSGDDYTIR 
Sbjct: 401 FTTSGIQVRYLKINEPKLQYQSYPWVRYITQSGDDYTIRT 440

>ADL017C Chr4 complement(679085..680416) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL259C
           (APM1)
          Length = 443

 Score =  692 bits (1786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/460 (70%), Positives = 390/460 (84%), Gaps = 17/460 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S +YFCD KGK LLSRRYKDD+P +AI++F  LL + E ES+V+PPC + NG++YLFI
Sbjct: 1   MTSGIYFCDSKGKLLLSRRYKDDIPANAIEQFPHLLIEKEQESSVLPPCFSFNGVQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLYV+ L  S+++N+A+VF++LHKL+ VL EY+K VEEESI+DNFVIIYEL+DEMMD
Sbjct: 61  QHNDLYVLTLTKSMSINVAQVFSYLHKLIEVLEEYMKVVEEESIKDNFVIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
           +GIPQIT+ +ML++YITQKSFKL ++ KKK+N  RPP+ L NSVSWR EGI YKKNEAFL
Sbjct: 121 HGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPATLTNSVSWRPEGIVYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D+VESINML+TQ+GQVLRSEI+G VK+KSRLSGMPDLKLG+ND+GIF +           
Sbjct: 181 DVVESINMLLTQQGQVLRSEILGKVKVKSRLSGMPDLKLGLNDKGIFAQ----------- 229

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
                 G    +    + G K+K+NIELEDLKFHQCVRL+KFENEKIITFIPPDG+F+LM
Sbjct: 230 ------GDDDDDEEGASGGTKKKSNIELEDLKFHQCVRLTKFENEKIITFIPPDGDFELM 283

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           +YRL+T IKPLIWCDV +QVHS+SRIEI CRAKAQIKKKS A NV+ILIPVP+DAD+P F
Sbjct: 284 SYRLSTPIKPLIWCDVKLQVHSRSRIEIHCRAKAQIKKKSTANNVEILIPVPEDADSPKF 343

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHG+IK+VP Q+AILWKIKSFPGGK+Y+M AEMGLPS+    + K+KRPVQ+KF+IPY
Sbjct: 344 RYSHGTIKWVPSQNAILWKIKSFPGGKDYSMAAEMGLPSVSDNSDHKLKRPVQIKFQIPY 403

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQVRYLKINEPK+QY SYPWVRYITQSGDDYTIR+
Sbjct: 404 FTTSGIQVRYLKINEPKMQYNSYPWVRYITQSGDDYTIRM 443

>Ecym_8350 Chr8 (700421..701758) [1338 bp, 445 aa] {ON} similar to
           Ashbya gossypii ADL017C
          Length = 445

 Score =  687 bits (1772), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/460 (69%), Positives = 390/460 (84%), Gaps = 15/460 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S +YFCD KGK LLSRRYKDD+P+SAI++F  LL + E ES VIPPC +HNG++YLFI
Sbjct: 1   MSSGIYFCDAKGKLLLSRRYKDDIPISAIEQFPYLLIEKEQESNVIPPCFSHNGVQYLFI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           QHNDLY++ L  S+  N+A+VF+FLH L+ VL EY+K VEEESI+DNFVIIYEL+DE+MD
Sbjct: 61  QHNDLYILTLTRSMYANVAQVFSFLHTLVDVLQEYMKVVEEESIKDNFVIIYELLDEVMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
            GIPQIT+ +ML++YITQKSFKL ++ KKK+N  RPPS L  +VSWR EGIKYKKNEAFL
Sbjct: 121 SGIPQITDTKMLRQYITQKSFKLIRSAKKKKNVVRPPSSLTTAVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D++ESINM++TQ+GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT+  E        
Sbjct: 181 DVIESINMMMTQQGQVLRSEILGKVKVRSRLSGMPDLKLGLNDKGIFTQSNE-------- 232

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
              +E     ++ SIT    ++K+NIELEDLKFHQCVRLSKFENEKIITFIPPDG+F+LM
Sbjct: 233 ---EEEDEPSSQPSIT----RKKSNIELEDLKFHQCVRLSKFENEKIITFIPPDGDFELM 285

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
           +YRL+T IKPLIWCD  IQVHS+SR+E+ CRAKAQIK KS A NV+ILIPVP+DAD+P F
Sbjct: 286 SYRLSTPIKPLIWCDAKIQVHSRSRVEVHCRAKAQIKAKSTANNVEILIPVPNDADSPKF 345

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           +YSHGSIK+VPE++AILWKIKSFPGGK+Y+M AEMGLPS++   +   KRPVQ+KF+IPY
Sbjct: 346 RYSHGSIKWVPEKNAILWKIKSFPGGKDYSMAAEMGLPSVNDIADYNFKRPVQIKFQIPY 405

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQVRYLKINEPKLQY SYPWVRYITQSG+DY IR+
Sbjct: 406 FTTSGIQVRYLKINEPKLQYNSYPWVRYITQSGEDYIIRM 445

>KLLA0D14311g Chr4 (1216574..1217905) [1332 bp, 443 aa] {ON} similar
           to uniprot|Q00776 Saccharomyces cerevisiae YPL259C APM1
           medium subunit of the clathrin-associated protein
           complex
          Length = 443

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/460 (70%), Positives = 387/460 (84%), Gaps = 17/460 (3%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           MAS V FCD KGKPLLSRRY+DDV  SA++ F  LL + E ES+V+PPC +HNGI Y+++
Sbjct: 1   MASYVAFCDSKGKPLLSRRYQDDVSQSAVESFQHLLLEREQESSVMPPCFHHNGIHYMYV 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
           Q+ND+YV+AL  S++VN   +FAF++KL+ V+ EY+K VEEESIRDN++IIYEL+DEMMD
Sbjct: 61  QYNDVYVLALTRSVSVNATTMFAFMYKLINVVEEYVKRVEEESIRDNYIIIYELLDEMMD 120

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
            G+PQ+TE +MLK+YITQKSFKL ++ KK++N ARPP+EL NSVSWR EGIKYKKNEAFL
Sbjct: 121 KGVPQVTETKMLKQYITQKSFKLTRSAKKQKNVARPPTELTNSVSWRPEGIKYKKNEAFL 180

Query: 181 DIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNI 240
           D++ESINML+TQ+GQVLRSEI+G VK++SRLSGMPDLKLG+ND+GIFT      N   + 
Sbjct: 181 DVIESINMLMTQQGQVLRSEILGTVKVRSRLSGMPDLKLGLNDKGIFT-----TNDQEDS 235

Query: 241 PDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 300
           P+P                KK+ +NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM
Sbjct: 236 PEP------------VVSSKKKNSNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLM 283

Query: 301 NYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSF 360
            YRL+T IKPLIWCDV +QVHS SRIEI CRAKAQIKKKSVA NV+ILIP+P+DAD+P+F
Sbjct: 284 TYRLSTPIKPLIWCDVKVQVHSGSRIEIHCRAKAQIKKKSVANNVEILIPIPEDADSPTF 343

Query: 361 KYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPY 420
           KYS G+IK+VPE++AILWK  SF GGKEY+M A++GLPS+   E PK+KRPVQ+KF+IPY
Sbjct: 344 KYSRGNIKWVPEKNAILWKFSSFQGGKEYSMAAQLGLPSVSDAEPPKLKRPVQIKFQIPY 403

Query: 421 FTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           FTTSGIQVRYLKI EPKLQY SYPWVRYITQSGDDYTIR+
Sbjct: 404 FTTSGIQVRYLKIEEPKLQYNSYPWVRYITQSGDDYTIRL 443

>Ecym_5239 Chr5 complement(492091..493485) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii ADR315W
          Length = 464

 Score =  224 bits (571), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 151/479 (31%), Positives = 252/479 (52%), Gaps = 36/479 (7%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M SA++    +G  ++S+  KD++ L   + F   + +  D   V  P +      +  I
Sbjct: 1   MISALFLYSPRGDLIISKLIKDNIKLGVSEIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119
           + N  L++V ++   T + A ++ FL+    +L E      E+S++ +F++ YE++D ++
Sbjct: 58  RSNGGLWLVTVSRGNT-DSAGIWEFLYNFNKLL-EVYDINSEDSLQGDFMLCYEILDIVL 115

Query: 120 DYGIPQITEPRMLKKYITQKSFK---------LEKAHKKKRNAARPPSELNNSVS----- 165
           D GIP+ TE   +  YI++K            L       +  AR  S  N  ++     
Sbjct: 116 DNGIPRDTELTHIMPYISKKPLSENLLGSDDILNTPSWLVKAGARGMSSENLGLTSKDMC 175

Query: 166 -WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDR 224
            WR+EGI+YKKNE +LD+ E I++L+ + G +L+S + G+V+  + LSGMP  + G ND 
Sbjct: 176 LWRSEGIRYKKNEVYLDVFEHISILVNKDGAILKSYVDGSVQCVAHLSGMPVCQFGFNDY 235

Query: 225 GIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFEN 284
              +      + G +    +E+G+   +++IT        ++ LED KFHQCV+L KF+ 
Sbjct: 236 --LSPSSNTQSSGNDGWAEEENGTKAIKNAITG-------SVILEDCKFHQCVQLDKFDQ 286

Query: 285 EKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAA 343
           E++I F+PPDG F+LM Y +  ++  P     +   +  KS +E R   K+    K  A 
Sbjct: 287 ERVIRFVPPDGLFELMKYHVRDNLNLPFKVTPMVTTLKGKS-VEYRITLKSLFPSKLCAK 345

Query: 344 NVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKE---YAMFAEMGLPSM 400
           +V++ IP P D        S G  K++PE++AI+WKI  + G  E    A+   MG  + 
Sbjct: 346 DVELYIPAPPDTVNAKINVSSGKGKFIPEENAIVWKIHKYHGLTENVFSAVIVPMGNGND 405

Query: 401 DSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459
               E   + P+ V+FEI  F+ SG+ VRYLK+ E  L Y +  WV+YI++SG  Y +R
Sbjct: 406 SLNLEQWSRPPISVRFEISMFSNSGLVVRYLKVMEKDLNYNTVKWVKYISKSG-AYEVR 463

>KLTH0F06534g Chr6 complement(565211..566611) [1401 bp, 466 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 466

 Score =  215 bits (547), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 147/489 (30%), Positives = 249/489 (50%), Gaps = 54/489 (11%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M SA++    +G+ L+S+  +  VP S  + F   + +  D   V  P +      +  +
Sbjct: 1   MLSALFIFSLRGELLISKHVRSSVPKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHV 57

Query: 61  QH-NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119
           +   +L++VA++ S   + A ++ FL+KL  +L E      E  ++++F+  YEL+D ++
Sbjct: 58  KSPGNLWIVAVSRS-NADSAAIWEFLYKLSALL-EAFGLHSENELKEDFMTCYELLDIVL 115

Query: 120 DYGIPQITEPRMLKKYITQK---------SF---------------KLEKAHKKKRNAAR 155
           + G+P  TE   +   ++ K         +F               +  +A     N   
Sbjct: 116 EDGVPVDTELSSVASKMSVKPSASAERINTFIESGNGGTNRILPVAQFLRARSSSSNLHD 175

Query: 156 PPSELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMP 215
             S++ +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 SHSKVPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKTNIELEDLK 272
             + G+ND           ++ V+ P       G  ES  TN     K    ++ LED K
Sbjct: 236 VCRFGLND-----------SLSVSTP------FGDNESPTTNKKAIPKAAAGSVMLEDCK 278

Query: 273 FHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRA 332
           FHQCV+L KF++E+ I FIPPDG F+LM Y +  ++         + +   + I+ R   
Sbjct: 279 FHQCVQLDKFQSERTINFIPPDGSFELMKYHVRENLNLPFKITPVVTLFKANSIDYRVTI 338

Query: 333 KAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMF 392
           K+    K  A +VQ+ IPVP +        S+G  K+VPE+SAI+WK   + G  E ++ 
Sbjct: 339 KSLFPSKLTAKDVQLRIPVPPETVDCHISTSNGRCKFVPEESAIIWKFSKYQGLTENSLS 398

Query: 393 AEMGLPSMDSYE--EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYIT 450
           A   +P  DS    +   K P+ +KFEI  F+ SG+ VR+  ++E    YK   W++Y++
Sbjct: 399 A-TAVPMKDSALNIDQWSKPPMSLKFEIVMFSNSGLVVRFFDVSEGDRNYKMVKWIKYLS 457

Query: 451 QSGDDYTIR 459
           +SG  Y +R
Sbjct: 458 KSG-AYEVR 465

>KLLA0C03894g Chr3 complement(354889..356316) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit,
          Length = 475

 Score =  211 bits (537), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 145/493 (29%), Positives = 250/493 (50%), Gaps = 53/493 (10%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M SA++  + KG  L+S+  KD V  S  D F T ++ D    S ++   +     +++ 
Sbjct: 1   MLSAIFIYNAKGDLLISKLIKDHVKRSLADVFRTQVINDPHVRSPIL--TLGSTTFQHVI 58

Query: 60  IQHND---LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116
            + +D   +++VA++ S  V+ + ++ +LHKL  ++ E     +E+ ++D F+++YE+++
Sbjct: 59  RESSDNLPMWLVAVSRS-NVDSSMIWEYLHKLYQLM-EAFGINDEDVLKDEFMLLYEILE 116

Query: 117 EMMDYGIPQITE-----PRMLKKYITQKSFK--------------LEKAHKKKRNAARPP 157
             ++ GIPQ T+     PR+ +K I   +                L+     KR+++   
Sbjct: 117 LTLENGIPQTTDLAQIIPRVSRKPIENNTISKSPDLDDFLSGSNILKAPKLSKRSSSSIA 176

Query: 158 SELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDL 217
               +   WR  G+KYKKNE +LDI E I +L+ + G +++S + G+V   S LSGMP  
Sbjct: 177 LSSLSECPWRPSGLKYKKNEVYLDINEKITILVGKDGSIVKSFVDGSVDCVSHLSGMPLC 236

Query: 218 KLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKT-------NIELED 270
           +LG+ND    T  + GN         ++    + E     D K +K        ++ LED
Sbjct: 237 QLGLND----TYSIHGN---------EKSELSIVEMMSEYDIKNKKAIPNAAAGSVILED 283

Query: 271 LKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRC 330
            KFHQCV+L+K+E   +I F+PPDG F LM YR+  +I         +++   S +  + 
Sbjct: 284 CKFHQCVQLNKYEANHVIQFVPPDGPFQLMQYRVIDNINIPFNVIPEVEIVKNSTLNYKV 343

Query: 331 RAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYA 390
             ++       A +V + IPVP       F  S G  KY   +  ++WK   + G  E  
Sbjct: 344 TLRSLFPSNVSAKDVTVKIPVPPTTIKCDFNVSGGKCKYDAGEKCMVWKYNKYKGSTENT 403

Query: 391 MFAEMGLPSMDSYEEPKVKR----PVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWV 446
           +  ++ +P+  S++   + R    P+ + FEI  F+ SG+ VR+LK  EP+L Y+   W+
Sbjct: 404 LSGKVAIPAT-SHDLSDLLRWSRPPISMGFEIVMFSNSGLVVRHLKCQEPQLNYQPVKWI 462

Query: 447 RYITQSGDDYTIR 459
           +YI+ SG  Y IR
Sbjct: 463 KYISHSG-AYEIR 474

>Kwal_33.14182 s33 complement(560456..561859) [1404 bp, 467 aa] {ON}
           YOL062C (APM4) - Clathrin associated protein, medium
           subunit [contig 105] FULL
          Length = 467

 Score =  204 bits (520), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 150/490 (30%), Positives = 249/490 (50%), Gaps = 55/490 (11%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M +A++    +G+ L+S+  K  V  S  + F   + +  D   V  P +      +  I
Sbjct: 1   MLNALFIYSLRGELLISKHVKGSVQKSMSEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QH-NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119
           +   +L++VA++ S   + A ++ FL++L  +L E      E  +++ F+I YEL+D ++
Sbjct: 58  KSAKNLWIVAVSRS-NADSAAIWEFLYRLNELL-EAFNLYSENELKERFMICYELLDIVL 115

Query: 120 DYGIPQITEPRMLKKYITQK------SFKL--EKAHKKKRNA--------ARP------- 156
           + G+P  TE   +   ++ K      +F +  E  H               RP       
Sbjct: 116 EDGLPVDTELSSVASKMSVKPNAGVDNFNMFAENGHGGTNRILPVSQFLRGRPSAGNLQD 175

Query: 157 -PSELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMP 215
             SE  +++ WR  GIKYKKNE FL++ E I++L+++ G +L+S + G V+  + LSGMP
Sbjct: 176 IASEAPSNIPWRMNGIKYKKNEVFLNVNERISILVSKDGSILKSYVDGTVEATTHLSGMP 235

Query: 216 DLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKTNIELEDLK 272
             + G+ND            + V+ P   +      E  +TN     K    ++ LED K
Sbjct: 236 VCRFGLNDA-----------LSVSTPFGDDD-----EYQVTNKKAIPKAAAGSVMLEDCK 279

Query: 273 FHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIEIRCR 331
           FHQCV+L KF++E+ I FI PDG F+LM Y +  ++  P     +   V S S I+ +  
Sbjct: 280 FHQCVQLDKFQSERTINFIAPDGSFELMKYHVRENLNLPFKVTPIVTVVRSNS-IDYQIT 338

Query: 332 AKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAM 391
            K+    K  A +VQ+ IPVP +  +     S+G  K+VPE+SAI+WK   + G  E ++
Sbjct: 339 IKSLFPSKLTAKDVQLRIPVPPETVSCHISTSNGKCKFVPEESAIVWKFSKYQGLTENSI 398

Query: 392 FAEMGLPSMDSYE--EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 449
            A   +P  DS    E   + P+ +KFEI  F+ SG+ VR+  ++E    YK   W++Y+
Sbjct: 399 SA-TAVPMKDSTLNIEQWPRPPISLKFEIVMFSNSGLVVRFFNVSERDRNYKMVKWIKYL 457

Query: 450 TQSGDDYTIR 459
           ++SG  Y +R
Sbjct: 458 SKSG-AYEVR 466

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score =  202 bits (513), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 148/504 (29%), Positives = 248/504 (49%), Gaps = 64/504 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M + +     +G+ ++S+ +K  +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MINGILIYSPRGELIVSKLFKGTLKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QH----NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116
           +     ++L++VA AT    N A ++ FL+KL  +L EY    +EE +++ F+I++EL+D
Sbjct: 58  RSSKDSDNLWLVA-ATRNNANSAAIWEFLYKLDSMLIEY-GLNKEEYLKEEFMIVHELLD 115

Query: 117 EMM-DYGIPQITEPRMLKKYITQKSFKLEKAHKK------------------------KR 151
            M+   GIP  TEP    K I + S K  K H                          KR
Sbjct: 116 VMLGSCGIPLETEP---SKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKR 172

Query: 152 NAARPPSELN---NSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIK 208
           N +    + N   N  SWR + IK+KKNE  L + E IN+L+ + G +L++ + G++ ++
Sbjct: 173 NDSSQSHDSNFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKDGSILKAYVDGSIDLQ 232

Query: 209 SRLSGMPDLKLGINDRGIF----TKYLEGNNIGVNIPDPQEHGSGVAESSITND--GKKR 262
           +RLSG P  + G+ND        ++Y   N    N      + S + +S+++N    K  
Sbjct: 233 TRLSGTPVCQFGLNDSLTLGSNDSEYSSRNGRTGN------NKSSMLDSNLSNKVLSKAS 286

Query: 263 KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVH 321
             N+ LED KFHQCV L KF+ E+II F+PPDG  +LM Y +  ++  P     +     
Sbjct: 287 VGNVILEDCKFHQCVSLDKFDRERIIKFVPPDGSVELMKYHIRNNLNLPFKITPIVTNSV 346

Query: 322 SKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIK 381
           +   ++ R   K+    +  A  V + IPVP      +   S+G+ K+VP ++A++WK  
Sbjct: 347 TGDALDYRIALKSLFPGRLSAKGVVLHIPVPPGVMDCNISVSNGTCKFVPAENAMVWKFN 406

Query: 382 SFPGGKEYAMFA------EMGLPSMDSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINE 435
            + G  E  + A      E+   ++  +  P    P+ + FEI  F+ SG+ VRY  I+E
Sbjct: 407 KYNGLTENTLSAVTVPSKEVNQTTLQQWARP----PMSLDFEILMFSNSGLVVRYFTISE 462

Query: 436 PKLQYKSYPWVRYITQSGDDYTIR 459
               YK+  W++Y+++SG  Y +R
Sbjct: 463 GHQNYKAVKWIKYVSKSG-SYEVR 485

>SAKL0C07414g Chr3 complement(683859..685307) [1449 bp, 482 aa] {ON}
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 482

 Score =  201 bits (512), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 142/500 (28%), Positives = 248/500 (49%), Gaps = 60/500 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M +A++    KG+ ++S+  +D +  S  + F   + +  D   V  P +      +  I
Sbjct: 1   MLNALFVFSQKGELVVSKLIRDTIKRSVAEIFRIQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QHN-DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119
           + + +L++VA+  S   + A ++ FL+K   +L  Y     EES+++ F+  YEL+D ++
Sbjct: 58  RSSSNLWIVAVTRS-NADSAAIWEFLYKFNALLEAY-GLNSEESLKEEFMTCYELLDVVL 115

Query: 120 DYGIPQITEPRMLKKYITQKSFK-----------LEKAHKKKRNAARPPSELNNSVS--- 165
           + G+P  TE   +   ++++              L  A        R P  LN       
Sbjct: 116 ENGVPVDTELSSVASKMSRRPVVSLENNPLTDELLMSAAANVDLGFRMPKFLNKGSRSSS 175

Query: 166 ------------------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKI 207
                             WR+ GIKYKKNE FLD+ E IN+L+++ G +L+S + G+V +
Sbjct: 176 SVSSPANGDEHGDPCAYPWRSSGIKYKKNEIFLDVNERINILVSKDGSILKSYVDGSVDL 235

Query: 208 KSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG---KKRKT 264
            + LSG P  + G+ND    +  L+G  +  ++         ++E  + N     K    
Sbjct: 236 TTHLSGTPLCQFGLND----SLSLDGGTLSRDL-------DFISEYEVKNKKAIPKAAAG 284

Query: 265 NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSK 323
           +++LED KFHQCV+L++F  ++II F+PPDG F+LM Y +  ++  P     +     + 
Sbjct: 285 SVQLEDCKFHQCVQLNRFNTDRIIRFVPPDGSFELMRYHVRDNLNLPFKITPIFSVRSNN 344

Query: 324 SRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSF 383
             +E R   K+    K  A +V + IPVP          S+G  ++VPE++A+LWK   +
Sbjct: 345 GAVEYRVALKSLFPSKLTAKDVVLRIPVPPGTVDCKINTSNGRCRFVPEENAVLWKFAKY 404

Query: 384 PGGKEYAMFAEMGLPSMDSYEEPKVKR----PVQVKFEIPYFTTSGIQVRYLKINEPKLQ 439
            G  E  + A + +P MD+     +++    P+ + FEI  F+ SG+ VR+ K++E    
Sbjct: 405 QGLTENTLSA-LTVP-MDNQSSLNLQQWSRPPMSLTFEILMFSNSGLVVRFFKVSERDHS 462

Query: 440 YKSYPWVRYITQSGDDYTIR 459
           Y +  WV+YI++SG  Y +R
Sbjct: 463 YHTVKWVKYISRSG-AYEVR 481

>NCAS0C03580 Chr3 complement(715761..717236) [1476 bp, 491 aa] {ON}
           Anc_3.165
          Length = 491

 Score =  202 bits (513), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 143/503 (28%), Positives = 254/503 (50%), Gaps = 57/503 (11%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M +A+     +G+ ++S+ +K  +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MINALLIFTARGELVVSKLFKGSMKRSIADIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QH---NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           +    ++L++VA++ +  V+ A ++ FL+KL  +L  Y     EE +++ F+I++EL+D 
Sbjct: 58  KSTRGDNLWIVAVSRN-NVDSAAIWEFLYKLDSLLDSY-GLNHEEYLKEEFMIVHELLDV 115

Query: 118 MM--DYGIPQITEPRMLKKYITQKSFK--LEKAHKK------------------------ 149
           MM    GIP +TE  ++   ++ K  K  LE  +                          
Sbjct: 116 MMCGSGGIPMLTENSLVISRMSVKPSKSILEAQNSGNGSSNTNSNNNNNNVPDLLMSGPK 175

Query: 150 --KRNAARPPSELN--NSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAV 205
             +RN+A    +L+      WR +GI +KKNE  L + E IN+L+++ G VL++ + G++
Sbjct: 176 LLRRNSASLSQDLSILTDFKWRPKGIVHKKNEVILHVNERINILVSKDGSVLKAYVDGSI 235

Query: 206 KIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKT- 264
            +++ LSG P  + G+ND       L  + +  ++     H     + +     KK+ + 
Sbjct: 236 DLETHLSGTPICQFGLNDS------LSVSGVDSDMYGSHNHNHHFGDVNFDKTDKKQLSM 289

Query: 265 ----NIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQ 319
               ++ LED KFHQCV L KF+ ++II F+PPDG  +LM Y +  ++  P     +   
Sbjct: 290 ASVGSVILEDCKFHQCVSLDKFDKDRIIKFVPPDGSMELMKYHVRDNLNLPFKVSPIVTN 349

Query: 320 VHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWK 379
             + + +E R   K+    +  A NV + IPVP +        ++GS K++PE+SA++W+
Sbjct: 350 TRNGTALEYRITMKSLFPGRLSAKNVALHIPVPPNTMDCKINVTNGSCKFIPEESAMIWR 409

Query: 380 IKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEP 436
              F G  E  + A + +P+ D+ +   +   K P+ + FEI  F+ SG+ VRY  I E 
Sbjct: 410 FNKFNGLTENTLSA-VTIPTKDNTQLSLQQWSKPPMSLDFEILMFSNSGLVVRYFTITER 468

Query: 437 KLQYKSYPWVRYITQSGDDYTIR 459
             +YK+  W++YI++SG  Y IR
Sbjct: 469 DQKYKAVKWIKYISRSG-SYEIR 490

>CAGL0C05203g Chr3 (496561..497988) [1428 bp, 475 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062c APM4
          Length = 475

 Score =  195 bits (495), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 254/498 (51%), Gaps = 63/498 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M SAV     +G+ ++S+ +K+++  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MISAVLVFSSRGELIVSKFFKNNLKRSISDIFRIQVINNLD---VRSPILTLGSTTFQHI 57

Query: 61  QHN----DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMD 116
           + N    DL++V++  S  +N   V+ FL+K   +L E      EE +++ F++ YEL+D
Sbjct: 58  RSNVHGDDLWLVSVTRS-NINCGAVWEFLYKFDHML-ELYGLNNEEFLKEEFMVCYELLD 115

Query: 117 EMM-DYGIPQITEPRMLKKYITQK-------SFKLEKAHKK----------KRNAARPPS 158
            M+ + G P  T+P  + K ++ K       +F +   +K           +R ++    
Sbjct: 116 VMLGENGTPMDTDPATVIKKMSVKPSKETIENFAISVQNKNSTLPKIPKFLRRTSSFLNQ 175

Query: 159 ELNNSVS----------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIK 208
           E +N+ S          WR +GI +KKNE FL + E I++L++++G +L+S + G + + 
Sbjct: 176 ESSNNSSGAFNMAGELPWRPKGISHKKNEIFLYVNEKISILVSKEGSILKSYVDGTIDLV 235

Query: 209 SRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIEL 268
           + LSG P  + G+ND    +  ++ ++ G +  D  ++   + +++          ++ L
Sbjct: 236 THLSGTPVCQFGLND----SLSVKNDDYGDSF-DYIKNKKAIPKAA--------AGSVLL 282

Query: 269 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIE 327
           ED KFHQCV L KF+ ++II F+PPDG  +LM Y + ++I  P     +     S + +E
Sbjct: 283 EDCKFHQCVSLEKFDKDRIIKFVPPDGSMELMKYHVRSNINLPFKVSPIVTYSSSGTAVE 342

Query: 328 IRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK 387
            R   K+    K  A NV + IPVP +        S+GS K+ PE+ A+LW    + G  
Sbjct: 343 YRITLKSLFPSKLTAKNVTMKIPVPPETLDCKIDVSNGSCKFAPEEKAMLWTFNKYNGLT 402

Query: 388 EYAMFAEMGLPSMDSYEEPKV------KRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYK 441
           E  + A     ++ S + P++      K P+ + FEI  F+ SG+ VRY  I E + +YK
Sbjct: 403 ENTLSA----VTITSKDAPRLNIQQWQKPPISLDFEIMMFSNSGLVVRYFTIKESE-RYK 457

Query: 442 SYPWVRYITQSGDDYTIR 459
           +  W+RY+++SG  Y IR
Sbjct: 458 TVKWIRYVSKSG-SYEIR 474

>SAKL0D13090g Chr4 (1093315..1094814) [1500 bp, 499 aa] {ON} weakly
           similar to uniprot|P38700 Saccharomyces cerevisiae
           YHL019C APM2 homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 499

 Score =  195 bits (495), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 143/536 (26%), Positives = 251/536 (46%), Gaps = 113/536 (21%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S +Y  D+  +PL+ + +K    +S  ++   L      +  ++P   ++ GI +++I
Sbjct: 1   MSSCIYILDETLQPLIYKNFK---AISNGEESIELFQQAHSKHPMVP-VFHYKGIHFVYI 56

Query: 61  QHNDLYVVALATSLT--------VNIAEVFAFLHKLMGVLGEYLKT--VEEESIRDNFVI 110
           + +  Y ++    +          N+  +  +L     +L  Y  +  +    I DNF +
Sbjct: 57  RRDGFYFISAVELVAEASNKKSHFNVMAILTYLENFYTLLKRYFNSQKLNRWLIVDNFHL 116

Query: 111 IYELMDEMMDYGIPQITEPRMLKKYI-TQKSFKLEKAHKKKRNAARP--------PSELN 161
           IYEL+DE +D+G+PQ+T+  +++ YI  Q +   E A   K+ + +          S +N
Sbjct: 117 IYELLDESLDFGVPQLTDYNIIQDYIKVQVNLHDELADSSKKISKKEDLHGFEDDESYMN 176

Query: 162 --------NSVSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLS 212
                   +++SWR +GI Y KNE FLD++E I   +   K ++ ++ + G ++ +S LS
Sbjct: 177 SFIARTTTSAISWRPKGIHYTKNEFFLDVIEEIEYCMDFNKSKIRKNFVHGRIRCRSYLS 236

Query: 213 GMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLK 272
           GMP LK+G+                               S IT+   K +    + + K
Sbjct: 237 GMPKLKIGL-------------------------------SKITSSLPKEREQF-MNNAK 264

Query: 273 FHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-----PLIWCDVSIQVHSKSRIE 327
           FHQCV L   + + I++FIPPDGEF L  Y+L   ++      L+  DV  +   + +I 
Sbjct: 265 FHQCVSLEDLQ-KNIVSFIPPDGEFQLCEYKLKRHVRDPPVIKLVKFDVKKEEKKRPKIL 323

Query: 328 IRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWK 379
           I        K ++  + + I IP+         D A  P FK   G++ +      +LW+
Sbjct: 324 ISLTITTDFKSQNSTSVLNIRIPLTKIFSEYQIDLAKPPRFKCDQGNVLFNLTDDLLLWE 383

Query: 380 IKSFPGGK---EYAMFAEMGLPSMDSYEE-----------------PKVK---------- 409
           + S  GG    E++M+ E  L   + Y++                 PK++          
Sbjct: 384 VGSIKGGHAQTEHSMYCEFRLYDEEEYKKQLEELKNSMDPPPLRQGPKLEELYKQVHENE 443

Query: 410 -----RPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
                R V ++FEIPY+T SG++V+YLKI E +LQY S+PWVRY T + ++Y  ++
Sbjct: 444 NTNRSRLVSMEFEIPYYTCSGLKVQYLKIEEDQLQYHSFPWVRYKTVNDEEYAYQI 499

>TDEL0D04580 Chr4 (840369..841817) [1449 bp, 482 aa] {ON} Anc_3.165
           YOL062C
          Length = 482

 Score =  189 bits (479), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 140/502 (27%), Positives = 243/502 (48%), Gaps = 64/502 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M SA+     +G+ ++++  K  +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MISAILIFSSRGELIVAKTMKSSLKKSISDIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           + +    L++VA++ S   N   ++ FL+KL  ++  Y  T +E ++++NF+  YE++D 
Sbjct: 58  RSDGSDSLWLVAVSRS-NANSGAIWEFLYKLNVIMDVYGLT-KEGTLKENFMNCYEILDT 115

Query: 118 MMDYG-IPQITE------------PRMLK-------KYITQKSFKLEKAHKKKRNAARPP 157
           +++ G IP  TE            P+ +          +T  S  L          + P 
Sbjct: 116 VLEEGGIPVDTELNSVISKMTVKPPKQISGNLLDRPDLLTMSSLNLSTPGDSSSTLSMPK 175

Query: 158 --------------SELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIG 203
                         S   +++SWR  GIKYKKNE  L++ E I++L+++ G +L+S + G
Sbjct: 176 FLTRNNRSMSQDLGSNYPSNLSWRPHGIKYKKNEVLLNVNEKISILVSRDGSILKSYVDG 235

Query: 204 AVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQ--EHGSGVAESSITNDGKK 261
            + + + LSGMP  + G+ND           ++ V   D    E      + +I      
Sbjct: 236 TIDLTTHLSGMPICQFGLND-----------SLSVEFGDDSISEVEDFANKKAIPKAAAG 284

Query: 262 RKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQV 320
           R   + LED KFHQCV L KF  +++I F+PPDG  +LM Y +  ++  P     +   +
Sbjct: 285 R---VMLEDCKFHQCVSLDKFNKDRVIKFVPPDGSMELMKYCVRDNLNLPFKVTPIVTSI 341

Query: 321 HSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKI 380
              + I+ R   K+    K  A +V + IPVP          S+G  K+VPE+SA++WK 
Sbjct: 342 GRGNTIDYRVTLKSLFPGKLSAKDVSLRIPVPPGTVDCEINVSNGKCKFVPEESAMIWKF 401

Query: 381 KSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPK 437
             + G  E  + A + +PS D+ +   +   + P+ + FEI  F+ SG+ VRY K+++  
Sbjct: 402 TKYTGLTENTLSA-VTVPSSDTTQLTVQQWPRPPMSLNFEIMMFSNSGLVVRYFKVSDKD 460

Query: 438 LQYKSYPWVRYITQSGDDYTIR 459
            +Y++  W++YI++SG  Y IR
Sbjct: 461 ERYRTAKWIKYISKSG-SYEIR 481

>Kpol_1045.44 s1045 complement(103089..104498) [1410 bp, 469 aa]
           {ON} complement(103091..104500) [1410 nt, 470 aa]
          Length = 469

 Score =  187 bits (474), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 236/495 (47%), Gaps = 63/495 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M + V     KG+ ++S+  K +   S  D F   + +  D   V  P +      +  I
Sbjct: 1   MINGVLVYTGKGELIVSKFSKSNAKRSISDIFRVQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHND---LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           + N    L++VA+  S   N   ++ FL+K   +L  +     E ++++ F+  YEL+D 
Sbjct: 58  RSNSRDHLWLVAVTRS-NANSGAIWEFLYKFDSLLNAF-GLDNETTLKEEFMTCYELLDL 115

Query: 118 MMDY-GIPQITEPRMLKKYITQKSFKLEKAHK-----------------KKRNAARPPSE 159
           M++  G+P  TE   +   ++ K      +                    + N +     
Sbjct: 116 MLNVDGVPLDTELSSVSAKMSTKPLHSINSPSDSSLDNSSSPLSISKFLNRNNRSMSVDT 175

Query: 160 LNNSVS---WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPD 216
           +N   S   WR  GIKYKKNE FL+I E I++L+++   +L++ + G V + S LSG P 
Sbjct: 176 MNTEPSNYPWRPNGIKYKKNEIFLNINEKISILVSKDETILKAYVDGTVDLTSHLSGTPT 235

Query: 217 LKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIE--------L 268
            + G+ND              +++ +P  + S        ++G + + NI         L
Sbjct: 236 CQFGLND-------------SLSVDEPNYYNSD-------DNGFRNQQNIPRATAGTVVL 275

Query: 269 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQVHSKSRIE 327
           ED KFH+CV L KF  ++II F+PPDG  +LM Y +  +I  P       I   S++ ++
Sbjct: 276 EDCKFHECVSLDKFNRDRIIKFVPPDGHIELMKYHVRDNINLPFKVTPNVINSRSRTGLD 335

Query: 328 IRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK 387
            R   K+    K  A +V + IPVP          S+G  ++VPE+S I+WK   + G  
Sbjct: 336 YRITLKSLFPSKLSANDVVLKIPVPSSTVDCKLNVSNGKCRFVPEESCIIWKFAKYNGLT 395

Query: 388 EYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYP 444
           E  + A + + S D+ +   +   + P+ + FEI  F+ SG+ VRYLKI E   +Y++  
Sbjct: 396 ENKLSA-VTVSSNDTTQLMLQQWARPPISLDFEIMMFSNSGLVVRYLKIMEKDQKYRTVK 454

Query: 445 WVRYITQSGDDYTIR 459
           W++YI++SG  Y +R
Sbjct: 455 WIKYISRSG-SYEVR 468

>ABR047W Chr2 (479283..480779) [1497 bp, 498 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHL019C (APM2)
          Length = 498

 Score =  187 bits (476), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 136/482 (28%), Positives = 221/482 (45%), Gaps = 117/482 (24%)

Query: 48  PCINHNGIEYLFIQHNDLYVVALATSL-TVNIAEVFAFLHKLMGVLGEYL-KTVEEESIR 105
           P ++H G +Y++IQ + LY ++L+  + TV    VFA+L +L  +  +YL + +  + I 
Sbjct: 41  PVLSHRGYDYIYIQRDGLYFLSLSYGVETVVPMTVFAYLGQLYQLFKKYLGERLNRQLIM 100

Query: 106 DNFVIIYELMDEMMDYGIPQITEPRMLKKYI-------TQKSFKLEKAHKKKRNAARPPS 158
           DNF ++YELMDE +D GIPQ+T+  +++ Y+        +   K    HK KR+ A    
Sbjct: 101 DNFHLVYELMDESIDMGIPQLTDHNIIRDYVKVQVVRRAEDGEKHAGKHKAKRDKAGKEE 160

Query: 159 E-------------------LNNSVSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLR 198
           E                     +++SWR  GI Y KNE FLD+VE +  L+  ++ QV  
Sbjct: 161 EEADPGAADEHFMNSYIAKTTTSAISWRPRGIYYSKNEFFLDVVEELEYLMDFERAQVRL 220

Query: 199 SEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITND 258
           +++ GA+  +S LSGMP L +G+N                 +   ++  S V        
Sbjct: 221 NQVHGAINCRSYLSGMPQLTVGLNKM---------------VAQDRDFTSQV-------- 257

Query: 259 GKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSI--KPLI---W 313
                         FHQCV L +   ++ ITF+PPDGEF L +Y+L      +PLI    
Sbjct: 258 -------------HFHQCVDLERLATDRHITFVPPDGEFQLCHYKLARGANEQPLIKLEE 304

Query: 314 CDVSIQVHSK----SRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFK 361
           C  +++   +     R+ +        K +   + +++ +P+         D +  P FK
Sbjct: 305 CRAAVKPRRRPADADRLVLTVSISTNFKLQDATSVLKVRVPLARVFEQWKVDLSFPPRFK 364

Query: 362 YSHGSIKYVPEQSAILWKI---KSFPGGKEYAMFAEMGL--------------PSMDS-- 402
              G + +      +LW I   K   G + + M ++  L               SMD   
Sbjct: 365 CDAGCVMFNITDDYLLWDIGKAKGSHGDRRFTMQSQFHLYDEAYYSRRRAQLSTSMDPLP 424

Query: 403 ----------YEEPKVKRP------VQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWV 446
                     Y +     P      ++V FE+PY T SG++V +LKI EP+LQY+S+PW+
Sbjct: 425 AHPGQQLEALYNQTHASAPTHASALLRVDFEVPYHTISGLKVEFLKILEPQLQYQSFPWI 484

Query: 447 RY 448
           RY
Sbjct: 485 RY 486

>YOL062C Chr15 complement(210520..211995) [1476 bp, 491 aa] {ON}
           APM4Mu2-like subunit of the clathrin associated protein
           complex (AP-2); involved in vesicle transport
          Length = 491

 Score =  186 bits (472), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 140/510 (27%), Positives = 247/510 (48%), Gaps = 71/510 (13%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M S V     +G+ +L++ +K+ +  S  D F   ++ +L+  S V+   +      ++ 
Sbjct: 1   MISGVLVYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEM 118
            +H D L++V +  S   N A ++ FL+KL  V+  Y +   EE++++ F+I++E++D M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITEPRMLKKYITQKSFK---------------------------LEKAHKKK 150
           +   GIP  TE   L   I Q S K                             + H  K
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNMGGLLDSPDGNDVLSSSSSPTSSAGELHFPK 173

Query: 151 RNAARPPSEL-----------NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRS 199
               R  S L           NN ++WR +GI +KK+E FL + E IN+L+++ G +L+S
Sbjct: 174 FLTKRSSSFLGQGDSTSDFYDNNKITWRPKGIIHKKDEVFLYVNERINILVSRDGSILKS 233

Query: 200 EIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG 259
            + G + I + LSG P  + G+ND           ++G+   D ++  +     S ++ G
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLND-----------SLGMQSEDEKKWLAQQQRHSGSDFG 282

Query: 260 KKR------KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLI 312
            K         ++ LED KFH+CV L KF    II F+PPDG  +LM Y +  +I  P  
Sbjct: 283 NKNFIPKAAAGSVLLEDCKFHECVSLDKFNRNHIIEFVPPDGSMELMKYHVRDNINLPFK 342

Query: 313 WCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPE 372
              +       + I+ R   K+    K  A +V + IPVP          S+G  K+VPE
Sbjct: 343 VTPIVTHSTRDNEIDYRITLKSLFPGKLSAKDVVLHIPVPPSTVDCKISVSNGHCKFVPE 402

Query: 373 QSAILWKIKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVR 429
           ++A++W+   + G  E  + A + + + D+ +   +   + P+ ++FE+  F+ SG+ VR
Sbjct: 403 ENAMIWRFNKYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPISLEFEVMMFSNSGLVVR 461

Query: 430 YLKINEPKLQYKSYPWVRYITQSGDDYTIR 459
           Y  I+    ++++  W++YI+++G  Y +R
Sbjct: 462 YFTISGKDSKHRAVKWIKYISKAG-SYEVR 490

>Kwal_26.8146 s26 (665689..667206) [1518 bp, 505 aa] {ON} YHL019C
           (APM2) - Similiar to clathrin coat proteins [contig 55]
           FULL
          Length = 505

 Score =  186 bits (472), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 155/551 (28%), Positives = 249/551 (45%), Gaps = 137/551 (24%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S+++  D++  PL+ + +K    +   + F+    ++   S V  P I H GI ++ I
Sbjct: 1   MSSSIFLLDEQLNPLIVKSFKS---VQHPEAFAYRFKEVYKVSNV--PVIYHKGIVFISI 55

Query: 61  QHNDLYVVALAT-SLTVNIAEVFAFLHKLMGVLGEYLK--TVEEESIRDNFVIIYELMDE 117
             + LY V+++  SL  +I     +L+    +L +YL+   ++   I DNF +IYEL+DE
Sbjct: 56  CRDGLYFVSMSVGSLRSSIMSTLVYLNDFHMLLKKYLRVNALDRTRIVDNFNLIYELLDE 115

Query: 118 MMDYGIPQITEPRMLKKYI-----------------------TQKSFKLEKAHKKKRNAA 154
            +D+GIPQ+T+  +++  I                        ++S   E   K  ++  
Sbjct: 116 SLDFGIPQLTDFNIIRDSIKIQPNIPPDPKIARSNSDDDESEQEESNVAETQEKSNKHGF 175

Query: 155 RPPSELNNS---------VSWRAEGIKYKKNEAFLDIVESINMLITQK-GQVLRSEIIGA 204
           +   E  NS         +SWR +GI Y KNE F+D++ES   ++  K  QV ++ I G 
Sbjct: 176 QDDEEYINSFVLRTTTQAISWRPKGIYYAKNELFVDVIESQAYVMDFKHHQVRKNFIFGR 235

Query: 205 VKIKSRLSGMPDLKLGIN----DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGK 260
           +  +S LSGMP +K+ IN    DR  F                                 
Sbjct: 236 IICRSYLSGMPVVKICINKMLKDRDQF--------------------------------- 262

Query: 261 KRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-----PLIWCD 315
                  L   KFHQCV L    ++  I FIPPDG+F L  Y++   I       LI   
Sbjct: 263 -------LSSAKFHQCVSLESLSSQDFIEFIPPDGDFQLCEYKIKRHISDSPVIKLIEYK 315

Query: 316 VSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADT--------PSFKYSHGSI 367
           V ++   K +++I  + +   K ++ A  + I +P+ D  +T        P FK   GSI
Sbjct: 316 V-VEKPKKHKLQISMKIQPHFKAQNSATFLDIRVPIQDIFETYKIDLTKQPRFKCDFGSI 374

Query: 368 KYVPEQSAILWKIKSFPGGK---------EYAMF--------AEMGLPSMD--------- 401
            +      +LWK     GG          E+ +F        AE    SMD         
Sbjct: 375 LFNLSDGYLLWKANGMKGGHGETYHSMQVEFFLFDAEAHRKEAEELKNSMDPPPLREGVR 434

Query: 402 -------SYEEP-KVKRPVQ----VKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYI 449
                  ++EE  ++  PV+     +FE+PYFT+SG++V YLKI E +LQY+S+PWVRY 
Sbjct: 435 MEELYALAHEEKGQINNPVRNMITAEFEVPYFTSSGLRVEYLKIEEEQLQYQSFPWVRYK 494

Query: 450 TQSGDDYTIRV 460
           T +  +Y  ++
Sbjct: 495 TINDTEYAFQM 505

>ADR315W Chr4 (1259839..1261317) [1479 bp, 492 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL062C (APM4)
          Length = 492

 Score =  183 bits (464), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 117/369 (31%), Positives = 186/369 (50%), Gaps = 43/369 (11%)

Query: 79  AEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITEPRMLKKYITQ 138
           A ++ FL+ +  +L  Y    EE ++ D+F++ YEL+D ++D G+PQ TE   +   +++
Sbjct: 76  AAIWEFLYHMNKLLDAYAINTEE-ALLDDFMLCYELLDVVLDSGLPQDTELSHIVPLLSR 134

Query: 139 KSFKLEKAHKKK-RNAARPPSELNNSVS-------------WRAEGIKYKKNEAFLDIVE 184
           K    E A      N+AR       +VS             WR EGIKYKKNE +LD++E
Sbjct: 135 KPATGESASGDDFLNSARLRRTGTKNVSVETLDHFSRDVCPWRGEGIKYKKNEVYLDVIE 194

Query: 185 SINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQ 244
            +++L+ + G +L++ + G V+  + LSGMP    G ND     +             P+
Sbjct: 195 KLSLLVNRDGTILKAYVDGTVQCTAHLSGMPLCHFGFNDSQSLRQRSPRRQYA-----PR 249

Query: 245 EHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 304
             G+   ES +            LED KFHQCV+L+KF+ E++I F+PPDGEF+LM Y +
Sbjct: 250 VFGTDERESVV------------LEDCKFHQCVQLNKFDQERVIRFVPPDGEFELMKYHI 297

Query: 305 TTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSH 364
              ++P       +   ++  IE R   ++    K  A +V++ IP P    +     S 
Sbjct: 298 RDDLRPPFKVTPVVSKVNERSIEYRITLQSLFPTKLSAKDVELYIPAPPYTISAKVNVSC 357

Query: 365 GSIKYVPEQSAILWKIKSFPGGKEYAMFA-----EMG--LPSMDSYEEPKVKRPVQVKFE 417
           G  K+VPE++AI+WKI  F G  E  + A     E G     +D +  P    P+ +K E
Sbjct: 358 GKCKFVPEENAIIWKIHKFHGLTENTLSAVTIADEQGHYAQVLDQWPRP----PISMKLE 413

Query: 418 IPYFTTSGI 426
           I  F+T+ +
Sbjct: 414 IMMFSTAAL 422

>ZYRO0B04840g Chr2 (389669..391099) [1431 bp, 476 aa] {ON} highly
           similar to uniprot|Q99186 Saccharomyces cerevisiae
           YOL062C APM4 Clathrin associated protein medium subunit
          Length = 476

 Score =  182 bits (461), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 141/496 (28%), Positives = 245/496 (49%), Gaps = 58/496 (11%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M +A++    +G+ ++S+ + + +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MINAIFIYSTRGELIVSKLFNNSLKRSISDIFRIQVINNLD---VRSPILTLGSTTFHHI 57

Query: 61  QHN---DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           + N    L++V ++ +   N   ++ FL+K   +L  Y  T +EE ++++F+I YE++D 
Sbjct: 58  RSNGSDSLWIVTVSRT-NANSGAIWEFLYKFNAILDAYDLT-KEEKLKEDFMICYEILDV 115

Query: 118 MMDYG-IPQITEPRMLKKYIT---QKSFKLEKAHKKKRNAARPPSEL------------- 160
           ++  G IP  TE   +   I+    KS       K    A  P S L             
Sbjct: 116 VIGAGGIPMDTELGSIASKISVKPPKSGGTSSEPKSSTVANFPGSNLSTSNLSMPKFLTR 175

Query: 161 -NNSVS------------WRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKI 207
            N S+S            WR  GIKYKKNE FL + E IN+L+++ G +L++ + G + +
Sbjct: 176 NNRSMSQDLGTNYPSNFPWRPNGIKYKKNEVFLYVNEKINILVSRDGSILKAYVDGTIDM 235

Query: 208 KSRLSGMPDLKLGINDRGIFTKYLE-GNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNI 266
            + LSG P  + G+ND    +  +E G+++ +   D QE  +  A        K    ++
Sbjct: 236 TTHLSGTPICQFGLND----SPSVEFGDSLWL---DTQEFHNKKAVP------KAAAGSV 282

Query: 267 ELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRI 326
            LED KFHQCV L KF  E+II F+PPDG  +LM Y +  ++  L +    +     S +
Sbjct: 283 MLEDCKFHQCVSLDKFNKERIIKFVPPDGNMELMKYCVRDNLN-LPFKITPVVTPCGSTV 341

Query: 327 EIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGG 386
           E R   K+    K  A +V + IPVP          S+G  K+  E++A++W+   + G 
Sbjct: 342 EYRITLKSLFPNKLSAKDVALHIPVPPGTVDCKINISNGKCKFESEENAMVWRFNKYHGL 401

Query: 387 KEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSY 443
            E  + A + +P+ D+ +   +   + P+ + FEI  F+ SG+ VRY ++++   +Y+  
Sbjct: 402 TENTLSA-VTVPTSDTTQLTLQQWPRPPMSLGFEIMMFSNSGLVVRYFRVSDKDEKYRVV 460

Query: 444 PWVRYITQSGDDYTIR 459
            W++YI++SG  Y +R
Sbjct: 461 KWIKYISKSG-SYEVR 475

>Smik_15.96 Chr15 complement(174750..176225) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  182 bits (462), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/504 (27%), Positives = 241/504 (47%), Gaps = 59/504 (11%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M S V     +G+ +L++ +K+ +  S  D F   ++ +L+  S V+   +      ++ 
Sbjct: 1   MISGVLIYSSRGELVLNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEM 118
            +H D L++V +  S   N A ++ FL+KL  V+  Y +   EE++++ F+I++E++D M
Sbjct: 59  SRHGDNLWLVTITRS-NANSAAIWEFLYKLDFVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITEPRMLKKYITQKSFK----------------------------------- 142
           +   GIP  TE   L   I Q S K                                   
Sbjct: 117 LGGNGIPIDTE---LNSVIAQMSVKPVRNTGGLLDSPDGNDMLSSSSSPSSVSGELHFPK 173

Query: 143 -LEKAHKKKRNAARPPSEL--NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRS 199
            L+K+           S+    N ++WR +GI +KK+E FL + E +N+L+++ G +L+S
Sbjct: 174 FLKKSSSSFLGQGDSASDFYDGNKITWRPKGITHKKDEVFLYVNERMNILVSRDGSILKS 233

Query: 200 EIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG 259
            + G + I + LSG P  + G+ND    +  ++  +    +   Q H  G  ES      
Sbjct: 234 YVDGTIDITTHLSGTPICRFGLND----SLGMQSEDEKKWLAQQQHHSRGNFESK-NFIH 288

Query: 260 KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSI 318
           K    ++ LED KFH+CV L KF     I F+PPDG  +LM Y +  +I  P     +  
Sbjct: 289 KAAAGSVLLEDCKFHECVSLDKFNKNHTIEFVPPDGSMELMKYHVRDNINLPFKITPIVT 348

Query: 319 QVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILW 378
                + I+ R   K+    K  A +V + IPVP          S+G  K+VPE++A++W
Sbjct: 349 HSTRDNEIDYRITLKSLFPGKLSAKDVTLHIPVPPSTVDCKISVSNGHCKFVPEENAMMW 408

Query: 379 KIKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKINE 435
           +   + G  E  + A + + + D+ +   +   + P+ + FE+  F+ SG+ VRY  I  
Sbjct: 409 RFNKYNGLTENTLSA-VTVSTSDTTQLNLQQWTRPPMSLDFEVMMFSNSGLVVRYFTIFG 467

Query: 436 PKLQYKSYPWVRYITQSGDDYTIR 459
              ++++  W++YI++SG  Y +R
Sbjct: 468 KDSKHRAVKWIKYISRSG-SYEVR 490

>Skud_15.91 Chr15 complement(169608..171083) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  180 bits (456), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 133/507 (26%), Positives = 245/507 (48%), Gaps = 65/507 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M S V     +G+ +L++ +K+ +  S  D F   ++ +L+  S V+   +      ++ 
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLDVRSPVL--TLGSTTFHHIR 58

Query: 60  IQHND-LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEM 118
            +H D L++V +  S   N A ++ FL+KL  V+  Y +   EE++++ F+I++E++D M
Sbjct: 59  SKHGDNLWLVTITRS-NANSAAIWEFLYKLDAVMNAY-RLDREEALKEEFMIVHEMLDIM 116

Query: 119 MD-YGIPQITEPRMLKKYITQKSFK---------------------------------LE 144
           +   GIP  TE   +   ++ K  +                                 L+
Sbjct: 117 LGGNGIPIDTELNSVVARMSVKPMRNTGGLLDGADGSDILSSSSSPSSAGGELHFPKFLK 176

Query: 145 KAHKKKRNAARPPSEL--NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII 202
           K+           S+   +N ++WRA GI +KK+E FL + E +N+L+++ G +L+S + 
Sbjct: 177 KSSSSFLGQGDSTSDFYDSNKITWRATGIIHKKDEVFLYVNERMNILVSRDGSILKSYVD 236

Query: 203 GAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKR 262
           G + I + L+G P  + G+ND           ++G+   D +   +   + S ++ G K 
Sbjct: 237 GTIDIVTHLNGTPVCRFGLND-----------SLGMQSEDEKNWLAQQHQHSRSDFGNKN 285

Query: 263 ------KTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCD 315
                   ++ LED KFH+CV + KF    II FIPPDG  +LM Y +  +I  P     
Sbjct: 286 FLPKAAAGSVLLEDCKFHECVSIEKFNKNHIIEFIPPDGSMELMKYHVRDNINLPFKITP 345

Query: 316 VSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSA 375
           +       + I+ R   K+    K  A +V + IPVP          S+G  K+VPE++A
Sbjct: 346 IVSHSTRDNEIDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGHCKFVPEENA 405

Query: 376 ILWKIKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLK 432
           ++W+   + G  E  + A   + + D+ +   +   + P+ + FE+  F+ SG+ VRY  
Sbjct: 406 MIWRFNKYNGLTENTLSAAT-VSTSDTTQLSFQQWTRPPMSLDFEVMMFSNSGLVVRYFT 464

Query: 433 INEPKLQYKSYPWVRYITQSGDDYTIR 459
           I+    ++++  W++YI++SG  Y +R
Sbjct: 465 ISGKDSKHRAVKWIKYISKSG-SYEVR 490

>KLTH0D07502g Chr4 (650799..652313) [1515 bp, 504 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 504

 Score =  180 bits (456), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 153/545 (28%), Positives = 241/545 (44%), Gaps = 126/545 (23%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S V+  D++  PL+ R  K    ++  + ++     +  +S    P I   GI Y++I
Sbjct: 1   MSSCVFILDEQLNPLILRNLKS---IAHPEWYALYFKRVHPQSR--GPVIYSKGIIYIYI 55

Query: 61  QHNDLYVVALATS-LTVNIAEVFAFLHKLMGVLGEYLKT--VEEESIRDNFVIIYELMDE 117
             + LY V+++   L  N+  + A+L+    +L +YLK   V+   I DNF +IYEL DE
Sbjct: 56  LRDGLYFVSVSNGGLRFNLMGILAYLNDFHALLVKYLKVNKVDRTGIIDNFNLIYELFDE 115

Query: 118 MMDYGIPQITEPRMLKKYITQKSF----------------------KLEKAHKKKRNAAR 155
            +DYGIPQ+T+  +++  I  ++                         E   K   +  R
Sbjct: 116 SLDYGIPQLTDYNIIRDSIKIEANVPKVPSNSQADSDEESGPEILQSKENKDKADIHGFR 175

Query: 156 PPSELNNS---------VSWRAEGIKYKKNEAFLDIVESINMLITQK-GQVLRSEIIGAV 205
              +  NS         +SWR +GI Y KNE F+DI+E  + L+  K  QV ++ + G +
Sbjct: 176 DDEQYINSFVLRTTTQAISWRPKGIYYTKNELFVDIIERQSYLMDFKNSQVRQTFVYGKI 235

Query: 206 KIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTN 265
             +S LSGMP +++ IN      K L+  ++ +        GS                 
Sbjct: 236 NCRSYLSGMPIVRVCIN------KMLKDKDLFL--------GSS---------------- 265

Query: 266 IELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK--PLI-WCDVSI-QVH 321
                 KFHQCV L    ++  I FIPPDG+F L  Y+L   I   P+I   D  I +  
Sbjct: 266 ------KFHQCVSLESLSSQDYIEFIPPDGDFQLCEYKLKRHINDSPIIKLIDYKINERQ 319

Query: 322 SKSRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQ 373
            K R+ +    +   K ++ A  ++I IP          D    P FK  HGS+ +    
Sbjct: 320 KKHRLHLSVTIQPHFKAQNSATALKIHIPTRDLFQNYKIDLTKAPRFKCDHGSVFFNLSD 379

Query: 374 SAILWKIKSFPGGK---EYAMFAEMGL--------------PSMDS------------YE 404
             +LW  +   GG     Y+M  E  L               SMD             Y 
Sbjct: 380 ELLLWDAQGIKGGHGETSYSMHVEFALFDEEEHARKLEQIKKSMDPPPLREGAHLEELYA 439

Query: 405 EPKVKR---------PVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDD 455
           + K  +          +  +FE+PY+T+SG++V YLKI+E  L+Y+S+ WVRY T +  +
Sbjct: 440 QVKSNKEGKGQFQSNAITAEFEVPYYTSSGLRVEYLKISEENLKYQSFSWVRYKTINDTE 499

Query: 456 YTIRV 460
           Y  +V
Sbjct: 500 YAYQV 504

>Suva_15.103 Chr15 complement(183026..184501) [1476 bp, 491 aa] {ON}
           YOL062C (REAL)
          Length = 491

 Score =  178 bits (451), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 140/506 (27%), Positives = 243/506 (48%), Gaps = 63/506 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M S V     +G+ +L++ +K+ +  S  D F   + +  D   V  P +      +  I
Sbjct: 1   MISGVLVYSSRGELILNKFFKNSLKRSISDIFRVQVINNLD---VRSPVLTLGSTTFHHI 57

Query: 61  QH---NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           +    ++L++V +  S   N A ++ FL+KL  V+  Y +   EE++++ F+I++E++D 
Sbjct: 58  RSMRGDNLWLVTITRS-NANSAAIWEFLYKLDSVMNAY-RLDREEALKEEFMIVHEMLDI 115

Query: 118 MMD-YGIPQITEPRMLKKYITQKSFK--------LE-------------------KAHKK 149
           M+   GIP  TE   L   I Q S K        LE                   + H  
Sbjct: 116 MLGGNGIPIDTE---LNSVIAQMSVKPIRNVGGLLESPDSIDMLSSTSSPSSVGGELHFP 172

Query: 150 KRNAARPPSELN-----------NSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLR 198
           K    R  S L            N ++WR +GI +KK+E FL + E +N+L+++ G +L+
Sbjct: 173 KFLKKRSSSFLGQGDSHSDFSDGNKIAWRPKGIIHKKDEVFLYVNERMNILVSRDGSILK 232

Query: 199 SEIIGAVKIKSRLSGMPDLKLGINDR-GIFTKYLEGNNIGVNIPDPQEHGSGVAESSITN 257
           S + G + I + LSG P  + G+ND  G+ ++  E      N    Q+  S     +   
Sbjct: 233 SYVDGTIDITTHLSGTPVCRFGLNDSLGMQSEDQE------NWLSQQDQHSHNGFENKNC 286

Query: 258 DGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDV 316
             K    ++ LED KFH+CV + KF    II F+PPDG  +LM Y +  +I  P     +
Sbjct: 287 FPKAAAGSVLLEDCKFHECVSIDKFNKNHIIEFVPPDGSMELMKYHVRDNINLPFKITPI 346

Query: 317 SIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAI 376
                  + ++ R   K+    K  A +V + IPVP          S+G+ K+VPE++A+
Sbjct: 347 VAHSARDNEVDYRITLKSLFPGKLSAKDVILHIPVPPSTVDCKISVSNGNCKFVPEENAM 406

Query: 377 LWKIKSFPGGKEYAMFAEMGLPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKI 433
           +W+   F G  E  + A + + + D+ +   +   + P+ + FE+  F+ SG+ VRY  I
Sbjct: 407 IWRFNKFNGLTENTLSA-VTVSTSDTTQLSLQQWTRPPMSLDFEVMMFSNSGLVVRYFTI 465

Query: 434 NEPKLQYKSYPWVRYITQSGDDYTIR 459
           +    ++++  W++YI++SG  Y +R
Sbjct: 466 SSRDSKHRAVKWIKYISKSG-SYEVR 490

>TPHA0P00660 Chr16 (136114..137535) [1422 bp, 473 aa] {ON} Anc_3.165
           YOL062C
          Length = 473

 Score =  176 bits (447), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 130/433 (30%), Positives = 208/433 (48%), Gaps = 63/433 (14%)

Query: 65  LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM-DYGI 123
           L++VA+  S   N   ++ FL+KL  +L  Y     EE + + F++ YE++D M+    +
Sbjct: 65  LWIVAITRS-NANSGVIWEFLYKLDSMLTAY-DLNNEEKLMEKFMVYYEMIDVMLTSNAM 122

Query: 124 PQITEPRMLKKYITQKSFKLEKAHKKK------------------RNAARPPSELNN--- 162
           P  TE   L    ++ S++L K                       RN+     E +N   
Sbjct: 123 PINTE---LSSIASKISYRLPKTISNSPTNEKNNNNGLSIPKFLTRNSRSMSQEFSNITQ 179

Query: 163 -SVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGI 221
             + WR  GIKYKKNE FL + E IN+L+++   +L++ + G++ + S LSG P  + G+
Sbjct: 180 SDIPWRPTGIKYKKNEVFLYVNEKINILVSKDQTILKAYVDGSIDLVSHLSGTPICQFGL 239

Query: 222 NDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSK 281
           ND    T    GNNI  N  D   H     E   T  G+   +++++ED  FHQCV L K
Sbjct: 240 NDYLSMT----GNNIS-NRGDEFRHDFMDDEDLST--GRSSSSSVKIEDCTFHQCVSLDK 292

Query: 282 FENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEI---RCRAKAQIKK 338
           F +E++I F+PPDG F+LM Y +          D++I      R+ I   RC  + +I  
Sbjct: 293 FNDERLINFVPPDGSFELMRYHVRD--------DLNIPFKVTPRVSISSSRCSMRYKIIL 344

Query: 339 KSV------AANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMF 392
           KS+      AA+  + IP+P          S G   +    +  +WK   + G  E  + 
Sbjct: 345 KSLFPTSLSAADAMLKIPLPPGTVDCKINASSGKCNFSTSDNCAIWKFNKYKGLTENELI 404

Query: 393 AE------MGLPSMDSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWV 446
            E        + S+  +  P    P+ + FEI  F+ SG+ V+YLK+ E   +Y+   W+
Sbjct: 405 LETVPSSSTDILSLQQWTRP----PMSMNFEIIMFSNSGLVVKYLKVMERVQKYRPVKWI 460

Query: 447 RYITQSGDDYTIR 459
           +Y+++SG  Y IR
Sbjct: 461 KYVSKSG-SYEIR 472

>TBLA0F00840 Chr6 (213915..215360) [1446 bp, 481 aa] {ON} Anc_3.165
           YOL062C
          Length = 481

 Score =  172 bits (435), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 130/502 (25%), Positives = 240/502 (47%), Gaps = 65/502 (12%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M +AV     +G+ L+ + +K  V  +  D F   + + ++   +  P +      + FI
Sbjct: 1   MINAVMIFTPRGELLVFKVFKSSVKRTISDIFRVQVINNDN---IRSPILTLGSTTFHFI 57

Query: 61  QH---NDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDE 117
           +    + L++VA+  S   +   ++ +L+KL  ++  Y  T  E+ ++D F++ +EL+D 
Sbjct: 58  RTTAGSKLWLVAVTRS-NADSGAIWEYLYKLNSLMEVYGLT-HEDILKDEFIVCHELLDI 115

Query: 118 MMDY-GIPQITEPRMLKKYITQKSFKLEKAHKKK-------------------------R 151
            +   G+P  TE   +   +T K  ++  +   +                         R
Sbjct: 116 TLGMNGLPMDTELSSVIGKMTLKPAQVLTSSADRSDILASSVTTLGHNSTPISMPKFLSR 175

Query: 152 NAARPPSELNNS------VSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAV 205
           N+ R  ++   S      + WR+  IKYKKNE  ++++E IN+L+ +   +LR+ + G +
Sbjct: 176 NSNRSVTQEFESQFSPSNIPWRSRDIKYKKNEMIVNVIEKINVLVGKDDNILRAYVDGTI 235

Query: 206 KIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTN 265
            I + LSGMP  ++G+ND    +    G N      D   +   + + S    G +    
Sbjct: 236 DITAHLSGMPMCQIGMND---LSTIQGGENAHWTNEDRASNRDAMPDVS----GDR---- 284

Query: 266 IELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK-PL-IWCDVSIQVHSK 323
           + LE  KFHQCV L K+  + +I FIPPDG+F+LM Y ++ ++  P  I   V++  H  
Sbjct: 285 VILEGSKFHQCVALDKYNKDNVIWFIPPDGQFELMKYHVSNNLNLPFRITPQVTLTSHGT 344

Query: 324 SRIEIRCRAKAQIKKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSF 383
           + +    + K+   +K  A NV + IPVP          S G  K++PE++ ++W    F
Sbjct: 345 A-LSYAIKLKSLFPRKLSAENVVLRIPVPPGTLDCKINASDGKCKFIPEENCMVWSFHRF 403

Query: 384 PGGKEYAMFAE------MGLPSMDSYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINEPK 437
            G  E  + A+      +   S+  +  P    P+ + F++  F+ +G+ VRYLK+ E  
Sbjct: 404 NGSTENHLNAQTVPTQSIASQSIKQWTRP----PMSLDFKVLMFSNTGLIVRYLKVQEKN 459

Query: 438 LQYKSYPWVRYITQSGDDYTIR 459
           + Y +  W++YI+ +G  Y +R
Sbjct: 460 MHYNTIKWIKYISAAG-SYEVR 480

>KLLA0F25432g Chr6 complement(2365434..2366957) [1524 bp, 507 aa]
           {ON} some similarities with uniprot|P38700 Saccharomyces
           cerevisiae YHL019C APM2 homologous to the medium chain
           of mammalian clathrin-associated protein complex Similar
           to clathrin coat proteins
          Length = 507

 Score =  164 bits (414), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 140/553 (25%), Positives = 233/553 (42%), Gaps = 139/553 (25%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAID-KFSTLLTDLEDESAVIPPCINHNGIEYLF 59
           M+S     D+  +PL+ R  +   P+  +D     L  +L+       P    NG  Y  
Sbjct: 1   MSSCFLLLDETYEPLIRRALR---PIHFLDDAILQLQNNLKHHKGCTKPIFEGNGWHYAV 57

Query: 60  IQHNDLYVVALAT--------SLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVII 111
           I  ++LY   +          S+   + E++    K MG+       + + ++RDNF +I
Sbjct: 58  ITRDNLYFAMIMQVNNSVSPISVLHYLDEIYQLCRKFMGM------KLNKLNVRDNFHLI 111

Query: 112 YELMDEMMDYGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAAR--PPSE---------- 159
           +E+++E  DYGI Q+T   ++  +I  +  K +   +   +     PP +          
Sbjct: 112 FEVIEESSDYGIIQVTNYNIIHDFIKVEVIKPDDDSENTASEKHELPPGDQDETFINSYI 171

Query: 160 ---LNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMP 215
              + ++VSWR +GI Y KNE FLD++E +  ++  +  V+R+ +I G +  +S LSGMP
Sbjct: 172 LRTMTSAVSWRPKGIHYGKNEFFLDVIEKLEFIMDFEEGVVRNNVINGTIICRSYLSGMP 231

Query: 216 DLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIE-LEDLKFH 274
            L +G+N                                     K  + N+  ++ LKFH
Sbjct: 232 QLSIGLN-------------------------------------KLMQKNVHFMKRLKFH 254

Query: 275 QCVRLSKF--ENEKIITFIPPDGEFDLMNYRLTTSI--KPLIWCDVSIQVHSKSR----- 325
           +CV L     E   +I FIPPDGEF+L NY+L   +  +P+I    S  +  K R     
Sbjct: 255 ECVDLHTLIKEESPVIKFIPPDGEFELCNYKLNRPLLDEPVIKLQ-SFGLSQKPRKNQET 313

Query: 326 ---IEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQS 374
              + ++       K +  A  + I IP+         D    P FK   G + +     
Sbjct: 314 QDKLLLKAAITTHFKAQDSAKELLIKIPIKSVIRKWNIDLEKPPLFKSDIGDVVFDITAG 373

Query: 375 AILWKIKSFPGG---KEYAMFAEMGLPSMDSYEE-----------------PKVKR---- 410
           +I+WKI +  GG   K Y +     +     +E                  PK++R    
Sbjct: 374 SIIWKINNLKGGHGNKNYGLKCMFEIWDRQIHEALEVQLRNSMDPPPLRTGPKLERIWDQ 433

Query: 411 ----------------------PVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRY 448
                                  + + FEIPY+  SG++V Y KI EP+L Y+S+PWVRY
Sbjct: 434 YHGKTTEYDGNENQKEDVDKFALIAMSFEIPYYAVSGLKVEYFKIEEPQLNYQSFPWVRY 493

Query: 449 ITQSGDDYTIRVN 461
            T + ++Y  +V+
Sbjct: 494 KTVNDNEYIYQVS 506

>TDEL0B06430 Chr2 (1137277..1138854) [1578 bp, 525 aa] {ON}
           Anc_2.555 YHL019C
          Length = 525

 Score =  162 bits (411), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 151/564 (26%), Positives = 243/564 (43%), Gaps = 151/564 (26%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S ++  D+  +PL+S+  K    L  I +    +   E +     P I+ +   ++ I
Sbjct: 1   MSSCIFITDENLEPLISKNIKAIPNLQGILRLFKSVYTPESQ-----PVISASSFHFVHI 55

Query: 61  QHNDLYVVAL--ATSLTVNIAEVFAFLHKLMGVLGEYL--KTVEEESIRDNFVIIYELMD 116
           + + L  V++  A   + N+  +  FL +   +L +YL    +++  + DN ++I EL+D
Sbjct: 56  KRSSLLYVSVIHAYDASANVMLIATFLDQFHSLLKKYLAVSALDKNMVLDNVLLIMELID 115

Query: 117 EMMDYGIPQITEPRMLKKYI----------TQKSFKL-------EKAHKKKRNAARP--- 156
           E +D+G+ QIT+  +++ YI          T     L       E   K KR + +P   
Sbjct: 116 ESIDFGVIQITDASIMRDYIRVKVNMPENKTIDDLSLGDSDTDEEDNKKTKRRSGKPNLY 175

Query: 157 ---------------------PSELNNS------------VSWRAEGIKYKKNEAFLDIV 183
                                  ++ +S            VSWRA+GI Y +NE FLD+V
Sbjct: 176 KFLRGAKDGTHKAEHTDTAAKEDDVEDSYNSYIAKATIMPVSWRAKGIHYARNEFFLDVV 235

Query: 184 ESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPD 242
           E +  L+     +++  +I G +  KS LSGMP LK+  N                    
Sbjct: 236 EQVQYLMDFNSGIIKKNLIHGKIICKSYLSGMPKLKIAFNKLS----------------- 278

Query: 243 PQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNY 302
            Q+    ++ S                  KFHQCV      NEK I FIPPDG+F L  Y
Sbjct: 279 -QKDEQFISHS------------------KFHQCVTWPS-SNEKEIEFIPPDGDFVLCQY 318

Query: 303 RLTTSIK--PLIWCDVSIQVH---SKSRIEIRCRAKAQIKKKSVAANVQILIPVPD---- 353
            L   +K  P++   VS  V     K +I++ C  +   K ++  + + + IP+      
Sbjct: 319 ELKRHVKDQPMLKL-VSFGVKPKLKKYKIQMSCTIETHFKARNSTSTLNLKIPLARLFQE 377

Query: 354 ---DADTPS-FKYSHGSIKYVPEQSAILWKIKSFPGGK---EYAMFAEMGL--------- 397
              D   P+ FK   G + +      +LW I+   GG    + +M AE  L         
Sbjct: 378 YQIDLKKPARFKSDSGKVLFNISDDFLLWDIEVMKGGHGDTQLSMAAEFSLFNKKEFEEE 437

Query: 398 -----PSMDS---YEEPKVK-----------------RPVQVKFEIPYFTTSGIQVRYLK 432
                 SM+     + PK++                 R + +KFEIPY T SG+QV YLK
Sbjct: 438 QEELKNSMNPPPLRDGPKLEELYDQVHNEKGPSKMASRLLSMKFEIPYSTCSGLQVEYLK 497

Query: 433 INEPKLQYKSYPWVRYITQSGDDY 456
           I+E +LQY+S+PWVRY T + ++Y
Sbjct: 498 IDEEQLQYQSFPWVRYKTVNDEEY 521

>Ecym_4591 Chr4 complement(1154444..1155949) [1506 bp, 501 aa] {ON}
           similar to Ashbya gossypii ABR047W
          Length = 501

 Score =  159 bits (402), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 225/500 (45%), Gaps = 126/500 (25%)

Query: 48  PCINHNGIEYLFIQHNDLYVVALATSLT-VNIAEVFAFLHKLMGVLGEYL-KTVEEESIR 105
           P + +   +Y+FIQ + LY ++L+  LT V    VF++L++L  +  +YL + + +  I 
Sbjct: 41  PILQNMDYDYIFIQRDGLYFLSLSYQLTNVYPMVVFSYLNQLHMLFQKYLGENLNKVLIT 100

Query: 106 DNFVIIYELMDEMMDYGIPQITEPRMLKKYITQKSFKLEKAHKKKRNA------------ 153
            NF +I+EL+DE +  G PQ+T+  +++ YI  +  K +      R A            
Sbjct: 101 GNFHLIHELIDESIFMGTPQLTDYNIIRDYIKVQVVK-DSPEPATREATVTNTKKNKKKD 159

Query: 154 ---------ARPPSELNN--------SVSWRAEGIKYKKNEAFLDIVESINMLITQKGQV 196
                    A   + +N+        ++SWR +GI Y KNE +LD++E +  L+  +   
Sbjct: 160 SKKKEEDTEATDENYMNSYIARTTTSAISWRPKGIHYNKNEFYLDVIEHLEYLVDFQCMN 219

Query: 197 LRSEII-GAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSI 255
           ++S  + G ++ +S LSGMP L +G+N      +Y                         
Sbjct: 220 IKSNTVYGYIQCRSYLSGMPMLTIGLNKLNSENEYF------------------------ 255

Query: 256 TNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRLTTSIK--PLIW 313
                 R+ N       FHQCV L +   +K+I+F PPDGEF L NY+LT ++   P+I 
Sbjct: 256 -----MRRAN-------FHQCVNLDQLTTDKLISFTPPDGEFQLCNYKLTRNMSDPPMIK 303

Query: 314 ---CDVSIQVHSK----SRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTP 358
              C V ++         R+ +        K +   + + I +P+         D +  P
Sbjct: 304 LEDCKVKLKPRKTKDGLDRLILAVTISTYFKLQDSTSLLNIKVPLSKVFRDWDVDLSYQP 363

Query: 359 SFKYSHGSIKYVPEQSAILWKIKSFPGG---KEYAMFAEMGLPSMDSYEEPKVK------ 409
            FK   G + +      +LW++    GG   K   M +E  L + +   E ++K      
Sbjct: 364 RFKCEQGKVMFNITDDYLLWEVGKVKGGHGDKTLKMQSEFHLHNRE--HEARIKQQLSNS 421

Query: 410 ---RPVQ--------------------------VKFEIPYFTTSGIQVRYLKINEPKLQY 440
              +P++                          V+FEIPY+T SG++V +LKI E +LQ+
Sbjct: 422 MDPKPIRRGPHLEKLYQQTHELNSPTSEAALLKVEFEIPYYTISGLKVEFLKIEEKQLQF 481

Query: 441 KSYPWVRYITQSGDDYTIRV 460
           +S+PWVRY T + D Y  ++
Sbjct: 482 QSFPWVRYKTINHDIYAYQL 501

>KNAG0K01150 Chr11 complement(225095..226519) [1425 bp, 474 aa] {ON}
           Anc_3.165 YOL062C
          Length = 474

 Score =  156 bits (394), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 119/489 (24%), Positives = 233/489 (47%), Gaps = 46/489 (9%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M +AV     +G+ ++S+ +K  +  S  D F   ++  L+  S ++   +      Y+ 
Sbjct: 1   MINAVLVYSARGELIVSKMFKPTLKRSVGDIFRVQVINSLDVRSPIL--TLGSTTFHYVR 58

Query: 60  IQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMM 119
                L+VV+++ +   N A  + FL+K   +L  Y +   EE +++ F++ +EL+D M+
Sbjct: 59  TPGEGLWVVSVSRN-NENSAATWEFLYKFATMLAAY-RLDSEEVLKEEFMLAWELLDTMV 116

Query: 120 DYG-IPQITEPRML--------------------KKYITQKSFKLEKAHKKKRNAARPPS 158
           + G IP  T+P  +                    ++  T  +     A  +  + A  P 
Sbjct: 117 EGGGIPSETDPHRIISAMSVKPAMSPVDVRADARQQQTTTSTGAFGHAFPQLLHRASNPG 176

Query: 159 ELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLK 218
            ++       +G + K+NE  + + ESI++L+++ G +L++ + G + + ++L G    +
Sbjct: 177 GISILPHATGDGAQLKRNEIVMVVQESISILVSKDGSILKAYVDGGIDLTTKLEGAAVCQ 236

Query: 219 LGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRK--TNIELEDLKFHQC 276
            G+ND       L  +N   +  DP        E+  TN   K      + L D KFHQC
Sbjct: 237 FGLNDS------LSTDNSSNSKWDPLRS----KETQGTNLEMKNAHVGTVLLRDCKFHQC 286

Query: 277 VRLSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQI 336
           V L +F+ ++II F PP+G  +LM Y +  ++         +   + +  + R   K+  
Sbjct: 287 VSLERFDRDRIIRFTPPEGTIELMKYHVRDNLNLPFKVTSMVIPTANNETDYRVTIKSLF 346

Query: 337 KKKSVAANVQILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMG 396
             K  A NV + IPVP          S+G+ K++PE++A++WK   + G  E  + A + 
Sbjct: 347 PGKLSAKNVTMRIPVPPGTLDCKINVSNGNCKFLPEENAMVWKFHKYNGLTENKLSA-IT 405

Query: 397 LPSMDSYE---EPKVKRPVQVKFEIPYFTTSGIQVRYLKI---NEPKLQYKSYPWVRYIT 450
           +P+ D+ +   +   + P+ + FEI  ++ +G+ VRY  +   +    ++K+  W++Y++
Sbjct: 406 VPTRDTTQLALQQWSRPPISLDFEILMYSNTGLVVRYFTVLDKHNNNTKFKTVKWIKYVS 465

Query: 451 QSGDDYTIR 459
            SG  Y +R
Sbjct: 466 HSG-SYEVR 473

>TPHA0I02390 Chr9 (528997..530676) [1680 bp, 559 aa] {ON} Anc_2.555
           YHL019C
          Length = 559

 Score =  154 bits (389), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 156/600 (26%), Positives = 244/600 (40%), Gaps = 181/600 (30%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S ++  D+  +PL+S+  K    L  I K     +  E  +   PP I  +   Y+++
Sbjct: 1   MSSCLFILDELLEPLISKNTKPVRNLPDIIK-----SFKESWTPTSPPIITVSNWHYVYV 55

Query: 61  QHNDLYVVALATSL---TVNIAEVFAFLHKLMGVLGEYLK--TVEEESIRDNFVIIYELM 115
           + + L+ VA    +    +N+  +  +L +L  +L  Y K   + +  I DN +++ ELM
Sbjct: 56  KRDALWFVAAIHYMDEKCMNLMMILFYLDQLYYLLKNYFKKELLTKLLIIDNALLVTELM 115

Query: 116 DEMMDYGIPQITEPRMLKKYITQK---------------SFKLEKAHKKKRNA----ARP 156
           DE +D+GI Q+T+P +++ YI  K                    ++   K+NA    +  
Sbjct: 116 DESIDFGIIQMTDPSIIRDYIRVKINNSIATGNNSNDDSDDSDTESASSKKNAKSLGSYM 175

Query: 157 PSELNNSVSWRAEGIK------------------------------------------YK 174
           PS  N +  W+    K                                          Y 
Sbjct: 176 PSANNLTNLWKGYSTKDETLNENVNNDNFENNDDETYINSHIARTTTMAVSWRTKGIYYA 235

Query: 175 KNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGINDRGIFTKYLEG 233
           KNE FLD+VES+  L+  K +V+R  +I G +K KS LSGMP L++ +N           
Sbjct: 236 KNEFFLDVVESVQYLMNFKDKVIRRNLIHGQIKCKSYLSGMPTLRIALN----------- 284

Query: 234 NNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLS------------- 280
                                I  D K+      L   KFHQCV L+             
Sbjct: 285 --------------------KILQDDKQF-----LGHAKFHQCVSLNSINIKDLEKDLEG 319

Query: 281 -------KFENEKIITFIPPDGEFDLMNYRLTTSIK-PLIWCDVSIQV---HSKSRIEIR 329
                   F N+K I FIPPDGEF L  Y L   +K P +    S  +     K R++I 
Sbjct: 320 PNDISNKNFVNKKEIEFIPPDGEFVLCQYELRRHVKDPPVINMTSFDIKPNFKKFRVQIS 379

Query: 330 CRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIK 381
            + +   K+++  + + I IP+         D +  P FK   G + +   +  ++W+I 
Sbjct: 380 LKIETHFKRQNSTSLMTIKIPLLQLFNDYKIDLSKQPRFKSDVGKVLFNISEDFLIWEID 439

Query: 382 SFPGG---KEYAMFAEMGLPSMDSY----EEPKVK------------------------- 409
           +  GG    E  M AE  L + + Y    EE K+                          
Sbjct: 440 ALKGGHGENEKGMVAEFFLFNQEEYDRLQEEAKISMNPPPLRNGPKLEELYEEMHENEDA 499

Query: 410 ---------RPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
                    + V ++FEIPY T SG++V YLKI E  L+Y+S+PWVRY T + D+Y   V
Sbjct: 500 EDTALKMKTQYVFMQFEIPYSTCSGLKVEYLKIEEDLLKYQSFPWVRYKTLNDDEYAFIV 559

>KAFR0A02060 Chr1 (428640..430262) [1623 bp, 540 aa] {ON} Anc_2.555
           YHL019C
          Length = 540

 Score =  151 bits (381), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 151/586 (25%), Positives = 237/586 (40%), Gaps = 172/586 (29%)

Query: 1   MASAVYFCDDKGKPLLSRRYKD----DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIE 56
           M+S +Y  ++  + LLS+  K     D+PLS       L      +  V  P I +    
Sbjct: 1   MSSILYILNEDLESLLSKSIKALESPDIPLS-------LFKKQFHKHQVTTPVIIYEDYI 53

Query: 57  YLFIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEY--LKTVEEESIRDNFVIIYEL 114
           +  IQ + LY V+ +     NI E   +L++   +L  Y  +K +++  I DN V I EL
Sbjct: 54  FTCIQRDTLYFVS-SIDCKTNILETLHYLNEFYILLKNYFNVKQLDKNIIMDNLVPILEL 112

Query: 115 MDEMMDYGIPQITEPRMLKKYIT---------------------------QKSFKLEKAH 147
           ++E +D+GI QIT+  ++K YI                            +K  + E  +
Sbjct: 113 IEESVDFGIIQITDSNLMKDYIRIKVNLPQDDYKIHYDSSDEEKTNYHKGKKHIRKELTY 172

Query: 148 KKKRNAARPPSELNNS----------------------------------VSWRAEGIKY 173
            KK+   R   E + S                                  VSWRA+GI+Y
Sbjct: 173 LKKKVLGRGTHEHSKSIDKTIEQKHTTAEDELVDEDTYINSYIAKTTIMSVSWRAKGIQY 232

Query: 174 KKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGINDRGIFTKYLE 232
            KNE FLD++E +   +     +++  +I G +  KS LSGMP LK+ +N          
Sbjct: 233 AKNEFFLDVIEKVEYFMDFSNNIIKKNLIHGEIICKSFLSGMPTLKVSLN---------- 282

Query: 233 GNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIP 292
                +   D Q                       L   KFHQCV     +  K++ F+P
Sbjct: 283 ----KIIYQDKQ----------------------FLSSCKFHQCVMPDSVDEGKVLEFVP 316

Query: 293 PDGEFDLMNYRLTTSIK--PLIWCDVSIQVH---SKSRIEIRCRAKAQIKKKSVAANVQI 347
           PDG+F L  Y L   +   PL+   +S +V     K ++++    ++  KK +    + I
Sbjct: 317 PDGDFVLCKYELKRHVNDLPLLKL-ISYEVKPKLDKYKLKLFVTIESTFKKTNSTTKLNI 375

Query: 348 LIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK-------EYAMF 392
            IP+         D +     +   G I +      +LW+I +  GG        ++A+F
Sbjct: 376 KIPLKVLLEKYDIDLSKNIKSRCDEGKILFNVSDDFLLWEIGAMKGGNSQLKMGADFALF 435

Query: 393 AE-------------MGLPSM-------------------------DSYEEPKVKRPVQV 414
            E             M  P +                         +S +E K    +++
Sbjct: 436 NEEEYLRQQEELKTSMNPPPLRTGPKLEELYKQIHEEKCNNFTRKGESSDETK-GNLIKM 494

Query: 415 KFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
            FEIPY T+SG++V YLKI EP LQY+++PWVRY T S D Y   V
Sbjct: 495 DFEIPYNTSSGLKVEYLKIEEPNLQYQAFPWVRYKTISDDGYAYAV 540

>Kpol_1056.13 s1056 complement(30531..32156) [1626 bp, 541 aa] {ON}
           complement(30531..32156) [1626 nt, 542 aa]
          Length = 541

 Score =  147 bits (370), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 148/578 (25%), Positives = 239/578 (41%), Gaps = 163/578 (28%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S ++  D+  +PL+S+  K    L+ I +F  L     +     PP        Y+FI
Sbjct: 1   MSSCLFILDESLEPLISKNVKSVRNLTGILEFFKL-----NYKENGPPVFTVLEWHYVFI 55

Query: 61  QHNDLYVVALATSLTVNIAEVFA---FLHKLMGVLGEYLK--TVEEESIRDNFVIIYELM 115
           + + L+ +         I  + A   +L +L  +L  Y    +++   + DN ++I EL+
Sbjct: 56  KRDSLWFMTAIHETDDRITNLMALTFYLDQLYLLLKTYFNRSSLDRNIVLDNVLLIIELI 115

Query: 116 DEMMDYGIPQITEPRM------------------------------LKKYITQKS--FKL 143
           DE MD+GI Q+T+P +                              L  YI  K+   KL
Sbjct: 116 DESMDFGIVQLTDPSIIKDYIRVKVNSPITHLTSDDDSDTEEKHKGLSTYIPGKTDIVKL 175

Query: 144 EKAHKKKRNAARPPSELNN--------------------SVSWRAEGIKYKKNEAFLDIV 183
            K            +E +N                     VSWR +GI Y KNE FLD++
Sbjct: 176 WKGQPAVTANEGKSNEQDNYDDDDDENFINSYIAKTTIMPVSWRTKGIYYAKNEFFLDVI 235

Query: 184 ESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPD 242
           E +  L+    G++ ++ I G +K K  LSGMP LK+ +N      K ++ +        
Sbjct: 236 EKVQYLMDFSTGRIRKNLIHGEIKCKCYLSGMPTLKVALN------KLIKND-------- 281

Query: 243 PQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFE------------NEKIITF 290
                    E  I+N              KFHQCV ++  +            + K I F
Sbjct: 282 ---------EQFISNS-------------KFHQCVSINSLKREINNEEEENTYHGKEIEF 319

Query: 291 IPPDGEFDLMNYRLTTSIK--PLI-WCDVSIQVH-SKSRIEIRCRAKAQIKKKSVAANVQ 346
           IPPDGEF L  Y L   ++  P+I   ++ I+    K +I+I    +   KK++  + + 
Sbjct: 320 IPPDGEFVLCKYELKRHVRDVPVIKLSNIEIKPKLKKYKIQIHVTIETHFKKQNSTSVLT 379

Query: 347 ILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK---EYAMFAEM 395
           I IP+         D    P FK   G + +      ++W++ S  GG    +  M AE 
Sbjct: 380 IKIPLRMVFSQYKIDLTKQPRFKSDFGEVLFNISDDFLIWEVGSMKGGNGESKNNMVAEF 439

Query: 396 GLPSMDSY-----------------EEPKV--------------------KRPVQVKFEI 418
            + + + Y                 E PK+                    ++ + +KFE+
Sbjct: 440 FIFNQEEYDRLQEEMKTSMNPPPLREGPKLEEIYEQTHDNRDEHDKNGISQQLLTMKFEV 499

Query: 419 PYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDY 456
           PY T SG++V YLKI E ++ Y+S+PWVRY T + D+Y
Sbjct: 500 PYSTCSGLKVEYLKIEENQVNYQSFPWVRYKTINDDEY 537

>ZYRO0E05874g Chr5 (452910..454559) [1650 bp, 549 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019C APM2
           homologous to the medium chain of mammalian
           clathrin-associated protein complex Similar to clathrin
           coat proteins
          Length = 549

 Score =  133 bits (334), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 110/349 (31%), Positives = 158/349 (45%), Gaps = 93/349 (26%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGIN 222
           VSWRA+GI Y KNE FLD+VE +  L   K +V+R  +I G +  KS LSGMP LK+ +N
Sbjct: 236 VSWRAKGIHYGKNEFFLDVVEKVQYLADFKEKVVRKNLIHGKIYCKSYLSGMPKLKIALN 295

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                 K L            Q     ++ S                  KFHQCV L   
Sbjct: 296 ------KLL------------QRDAQFMSHS------------------KFHQCVALETL 319

Query: 283 ENEKIITFIPPDGEFDLMNYRLT-----TSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIK 337
            NEK + FIPPDGEF L  Y L      T I  +   ++  Q+  K ++ I    +   K
Sbjct: 320 -NEKELEFIPPDGEFILCEYELKRHVNDTPILKITSFEIKPQL-KKFKLRILLTIETHFK 377

Query: 338 KKSVAANVQILIPVPD-------DADTPS-FKYSHGSIKYVPEQSAILWKIKSFPGGK-- 387
            ++  + + + IP+         D   P+ FK + G + +      +LW+I    GG   
Sbjct: 378 TRNSTSILNVKIPLAKLFADYNIDLSKPTRFKSAAGQVLFNLSDDFLLWEIGQMRGGHGE 437

Query: 388 -EYAMFAEMGL-------------------------PSMD-------SYEEPKV------ 408
            +++M AE  L                         P ++       S ++P+V      
Sbjct: 438 TQFSMVAEFSLFNKEEFEREQEERKHSMNPPPLREGPKLEELYAQTHSQKDPEVLVKSIQ 497

Query: 409 KRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 457
            + V + FEIPY T SG++V YLKI E +LQY+S+PWVRY T S ++Y 
Sbjct: 498 SQLVGMDFEIPYTTCSGLKVEYLKIEEEQLQYQSFPWVRYKTISDEEYA 546

 Score = 36.2 bits (82), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/154 (25%), Positives = 78/154 (50%), Gaps = 21/154 (13%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLED-ESAVIPPCINHNGIEYLF 59
           M+S +Y  D+  +PL+S+  K      +I   +TL+   ++  S+  PP + +    ++ 
Sbjct: 1   MSSCLYILDENLEPLISKNIK------SIPNLNTLVEVFQEVYSSNAPPIVFNRNWYFIH 54

Query: 60  IQHNDLYVV---------ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVI 110
            + + L  +         A A  +TV + + +  L K +GV       ++   + DN ++
Sbjct: 55  TKRDSLIFLSAIHGTDDSANAMMITVYMDQFYLLLKKYLGV-----AQLDRNLVLDNVLL 109

Query: 111 IYELMDEMMDYGIPQITEPRMLKKYITQKSFKLE 144
           + EL++E  ++G+PQ+TEP ++K YI  K  K E
Sbjct: 110 VLELLEESSEFGVPQMTEPSVMKDYIRIKVNKSE 143

>Skud_8.26 Chr8 complement(55759..57549) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  127 bits (318), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 104/377 (27%), Positives = 160/377 (42%), Gaps = 119/377 (31%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  L+  +KG + ++ I G +  +S LSGMP LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRSYLSGMPKLKISIN 312

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
              I  +            DPQ   +                        FHQCV L   
Sbjct: 313 --KILNR------------DPQFMSNS----------------------NFHQCVSLDSI 336

Query: 283 E-------------------NEKIITFIPPDGEFDLMNYRLTTSIK--PLIWC-DVSIQV 320
                               + + I F+PPDGEF L  Y L   +K  P+I   D  I+ 
Sbjct: 337 NTIEKGQEKEQNTGDSQAAADAREIEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFEIKP 396

Query: 321 H-SKSRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVP 371
              KS+I+I  + +   K  +  + + + IP+         D +    FK ++G + +  
Sbjct: 397 KLKKSKIQILTKIQTNFKPTNSTSKLNVKIPLTRVFQDYKIDLSKQIRFKANNGKVVFNL 456

Query: 372 EQSAILWKIKSFPGGKE----------------YAMFAEMGLPSMDSYEE---------- 405
               +LW+I++  G +E                 +M AE  L + + Y+           
Sbjct: 457 SDDFLLWEIQTMKGHRERNASNAPQDDGDPSTCASMVAEFSLFNQEEYDRLQEEMKTSMN 516

Query: 406 -------PKVK------------------RPVQVKFEIPYFTTSGIQVRYLKINEPKLQY 440
                  PK++                  R V + FEIPY T SG++V YLK+ EP+LQY
Sbjct: 517 PPPLRTGPKLEELYNQVHDKHTPHVTPRDRLVSIDFEIPYCTCSGLKVEYLKVEEPQLQY 576

Query: 441 KSYPWVRYITQSGDDYT 457
           +S+PWVRY T + ++Y 
Sbjct: 577 QSFPWVRYKTVNDEEYA 593

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 83/144 (57%), Gaps = 10/144 (6%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S+++  D+  +P++S+  +    LS++   S+      D S   PP +  N   ++ +
Sbjct: 1   MSSSLFILDEDLEPVVSKNIRALPNLSSV--LSSFKQCYHDGS---PPILFQNDWFFIHL 55

Query: 61  QHNDLYVVALATSL---TVNIAEVFAFLHKLMGVLGEY--LKTVEEESIRDNFVIIYELM 115
           + + L++V++  +     +++  + AFL +   +L +Y  +K + ++ I DN +++ ELM
Sbjct: 56  KRDFLHLVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIKVLSKDLILDNVLLVLELM 115

Query: 116 DEMMDYGIPQITEPRMLKKYITQK 139
           DE +D+GI Q+T+P ++K YI  K
Sbjct: 116 DECIDFGIVQVTDPSIIKDYIRVK 139

>NCAS0A12650 Chr1 (2492345..2494111) [1767 bp, 588 aa] {ON}
           Anc_2.555 YHL019C
          Length = 588

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 161/377 (42%), Gaps = 118/377 (31%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +   +  K  V+R  +I G +  +S LSGMP LK+ IN
Sbjct: 250 ISWRTKGIHYGKNEFFLDVIEKVEYFMDFKSGVIRKNLIHGEIICRSYLSGMPKLKISIN 309

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIE-LEDLKFHQCVRL-- 279
                                                K  K +++ L ++KFHQCV L  
Sbjct: 310 -------------------------------------KILKQDVQFLSNVKFHQCVSLDS 332

Query: 280 -------------SKFENEKI--------ITFIPPDGEFDLMNYRLTTSIK--PLIWC-- 314
                         K +NE+         I FIPPDGEF L  Y L   +K  P+I    
Sbjct: 333 IRARSNPPAVEEDGKKKNEEADTLGNKGEIEFIPPDGEFLLCKYELKRHVKDQPMIKLRN 392

Query: 315 -DVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHG 365
            ++  ++H K +I+I    +   K  +  + + + IP+         D +  P FK   G
Sbjct: 393 FEIIPKLH-KFKIKIHVIIETHFKTTNSTSKLNLRIPITNLFQSYRIDLSKQPKFKCEQG 451

Query: 366 SIKYVPEQSAILWKIKSFPGGK---------EYAMF-------------AEMGLPSM--- 400
           ++ +      +LW++ +  GG          E+A+F               M  P +   
Sbjct: 452 TVLFNLSDKFLLWEVGTMNGGHGENTLSMMAEFALFNEEEYKKMEEERKTSMNPPPLREG 511

Query: 401 --------------DSYEEPKVKRP---VQVKFEIPYFTTSGIQVRYLKINEPKLQYKSY 443
                         DS E    K+    + + FE+PY T SG+++ YLKI E +LQY+S+
Sbjct: 512 PKLEELYKKIHEEGDSDEVSTRKKNESLLTMDFEVPYCTCSGLKIEYLKIEEDQLQYQSF 571

Query: 444 PWVRYITQSGDDYTIRV 460
           PWVRY T S D+Y   V
Sbjct: 572 PWVRYKTISDDEYAFAV 588

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/143 (24%), Positives = 75/143 (52%), Gaps = 7/143 (4%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIP-PCINHNGIEYLF 59
           M+S+++  D+  +P++ +  +    L  +    T   +L   + V P P +N    ++L 
Sbjct: 1   MSSSIFILDETLEPIICKNIR---ALPNLPSLVTKFQELYRSNGVSPLPILNDIDWQFLH 57

Query: 60  IQHNDL-YVVALATSLTVNIAEVFAFLHKLMGVLGEYLKT--VEEESIRDNFVIIYELMD 116
           I+ + L ++  +  +   N+  VF +L +   +L +YL    +    + DNF+++ EL+D
Sbjct: 58  IKRDSLVFLSVVENNSRCNLLGVFTYLEEFYKLLKDYLHVGILNRNLLIDNFLVVIELID 117

Query: 117 EMMDYGIPQITEPRMLKKYITQK 139
           E +D+G+ Q T+  ++K Y+  K
Sbjct: 118 ESLDFGVVQFTDSSLIKDYVRVK 140

>CAGL0K03223g Chr11 (296371..298167) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38700 Saccharomyces cerevisiae YHL019c
           involved in clathrin-independent transport
          Length = 598

 Score =  125 bits (313), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 110/383 (28%), Positives = 158/383 (41%), Gaps = 125/383 (32%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           VSWRA+GI Y KNE FLD++E +  L+  + G V RS I G +  +S LSGMP LK+ +N
Sbjct: 249 VSWRAKGIHYAKNEFFLDVIEKLQYLVDLESGMVRRSLIHGQIVCRSYLSGMPKLKMSLN 308

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                                           + ND +       +  ++FHQCV L   
Sbjct: 309 ------------------------------KLLQNDKQF------ISQVQFHQCVSLDSI 332

Query: 283 EN----------------------EKIITFIPPDGEFDLMNYRLTTSIK--PLI-WCDVS 317
           E                       E  I FIPPDG+F L +Y L   I+  P++  C   
Sbjct: 333 EKVIKYAEEHSDELKTLKHTEHNAESEIEFIPPDGDFTLCSYELKRHIRDPPMVKLCSFE 392

Query: 318 IQVH-SKSRIEIRCRAKAQIKKKSVAANVQILIPVPD-------DADTP-SFKYSHGSIK 368
           I     K +++I    +   K  +  + + + IP+         D   P  FK S+G + 
Sbjct: 393 ITPKWKKYKLKISAAVETHFKPTNSTSKLDVKIPISKVFKDYQIDLKKPIKFKTSNGRVV 452

Query: 369 YVPEQSAILWKIKSFPGGKEYA-------------MFAEMGL------------------ 397
           Y      +LW+I    GGK +              M AE GL                  
Sbjct: 453 YNISDDFLLWEIGVIKGGKMHGSKEDISKFDNVATMAAEFGLFNEEEYERERKERETSMN 512

Query: 398 -------PSM-DSYEEPKV---------KRP------VQVKFEIPYFTTSGIQVRYLKIN 434
                  P + D Y+E            ++P      + + FEIPY T SG++V YLKI+
Sbjct: 513 PPPLRTGPKLEDIYKETHEENDGYNSVGQKPKNNLNLLSMDFEIPYCTCSGLKVEYLKID 572

Query: 435 EPKLQYKSYPWVRYITQSGDDYT 457
           E +LQY+S+PWVRY T + D+Y 
Sbjct: 573 EDQLQYQSFPWVRYKTINDDEYA 595

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 77/141 (54%), Gaps = 10/141 (7%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S++Y  D+  +PL+S+  K    L  +++   L      +S    P I+     +++I
Sbjct: 1   MSSSIYIFDETLEPLVSKSVKG---LPNVNELGDLFRYHVRQSQ--NPIIDVYNWRFVYI 55

Query: 61  QHNDLYVVALATSLTVNIAEVFA---FLHKLMGVLGEYL--KTVEEESIRDNFVIIYELM 115
           + + LY VA+  +    IA   A   +L +L  +  +Y+  K ++   + DN +++ EL+
Sbjct: 56  KRDTLYFVAVVDAADDAIANYLAILTYLEQLYQLFRDYVGVKVLDRNLVLDNTLLVMELI 115

Query: 116 DEMMDYGIPQITEPRMLKKYI 136
           DE +DYGI Q+TEP ++K YI
Sbjct: 116 DETLDYGIVQLTEPSIMKDYI 136

>Smik_8.23 Chr8 complement(51372..53183) [1812 bp, 603 aa] {ON}
           YHL019C (REAL)
          Length = 603

 Score =  124 bits (312), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 100/358 (27%), Positives = 160/358 (44%), Gaps = 81/358 (22%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  L+  +KG + ++ I G +  +  LSGMP LK+ IN
Sbjct: 260 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 319

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
              I  +            D Q   +      ++ D  K    IE  + K      L   
Sbjct: 320 --KILNR------------DAQFLSNSSFHQCVSLDSIK---TIEKREEKEDDDTGLQAA 362

Query: 283 ENEKIITFIPPDGEFDLMNYRLTTSIK--PLIWC-DVSIQVH-SKSRIEIRCRAKAQIKK 338
            + K + F+PPDGEF L  Y L   +K  P+I   D  I+    K +I+I  + +   K 
Sbjct: 363 ADAKELEFVPPDGEFVLCQYELKRHVKDAPMIKLKDFQIKPKLKKFKIQIETKIQTNFKP 422

Query: 339 KSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEY- 389
            +  + + + IP+         D +    FK + G + +      +LW+I++  G +E+ 
Sbjct: 423 TNSTSKLNVKIPLTKVFQEYRIDLSKQIRFKSNIGKVVFNLSDDFLLWEIQAMKGHREHN 482

Query: 390 ---------------AMFAEMGLPSMDSYEE-----------------PKVK-------- 409
                          +M AE  L + + Y+                  P+++        
Sbjct: 483 TNKTSQDDNDPDACASMVAEFPLFNQEEYDRLQEEKKTSMNPPPLRTGPRLEELYRQVHD 542

Query: 410 ----------RPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 457
                     + V + FEIPY T SG+++ YLK+ EP+LQY+S+PWVRY T S D+Y 
Sbjct: 543 QQIAHVTPRDKLVAIDFEIPYCTCSGLKIEYLKVEEPQLQYQSFPWVRYKTTSDDEYA 600

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 60/98 (61%), Gaps = 5/98 (5%)

Query: 47  PPCINHNGIEYLFIQHNDLYVVALATSL---TVNIAEVFAFLHKLMGVLGEY--LKTVEE 101
           PP ++ N   ++ ++ + L+ V++  +     +++  + AFL +   +L EY  +K + +
Sbjct: 42  PPILSQNDWFFIHLKRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQEYFEIKVLTK 101

Query: 102 ESIRDNFVIIYELMDEMMDYGIPQITEPRMLKKYITQK 139
           + I DN +++ ELMDE +D+GI Q+T+P ++K YI  K
Sbjct: 102 DVILDNVLLVLELMDECIDFGIVQVTDPSIIKDYIRVK 139

>KAFR0C01020 Chr3 (208272..209558) [1287 bp, 428 aa] {ON} Anc_3.165
           YOL062C
          Length = 428

 Score =  121 bits (303), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 112/473 (23%), Positives = 213/473 (45%), Gaps = 71/473 (15%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFST-LLTDLEDESAVIPPCINHNGIEYLF 59
           M SA+     +G+ ++S+ Y++++  S  + F   ++ +    S ++   +      ++ 
Sbjct: 1   MISAILIYTPRGELIVSKLYRNNIKRSISEIFRIQVINNFNVRSPIL--TLGSTTFHHIR 58

Query: 60  IQHND-----LYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYEL 114
              ND     L++V +  +   N A ++ FL KL  +L +Y  T  E  ++D F+ ++E+
Sbjct: 59  STANDPTDDELWLVCVNRN-NANSAAIWEFLQKLNLILQQYGIT-SESKLKDEFMTVHEI 116

Query: 115 MDEMM-DYGIPQITE-----PRMLKKYI--TQKSFKLEKAHKKKRNAARPPSELNNSVSW 166
           +D M+   GI Q T+      +M  K I  T ++   +    K+RN        N S+  
Sbjct: 117 LDNMLLGTGIIQNTDLKSIVDKMSVKPISRTNETTSTQTGFLKRRNTILTTPGANFSLIP 176

Query: 167 RAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGI 226
                 +KKNE F  + ES+N+L+++ G +L++ + G ++IKS L+G P  +  + D   
Sbjct: 177 TNRHDAHKKNEIFFFVNESMNLLVSKDGSILKNYVDGKIEIKSHLNGNPTCQFELVD--- 233

Query: 227 FTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEK 286
                                    ++ IT             D KF QC+   +    +
Sbjct: 234 ------------------------DQTKIT-------------DFKFDQCIEKVQ---SR 253

Query: 287 IITFIPPDGEFDLMNYRLTTSIKPLIWCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQ 346
            +     DGE +++NY +      + +    I    K  ++ R   K+   K   A +V 
Sbjct: 254 TVRVAATDGELEIVNYHVRDDKINIPFKITPIVSTVKDTVDYRISLKSLFPKNLSATDVV 313

Query: 347 ILIPVPDDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFA-----EMGLPSMD 401
           + IPVP +        S+G  K+  EQ+A++W    F G  E  + A        + +++
Sbjct: 314 LTIPVPPNTIDCKINVSNGHCKFKAEQNAVIWTFNKFNGSTENTLSAITIADGRQIMNLE 373

Query: 402 SYEEPKVKRPVQVKFEIPYFTTSGIQVRYLKINEP-KLQYKSYPWVRYITQSG 453
           S+  P     +Q+ FEI  ++ SG+ +R L I +  K +YK+  W++YI+++G
Sbjct: 374 SWTRPS----IQLTFEITMYSISGLLLRNLMITDKDKRRYKASRWIKYISRAG 422

>KNAG0C05550 Chr3 complement(1076437..1078185) [1749 bp, 582 aa]
           {ON} Anc_2.555 YHL019C
          Length = 582

 Score =  121 bits (303), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 98/363 (26%), Positives = 158/363 (43%), Gaps = 106/363 (29%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FL+++E +   +     V++  +I G ++ K  LSGMP+LK+ IN
Sbjct: 253 ISWRTKGIHYAKNEFFLNVIEKVEYFMDFTQNVIKKNLIHGEIRCKCFLSGMPNLKVSIN 312

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                                           I N+ K+      L + KFHQCV L+  
Sbjct: 313 -------------------------------KIVNEDKQF-----LANCKFHQCVSLASL 336

Query: 283 E--NEKIITFIPPDGEFDLMNYRLTTSIK--PLIWCDVSIQVH---SKSRIEIRCRAKAQ 335
           E  + K + F+PPDGEF L  Y L   ++  P++   V+ +V     K ++++    +  
Sbjct: 337 ESSDHKDVEFVPPDGEFTLCRYELKRHVRDEPMVKL-VNFEVKPKLKKFKLKLLLTIETH 395

Query: 336 IKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGK 387
            K  +  + + + +P+         D +     K   G+I +      +LW++ S  GG 
Sbjct: 396 FKTTNATSKLALRVPIKQLFREYRVDLSKNLKSKCDRGAILFNISDDFLLWEVGSMSGGH 455

Query: 388 ---------EYAMF--------AEMGLPSMDS---YEEPK-------------------- 407
                    E+A+F         EM   SM+     E PK                    
Sbjct: 456 GETQLSMGVEFALFNQEEYDREQEMLKTSMNPPPLREGPKLEELYKQIHEDDDDDDGNTE 515

Query: 408 -------------VKRPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGD 454
                        + + + + FE+PY T+SG++V YLKI EP+L+Y+S+PWVRY T S  
Sbjct: 516 PVAEHRLQPRTREIDKLLTMDFEVPYCTSSGLRVEYLKIEEPQLEYQSFPWVRYTTLSDA 575

Query: 455 DYT 457
           +Y 
Sbjct: 576 EYA 578

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 71/143 (49%), Gaps = 10/143 (6%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLS-AIDKFSTLLTDLEDESAVIPPCIN-HNGIEYL 58
           M+S +Y  D+  + L+S+  K    L   I +F  L        +  PP I+ H+   + 
Sbjct: 1   MSSVLYILDENLETLISKNIKAVPSLEYPIAQFKKLY------GSNAPPVIDYHDLFTFT 54

Query: 59  FIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYL--KTVEEESIRDNFVIIYELMD 116
           +IQ + L  V++   +   + E   +L     VL  YL  K +++  + DN V+I EL++
Sbjct: 55  YIQRDSLLFVSVVDRVDTGLVETLVYLEHFYEVLKNYLGVKVLDKNIVTDNSVLISELIE 114

Query: 117 EMMDYGIPQITEPRMLKKYITQK 139
           E +D+G  Q+T+  +L  YI  K
Sbjct: 115 ETIDFGAIQVTDSGLLADYIKMK 137

>Suva_8.33 Chr8 complement(69735..71525) [1791 bp, 596 aa] {ON}
           YHL019C (REAL)
          Length = 596

 Score =  120 bits (302), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 106/379 (27%), Positives = 156/379 (41%), Gaps = 122/379 (32%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  L+  +KG + ++ I G +  +  LSGMP LK+ IN
Sbjct: 252 ISWRTKGIHYSKNEFFLDVIERVQYLMDFEKGIIRKNLIHGEIVCRCYLSGMPKLKISIN 311

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                 K L          DPQ   +                       KFHQCV L   
Sbjct: 312 ------KLLNR--------DPQFMSNS----------------------KFHQCVSLDSI 335

Query: 283 E------------------NEKIITFIPPDGEFDLMNYRLTTSIK--PLIWCDVSIQVH- 321
                              + K I FIPPDGEF L  Y L   +K  P+I      ++  
Sbjct: 336 NIIEEEGRDTDDAGSQTATDTKEIEFIPPDGEFVLCQYELKRHVKDAPMIKLQ-GFEIKP 394

Query: 322 --SKSRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVP 371
              K +I+I  + +   K  +  + + + IP+         D +    FK + G + +  
Sbjct: 395 KLKKFKIQIITKIQTNFKPTNSTSKLNVKIPLTKVFQDYKIDLSKQIRFKANLGKVVFNL 454

Query: 372 EQSAILWKIKSFPGGKE---------------YAMFAEMGLPSMDSYEE----------- 405
               +LW+I +  G +E                +M AE  L + + Y+            
Sbjct: 455 SDDFLLWEIGTMKGHRERNTGTVPQEDDASTLASMVAEFPLFNQEEYDRLQEELKTSMNP 514

Query: 406 ------PKVK---------------------RPVQVKFEIPYFTTSGIQVRYLKINEPKL 438
                 PK++                     + V V FEIPY T SG++V YLK+ EP+L
Sbjct: 515 PPLRTGPKLEELYKQVHEERVLHTHDVAPRDKLVSVDFEIPYCTCSGLKVEYLKVEEPQL 574

Query: 439 QYKSYPWVRYITQSGDDYT 457
           QY+S+PWVRY T S D+Y 
Sbjct: 575 QYQSFPWVRYKTISDDEYA 593

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 82/145 (56%), Gaps = 12/145 (8%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLED-ESAVIPPCINHNGIEYLF 59
           M+S+++  D+  +PL+S+       + AI   S++L+  +       PP ++ NG  ++ 
Sbjct: 1   MSSSLFILDEDLEPLVSKN------IRAIPNLSSILSSFKQCYHRDSPPILSQNGWFFIH 54

Query: 60  IQHNDLYVVALATSL---TVNIAEVFAFLHKLMGVLGEY--LKTVEEESIRDNFVIIYEL 114
           ++ + L+ +++  +     +++  + AFL +   +L +Y  +  + +  I DN +++ EL
Sbjct: 55  LKRDFLHFISVIHATDKPNIDLMSILAFLEQFYHLLKKYFEINVLSKNIILDNVLLVLEL 114

Query: 115 MDEMMDYGIPQITEPRMLKKYITQK 139
           +DE +D+GI Q+T+P ++K YI  K
Sbjct: 115 VDECIDFGIVQVTDPSIIKDYIRVK 139

>YHL019C Chr8 complement(67731..69548) [1818 bp, 605 aa] {ON}
           APM2Protein of unknown function, homologous to the
           medium chain of mammalian clathrin-associated protein
           complex; involved in vesicular transport
          Length = 605

 Score =  120 bits (301), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 101/366 (27%), Positives = 162/366 (44%), Gaps = 93/366 (25%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +  L+  +KG + ++ I G +  +  LSGMP LK+ IN
Sbjct: 258 ISWRTKGIHYAKNEFFLDVIERVQYLMDFEKGVIRKNLIHGEIVCRCYLSGMPKLKISIN 317

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSG-----VAESSITNDGKKRKTNIELEDLKFHQCV 277
              I  +            DPQ   +      V+  SI    K  + N + +        
Sbjct: 318 --KILNR------------DPQFMSNSSFHQCVSLDSINTIEKDEEKNSDDD-------A 356

Query: 278 RLSKFENEKIITFIPPDGEFDLMNYRLTTSIK--PLIWC-DVSIQVH-SKSRIEIRCRAK 333
            L    + + I FIPPDGEF L  Y L   +K  P++   D  I+    K +I+I  + +
Sbjct: 357 GLQAATDAREIEFIPPDGEFVLCQYELKRHVKDAPMVRLKDFEIKPKLKKFKIQIVTKIQ 416

Query: 334 AQIKKKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPG 385
              K  +  + + + IP+         D +    FK + G + +      +LW+I++  G
Sbjct: 417 TNFKPTNSTSKLNVRIPLTKVFQEYKIDLSKQIRFKANIGKVVFNLSDDFLLWEIQTMKG 476

Query: 386 GKEY-------------------AMFAEMGLPSMDSYEE-----------------PKVK 409
            +E+                   +M AE  L + + Y+                  P+++
Sbjct: 477 HREHSTNKSSQYNSDEDDPNTCASMVAEFPLFNQEEYDRLQEEMKTSMNPPPLRTGPRLE 536

Query: 410 ------------------RPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQ 451
                             + V + FEIPY T SG++V YLK+ EP+LQY+S+PWVRY T 
Sbjct: 537 ELYRQVHDQQTSHVTPRDKLVNIDFEIPYCTCSGLKVEYLKVEEPQLQYQSFPWVRYKTV 596

Query: 452 SGDDYT 457
           S ++Y 
Sbjct: 597 SDEEYA 602

 Score = 62.4 bits (150), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 82/144 (56%), Gaps = 10/144 (6%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           M+S+++  D+  +PL+S+  +    LS++   S+      D S   PP ++ N   ++ +
Sbjct: 1   MSSSLFILDENLEPLVSKNIRALPNLSSV--LSSFKQCYHDGS---PPILSQNDWFFIHL 55

Query: 61  QHNDLYVVALATSL---TVNIAEVFAFLHKLMGVLGEY--LKTVEEESIRDNFVIIYELM 115
           + + L+ V++  +     +++  + AFL +   +L +Y  ++ + +  I DN +++ EL+
Sbjct: 56  KRDFLHFVSVIHTTDKPNIDLMTILAFLEQFYHLLQKYFEIEVLTKNVILDNILLVLELI 115

Query: 116 DEMMDYGIPQITEPRMLKKYITQK 139
           DE +D+GI Q+T+P ++K YI  K
Sbjct: 116 DECIDFGIVQVTDPSIIKDYIRVK 139

>TBLA0B06760 Chr2 (1594957..1596930) [1974 bp, 657 aa] {ON}
           Anc_2.555 YHL019C
          Length = 657

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/251 (29%), Positives = 112/251 (44%), Gaps = 55/251 (21%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEII-GAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E    ++  K  ++R  +I G +  +  LSGMP LK+ +N
Sbjct: 287 ISWRTKGIYYAKNEFFLDVLEKQEYIMDFKNDLIRKNLIQGKIICRCFLSGMPKLKIALN 346

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                 K L+                              K    L  L+FHQCV L   
Sbjct: 347 ------KLLQ------------------------------KDQQFLSQLRFHQCVSLETI 370

Query: 283 ENEKIITFIPPDGEFDLMNYRLTTSIK-----PLIWCDVSIQVHSKSRIEIRCRAKAQIK 337
           +N++I  FIPPDGEF L  Y L   +K      LI  ++  ++  K +I+I        K
Sbjct: 371 QNKEI-EFIPPDGEFILCEYELKRHVKDPPNIKLISFEIKPKL-KKFKIQINLSITTFFK 428

Query: 338 KKSVAANVQILIPVP--------DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKE- 388
            ++  + + + IP+         D   +P FK + G +K+      +LW+I S  GG   
Sbjct: 429 VQNSTSILNLKIPLEKLFNDYKIDLKKSPRFKSNIGQVKFNLSDDFLLWEIGSMKGGHGE 488

Query: 389 --YAMFAEMGL 397
              AM AE  L
Sbjct: 489 NIKAMTAEFFL 499

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%)

Query: 412 VQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIRV 460
           + V FEIPY+  SG++V YLKI E +L Y+S+PWVRY T +  DY   V
Sbjct: 609 LTVDFEIPYYACSGLKVEYLKIEEEQLLYQSFPWVRYKTTNDKDYVFVV 657

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 37/147 (25%), Positives = 76/147 (51%), Gaps = 15/147 (10%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIP---PCINHNGIEY 57
           M S ++  D+  +PL+S+       + AI  F +++       +      P ++ N   +
Sbjct: 1   MLSCIFILDENLEPLISKN------IRAIPNFKSIVELFRKHRSTNTTELPIVSINDWNF 54

Query: 58  LFIQHNDLYVVALATSLTVNIAEVFA---FLHKLMGVLGEYLKT--VEEESIRDNFVIIY 112
           + I+ + L  +  A ++   ++++ +   +L K   +L  +LKT  +    I DN ++I 
Sbjct: 55  IQIKRDSLIFLG-AININDYMSDLMSMSIYLDKFYYLLKMHLKTDTLNRNIILDNILLIM 113

Query: 113 ELMDEMMDYGIPQITEPRMLKKYITQK 139
           EL+DE +D+GI Q+T+P ++K Y+  K
Sbjct: 114 ELIDESIDFGIIQMTDPNIIKDYVRVK 140

>NDAI0B01610 Chr2 complement(384287..386305) [2019 bp, 672 aa] {ON}
           Anc_2.555 YHL019C
          Length = 672

 Score = 77.4 bits (189), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/274 (26%), Positives = 111/274 (40%), Gaps = 79/274 (28%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLIT-QKGQVLRSEIIGAVKIKSRLSGMPDLKLGIN 222
           +SWR +GI Y KNE FLD++E +   +  +KG + ++ I G +  K  LSGMP LK+ IN
Sbjct: 295 ISWRTKGIHYAKNEFFLDVIEKVEYFMDFEKGLIRKNLIHGEIVCKCYLSGMPKLKISIN 354

Query: 223 DRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKF 282
                                           + ND +       L +  FHQCV L   
Sbjct: 355 ------------------------------KILQNDSQF------LSNAHFHQCVSLDSL 378

Query: 283 -----------------ENE--------KIITFIPPDGEFDLMNYRLTTSIK--PLI--- 312
                            ENE        K I FIPPDG+F L  Y L   +K  P+I   
Sbjct: 379 HLQSAEDDDGDDNANVNENENHDERDRKKEIEFIPPDGDFLLCKYELKRHVKDLPVIKLK 438

Query: 313 WCDVSIQVHSKSRIEIRCRAKAQIKKKSVAANVQILIPVP--------DDADTPSFKYSH 364
             D+  ++ SK +++I    +   K  +  + + + IP+         D +    FK   
Sbjct: 439 LFDIKPKL-SKYKLKIHVIIETHFKTTNNTSKLNLKIPIERLFQEYRIDLSKQIKFKCDQ 497

Query: 365 GSIKYVPEQSAILWKIKSFPGGK---EYAMFAEM 395
           G + +    + ++W+I S  GG      +M AE 
Sbjct: 498 GKVLFNLSDNFLIWEIGSMKGGHGEVTMSMMAEF 531

 Score = 67.4 bits (163), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 26/46 (56%), Positives = 38/46 (82%)

Query: 412 VQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYT 457
           +++ FEIPY+T SG+++ YLKI EP+LQY+S+PWVRY T S ++Y 
Sbjct: 624 LKIDFEIPYYTCSGLKIEYLKIEEPQLQYQSFPWVRYKTISDEEYA 669

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 84/169 (49%), Gaps = 36/169 (21%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLE------------DESAVIPP 48
           M+S ++  D+  +P+L++  +     S  + F  LL   E            D+S V+P 
Sbjct: 1   MSSCIFILDENLEPILNKNIR-----SIGNNFELLLKFQEIYRKQQNEIHNNDDSKVLP- 54

Query: 49  CINHN---------------GIEYLFIQHNDLYVVALATSLTVN-IAEVFAFLHKLMGVL 92
            +N N               G ++L I+ + L  V++  + ++N +  +F++L +   +L
Sbjct: 55  ILNTNDYGMSNSTNGGGGNCGWQFLHIKRDSLIFVSIIENNSMNSLMIIFSYLEEFYKLL 114

Query: 93  GEYLKT--VEEESIRDNFVIIYELMDEMMDYGIPQITEPRMLKKYITQK 139
             YL    +++  + DNF+++ EL+DE +D+GI Q T+  ++K YI  K
Sbjct: 115 KSYLNVTKLDKGLLIDNFLLVMELLDESLDFGIVQFTDSSLIKDYIRVK 163

>SAKL0A09218g Chr1 complement(802348..803734,803809..803843) [1422
           bp, 473 aa] {ON} similar to uniprot|P38153 Saccharomyces
           cerevisiae YBR288C APM3 Mu3-like subunit of the yeast
           AP-3 complex which functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
           clathrin associated protein medium chain
          Length = 473

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/284 (22%), Positives = 111/284 (39%), Gaps = 77/284 (27%)

Query: 53  NGIEYLFIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYL--KTVEEESIRDNFVI 110
           +G+ Y  +Q  ++         T N  E F FL  +  +L +Y     ++   I  N+  
Sbjct: 72  DGLRYWCLQRTEI-----GEGSTPNPVEPFVFLQTVDTILNQYFGKDVLKASKITKNYDR 126

Query: 111 IYELMDEMMDYGIPQITEPRMLKKYI-------------------TQKSFKLEKAHKKKR 151
           +  L + M+D G P IT+   LK+ +                   T  + +  +   K  
Sbjct: 127 VTLLFNSMVDAGEPDITDLNRLKEIVPLKNNFARVINSTASSIGKTISNAEGNQMFSKHS 186

Query: 152 NAARPPSEL-----NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQV-----LRSEI 201
           + +R  S +     + +V WR+ G+KY  NE ++D+ E++N+++ +         +   I
Sbjct: 187 SNSRIGSSVSYANRDRTVPWRSAGVKYTNNELYVDMAETVNIILAKTRNSTSLVPISGSI 246

Query: 202 IGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKK 261
            G V  K  LS  P ++L +N  G                    H  G+           
Sbjct: 247 DGEVGFKCYLSENPLVELDLNTNG--------------------HDLGIP---------- 276

Query: 262 RKTNIELEDLKFHQCVRLSKFE-NEKIITFIPPDGEFDLMNYRL 304
                      FH+CVR    + +   + FIPPDG+F LM Y +
Sbjct: 277 ----------AFHRCVRTEGSDFHPGTLRFIPPDGDFCLMEYNI 310

>TDEL0A02970 Chr1 complement(532395..533885) [1491 bp, 496 aa] {ON}
           Anc_2.522 YBR288C
          Length = 496

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 85/339 (25%), Positives = 135/339 (39%), Gaps = 94/339 (27%)

Query: 158 SELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLR----------SEIIGAVKI 207
           S  ++ V WR  G+KY  NE ++D+ ESI+++  + G+  R            I G   +
Sbjct: 205 SREDDVVPWRTAGLKYSNNELYVDLTESIHVVYQKAGKRSRRTSSKLEMICGTINGQASV 264

Query: 208 KSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIE 267
           K  LSG P + L ++        L GN++GV  P                          
Sbjct: 265 KCYLSGNPTVDLQLD--------LAGNDLGV--P-------------------------- 288

Query: 268 LEDLKFHQCVRLSKFENEK--IITFIPPDGEFDLMNY------------RLTTSIKPLIW 313
                FH+CV L   +N     + FIPPDG F+LM Y            R       L+ 
Sbjct: 289 ----AFHECVELDNHQNPSNCDLRFIPPDGRFNLMQYSIDLDTPRIQQTRRFNHTVGLVT 344

Query: 314 CDVSIQVHSKS-RIEI-----RCRAKAQIKKKSVAANVQILIPVPDDADT----PSFKYS 363
            D + Q+ +K+   EI       R  A I+   +  +VQ+     +D++T       + +
Sbjct: 345 IDFADQLGNKTDEFEITVNISNSREVANIEDLRI--DVQLQSNTDEDSETDFKIKVLRNT 402

Query: 364 HGSI--KYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPYF 421
           HG      VP Q + ++  K  P G          LP +    E    R ++V+     +
Sbjct: 403 HGRFDNSVVPGQGSWIFD-KDTPTGT---------LPVLRGCVESTEPRLLRVQRVTASY 452

Query: 422 TTSG---IQVRYLKINEPKLQYKS---YPWVRYITQSGD 454
           + SG     +R   IN  +L  KS   +  V+Y T++GD
Sbjct: 453 SLSGQLASGIRVKAINIGQLTTKSNRPFKGVKYATKTGD 491

>AGL061W Chr7 (593647..594882) [1236 bp, 411 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR288C (APM3)
          Length = 411

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 91/410 (22%), Positives = 155/410 (37%), Gaps = 74/410 (18%)

Query: 84  FLHKLMGVLGEYL--KTVEEESIRDNFVIIYELMDEMMDYGIPQITEPRMLKKYITQK-- 139
           FL +   VL EY   + +  + + +N   +  L+  M+D G   +T+   L++ +  +  
Sbjct: 41  FLAQYHQVLIEYFDKEALTVKKLVNNADRLALLLHAMLDAGEVAVTDSNRLRQLVPLRND 100

Query: 140 -SFKLEKAHKKKRNA--------------ARPPSELNNSVSWRAEGIKYKKNEAFLDIVE 184
            S  L  A K   N               A    E   +V WR    +Y  NE ++D+VE
Sbjct: 101 LSTILNSATKTLANTVKYADSKQLFGAPVATGKVEAGQTVPWRTADCRYVNNEIYVDLVE 160

Query: 185 SINMLITQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQ 244
           ++N  + QKG  L         I   LSG  D+K           YL GN      P  Q
Sbjct: 161 TVNATLRQKGSSL-------TLINGSLSGKIDVKC----------YLSGN------PTVQ 197

Query: 245 EHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 304
                          K R +   L++   H+CV L +      + F+PPDG F L  Y +
Sbjct: 198 L--------------KLRTSGHPLDNSALHRCVELGE-AGVATMNFVPPDGRFTLAEYAI 242

Query: 305 TTS--------IKPLIWCDVSIQV---HSKSRIEIRCRAKAQIKKKSVAANVQILIPVPD 353
             S        +  L    VS+       +   EI+       +  ++  +++I +  PD
Sbjct: 243 DLSAISQAARRLTNLGLVTVSLASGLGQHRDEFEIKVIIGNSTQVAAI-EDLRITVYFPD 301

Query: 354 DADTPSFKY---SHGSIKYVPEQSAILWKI-KSFPGGKEYAMFAEMGLPSMDSYEEPKVK 409
            +D    K    +HG  +    +   +W   K    G    +   +  P    +  P   
Sbjct: 302 ISDAAKIKILRTTHGGWESDLSRVRGVWAFDKQTAVGSVPVLRGCVENPESTPHAPPVFP 361

Query: 410 RPVQVKFEIPYFTTSGIQVRYLKINEPKLQYKSYPWVRYITQSGDDYTIR 459
             + V +       SGI+V  + +++     K +  V+Y +++G DY +R
Sbjct: 362 SHLAVSYSHVGQLPSGIRVDTIALSDLPPGSKPFKGVKYTSRAG-DYIVR 410

>TPHA0C04130 Chr3 complement(886804..888405) [1602 bp, 533 aa] {ON}
           Anc_2.522 YBR288C
          Length = 533

 Score = 59.3 bits (142), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 45/181 (24%), Positives = 80/181 (44%), Gaps = 58/181 (32%)

Query: 143 LEKAHKKKRNAARPPSELNNSVS--WRAEGIKYKKNEAFLDIVESINMLITQKGQ----- 195
           L+K+ K++ N        +++V+  WR   + +  NE +LD+VESI++++  K +     
Sbjct: 179 LQKSQKQQSNFPYQDMNFDSNVAVPWRMRNVDHVNNELYLDLVESIHVVLETKKRKSSYA 238

Query: 196 -----VLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGV 250
                ++   IIG   +KS L+G P +++ I+        + GN                
Sbjct: 239 NSTMKIVTGNIIGKALVKSVLNGNPIVEMKID--------MAGN---------------- 274

Query: 251 AESSITNDGKKRKTNIELEDLKFHQCVRL------SKFENEKIITFIPPDGEFDLMNYRL 304
                           +LE +  H+CV+        +FEN K+I F+PPDG F L +Y +
Sbjct: 275 ----------------DLESIFLHECVKSKDVDKDQEFENTKLIKFLPPDGSFKLFDYNI 318

Query: 305 T 305
            
Sbjct: 319 N 319

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 65/156 (41%), Gaps = 45/156 (28%)

Query: 154 ARPPSELNNSVSWRAEGIKYKKNEAFLDIVESINMLI-----TQKGQVLRSEIIGAVKIK 208
           A+ P+     V WR+ G+KY  NE ++D+VE++++++     T +   +R  + G V  +
Sbjct: 176 AKGPAAKEKLVPWRSAGVKYSNNELYVDVVETVHVILRKNEKTGELTSVRGVLDGVVDFR 235

Query: 209 SRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIEL 268
           S LSG P + L +  RG                    H  G+                  
Sbjct: 236 SHLSGNPVIALNLRLRG--------------------HDLGMP----------------- 258

Query: 269 EDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNYRL 304
                HQC   S       + F+PPDG+F LM+Y +
Sbjct: 259 ---ALHQCCLDSYQGRPDQLRFVPPDGKFQLMHYSI 291

>Kwal_26.7957 s26 complement(586544..587914) [1371 bp, 456 aa] {ON}
           YBR288C (APM3) - clathrin associated protein medium
           chain [contig 55] FULL
          Length = 456

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (45%), Gaps = 45/146 (30%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLI--TQK-GQV--LRSEIIGAVKIKSRLSGMPDLK 218
           V WR  G+KY  NE ++D+VE+I++++  T+K GQ+  +R  I G V  +S L+G P + 
Sbjct: 186 VPWRTAGLKYSNNELYVDVVETIHVILRKTEKSGQLVPVRGLIDGYVDFRSHLTGNPVVA 245

Query: 219 LGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVR 278
           L +N        L G+++GV                                   H C +
Sbjct: 246 LKLN--------LHGHDLGVP--------------------------------ALHPCCQ 265

Query: 279 LSKFENEKIITFIPPDGEFDLMNYRL 304
                + + + F+PPDG+F LM Y +
Sbjct: 266 AQYTGSPENLQFVPPDGKFRLMQYTI 291

>ZYRO0B01738g Chr2 complement(139975..141453) [1479 bp, 492 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 492

 Score = 57.0 bits (136), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 47/188 (25%), Positives = 80/188 (42%), Gaps = 50/188 (26%)

Query: 132 LKKYITQKSFKLEKAHKKKRN---AARPP-SELNNSVSWRAEGIKYKKNEAFLDIVESIN 187
           L K I   +  L++A ++ R    AA P   E    V WR+  +KY  +E ++DI+E+++
Sbjct: 156 LSKMINNTAHTLQRAVRQPRQGILAATPEILESEEVVPWRSGHLKYTSDEIYVDIIETVH 215

Query: 188 MLI-----TQKGQVLRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPD 242
           ++          Q++   I G V +KS LSG P +++ ++        L GN        
Sbjct: 216 VIYQTHHRNNSVQMVSGTINGQVNVKSYLSGNPTVEMDMD--------LAGN-------- 259

Query: 243 PQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNY 302
                                   E+     HQCV + +  +   + FIPPDG  +L+NY
Sbjct: 260 ------------------------EMYAPSMHQCVEMPQ-GSPSSLCFIPPDGNCNLLNY 294

Query: 303 RLTTSIKP 310
            +   + P
Sbjct: 295 TIDLDMNP 302

>KLLA0E18789g Chr5 (1669103..1670596) [1494 bp, 497 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288C APM3
           Mu3-like subunit of the yeast AP-3 complex which
           functions in transport of alkaline phosphatase to the
           vacuole via the alternate pathway clathrin associated
           protein medium chain
          Length = 497

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 63/145 (43%), Gaps = 35/145 (24%)

Query: 162 NSVSWRAEGIKYKKNEAFLDIVESINMLITQKGQVLRSEIIGAVKIKSRLSGMP--DLKL 219
           + V WR  GI Y  NE F+D+ E IN ++ +KG++L   I G + + + LSG P  ++KL
Sbjct: 208 SGVPWRMSGINYANNEIFIDMSEEINAIV-EKGKLLTGHIKGCIDLNNHLSGQPLVEMKL 266

Query: 220 GINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRL 279
           G+ D  +                   H +      I  D    K N  + DL   +  +L
Sbjct: 267 GLLDHKL------------------SHLNTTFHRCILED----KAN-SINDLIAGKFTKL 303

Query: 280 SKFENEKIITFIPPDGEFDLMNYRL 304
                    TF+PPDG   L  Y L
Sbjct: 304 ---------TFVPPDGRTRLCQYTL 319

>KAFR0D03560 Chr4 complement(695693..697060) [1368 bp, 455 aa] {ON}
           Anc_2.522 YBR288C
          Length = 455

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 81/340 (23%), Positives = 130/340 (38%), Gaps = 67/340 (19%)

Query: 1   MASAVYFCDDKGKPLLSRRYKDDVP-----LSAIDKFSTLLTDLEDESAVIPPCINHNGI 55
           M  A Y CD K + +         P     L+ I      + D+E    V         I
Sbjct: 1   MYIAFYICDTKNQLVFQYLCDSIAPHFSKLLTRIHSLCPEVLDVETRGNVSKDL----KI 56

Query: 56  EYLFIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLK--TVEEESIRDNFVIIYE 113
              F   N+L   AL      +  E    L  +  +L EY     +    I +N+  +  
Sbjct: 57  YRYFSATNNLNYYALTIVSRHHDLEPHHVLESIDTLLVEYFNKTNLTTTKIMNNYDRMTI 116

Query: 114 LMDEMMDYGIPQITEPRM--LKKYITQK---SFKLEKAHKKKRNAARPPSELNNSV-SWR 167
           L D ++D GI       M  L+  I  K   S  +  A K  +    P   ++N V  WR
Sbjct: 117 LFDLLIDGGIIDGNNFYMNKLRNQIPLKNDFSNFINDAAKSLQKGQAPSKTVDNEVVPWR 176

Query: 168 AEGIKYKKNEAFLDIVESINMLI------TQKGQVLRSEIIGAVKIKSRLSGMPDLKLGI 221
           ++ IK  +NE ++D+ E++ + +      + + ++L   I G+V + S + G+P L++  
Sbjct: 177 SKEIKTVRNEIYVDVKETLYVTLIKSNRASHRLKLLNGYINGSVSVDSSIGGVPMLEVSF 236

Query: 222 NDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRLSK 281
                      G +    IP                              KFH CV +++
Sbjct: 237 G----------GCDFKDIIP------------------------------KFHDCVEVNE 256

Query: 282 F--ENEKIITFIPPDGEFDLMNYRLTTSI--KPLIWCDVS 317
           F   +  II FIPPDG+F LM Y +  S     LI C+ +
Sbjct: 257 FLTNDGNIIKFIPPDGKFQLMEYSMALSSFNDNLISCNFT 296

>TBLA0I00620 Chr9 complement(110231..112060) [1830 bp, 609 aa] {ON}
           Anc_2.522 YBR288C
          Length = 609

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 79/166 (47%), Gaps = 46/166 (27%)

Query: 161 NNSVSWRAEGIKYKKNEAFLDIVESINMLITQKG------------------QVLRSEII 202
           N  V WR+  +KY  NE ++D++E I+++  ++                   +++R++II
Sbjct: 253 NKVVPWRSGNVKYTNNEIYIDVIEEIHVVYQRRNSKRYHKINQFNRNDNSPMKLIRADII 312

Query: 203 GAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKR 262
           G + ++S LS  P +++ + DR              N  D +   +G +E+ +      +
Sbjct: 313 GELNVRSYLSDNPMVEVTLVDR--------------NYSDQK---TGWSENDLF-----K 350

Query: 263 KTNIELEDLKFHQCVRLS--KFENEKI--ITFIPPDGEFDLMNYRL 304
           + N+ L    FH CV +   K  N+    I FIPPDG+F LM Y +
Sbjct: 351 QLNLGLP--MFHDCVEIDYEKGINQDFRHIKFIPPDGKFSLMKYNI 394

>Kpol_1018.42 s1018 (137162..138889) [1728 bp, 575 aa] {ON}
           (137162..138889) [1728 nt, 576 aa]
          Length = 575

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 60/160 (37%)

Query: 166 WRAEGIKYKKNEAFLDIVESINML----ITQKGQVLRSE----------IIGAVKIKSRL 211
           WR++ +K+  NE ++D+VES++++    I +  ++ RS+          + G   ++S L
Sbjct: 203 WRSQNVKHNNNEIYIDLVESVHVVYQTKIRRSNELTRSKQSIKKIVNGYLKGTAYVQSFL 262

Query: 212 SGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDL 271
           +G P ++L +         L GN+IG        H S                       
Sbjct: 263 NGNPLVELQLE--------LSGNDIG--------HPS----------------------- 283

Query: 272 KFHQCVRLSKF----ENEKI--ITFIPPDGEFDLMNYRLT 305
            FH+CV + ++    +N  I  + FIPPDG+F LM+Y +T
Sbjct: 284 -FHECVDIDEYLKNIDNSSISSLKFIPPDGKFTLMDYTIT 322

>ZYRO0E09746g Chr5 complement(772264..773880) [1617 bp, 538 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 538

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 65/134 (48%), Gaps = 8/134 (5%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVV 68
           GKPLLSR++++   D  L  +  F +L+T+L  E   +      N + Y++   +D Y++
Sbjct: 13  GKPLLSRQFRELTKDRVLELLSNFQSLVTNLSSEHTFV----EGNHVRYVYRPFDDYYII 68

Query: 69  ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITE 128
            L T+   NI E  + L+ L   +   L + +E  I D+   I    DE++  G  +   
Sbjct: 69  -LITNRQSNIIEDLSTLNLLSQTVNNCLSSYDENEIYDSAFEILTAFDEVVIMGYKENLS 127

Query: 129 PRMLKKYITQKSFK 142
              +  Y+T +S +
Sbjct: 128 STQVTTYLTMESHE 141

>Suva_4.548 Chr4 complement(950244..951698) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 68/145 (46%), Gaps = 42/145 (28%)

Query: 164 VSWR-AEGIKYKKNEAFLDIVESINMLITQKGQVLR---SEIIGAVKIKSRLSGMPDLKL 219
           V WR ++  K++ NE ++D++E+ ++++ +K   LR    +I GAV ++S L+  P + +
Sbjct: 199 VPWRTSKTSKHENNELYVDLLETFHVVLEKKKTRLRLVNGDICGAVDVRSYLNDNPLVSV 258

Query: 220 GINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRL 279
            +N  G        N IG+    P  H        I +DG+   +NI             
Sbjct: 259 KLNTMG--------NEIGI----PSLHEC----VEINDDGEFTPSNI------------- 289

Query: 280 SKFENEKIITFIPPDGEFDLMNYRL 304
                    TFIPPDG+F L+ Y +
Sbjct: 290 ---------TFIPPDGKFRLLEYSI 305

>KLLA0D11396g Chr4 complement(976408..978018) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051C RET2 Delta subunit of the coatomer complex
           (COPI) which coats Golgi-derived transport vesicles
           involved in retrograde transport between Golgi and ER
          Length = 536

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/165 (24%), Positives = 74/165 (44%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           AV     KGKPLLSR+++D   D  +  +  F TL+ +    S+     +    + Y++ 
Sbjct: 5   AVSITTRKGKPLLSRQFRDITKDRVMELLSNFQTLVAN----SSKQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+L  NI +    L+  +  +   LK + EE + D+   I    DE++ 
Sbjct: 61  PFDDYYII-LITNLHSNIIQDMDTLNIFVQTVDSTLKGLSEEDVFDSAFDILNSFDEIIT 119

Query: 121 YGIPQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            G  +      +K ++  +S             + E A ++KR A
Sbjct: 120 MGYKENLSLTQIKTFLAMESHEERIQEIIERNKEFEAAEERKRRA 164

>Skud_2.419 Chr2 complement(746943..748397) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 65/145 (44%), Gaps = 42/145 (28%)

Query: 164 VSWR-AEGIKYKKNEAFLDIVESINMLITQKGQVLR---SEIIGAVKIKSRLSGMPDLKL 219
           V WR ++  K++ NE ++D++E+ +++   K   LR     I G V ++S L+  P + +
Sbjct: 199 VPWRTSKASKHENNELYVDLLETFHVVFETKKSRLRLVNGNIHGTVDVRSYLNNNPLVSV 258

Query: 220 GINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRL 279
            +N  G        N+IGV    P  H        I +DG+   +NI             
Sbjct: 259 KLNTMG--------NDIGV----PTLHEC----VEIKDDGEFLPSNI------------- 289

Query: 280 SKFENEKIITFIPPDGEFDLMNYRL 304
                    TFIPPDG+F L+ Y +
Sbjct: 290 ---------TFIPPDGKFRLLEYSV 305

>YBR288C Chr2 complement(778012..779463) [1452 bp, 483 aa] {ON}
           APM3Mu3-like subunit of the clathrin associated protein
           complex (AP-3); functions in transport of alkaline
           phosphatase to the vacuole via the alternate pathway
          Length = 483

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 62/273 (22%), Positives = 112/273 (41%), Gaps = 70/273 (25%)

Query: 66  YVVALATSLTVNIAEVFAFLHKLMGVLGEYLKT--VEEESIRDNFVIIYELMDEMMDYGI 123
           Y    +TS +    + F FL  +  +L EY     +  + I +N+  I  + +  ++ G 
Sbjct: 74  YWCLASTSKSKGPLDCFTFLETIDRILLEYFDKDKLSIKKIVNNYDRISLIFNCCVEAGE 133

Query: 124 PQIT-------------EPRMLKKYITQKSFKLEKA---------HKKKRNAARPPSELN 161
           P ++             E   L K+I+  +  L++A           ++   +R  + L 
Sbjct: 134 PNVSDMLYVNKIKEAVPERSDLSKFISSTAHNLQQAVQLPQQRQQQLQQNQISRGSNSLI 193

Query: 162 NS---VSWR-AEGIKYKKNEAFLDIVESINMLITQKGQVLR---SEIIGAVKIKSRLSGM 214
            +   V WR +   K++ NE ++D++E+ +++  +K   LR     I G V ++S L+  
Sbjct: 194 ENEEIVPWRTSRASKHENNELYVDLLETFHVVFEKKKSHLRLLTGSIHGIVDVRSYLNDN 253

Query: 215 PDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFH 274
           P + + +N  G        N+IG+    P  H     +    NDG    +NI        
Sbjct: 254 PLVAVKLNTMG--------NDIGI----PSLH-----DCVEINDGVFSPSNI-------- 288

Query: 275 QCVRLSKFENEKIITFIPPDGEFDLMNYRLTTS 307
                         TFIPPDG+F L+ Y +  S
Sbjct: 289 --------------TFIPPDGKFRLLEYSVDLS 307

>Smik_7.371 Chr7 complement(610971..612767) [1797 bp, 598 aa] {ON}
           YFR051C (REAL)
          Length = 598

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 11  KGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYV 67
           +GKPLLSR++KD   D  L  +  F  L+T++  +   +        + Y++   ++ Y+
Sbjct: 65  QGKPLLSRQFKDLSKDRVLELLSNFQNLVTEISSDHTFV----EDKHVRYVYRPFDNYYI 120

Query: 68  VALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYG 122
           + L T+   NI +  + L+     +  YL + +++ I  N   I    DE++  G
Sbjct: 121 I-LITNRQSNIIKDLSTLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 174

>Skud_6.142 Chr6 complement(245137..246777) [1641 bp, 546 aa] {ON}
           YFR051C (REAL)
          Length = 546

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 57/122 (46%), Gaps = 8/122 (6%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           A      +GKPLLSR++KD   D  L  +  F  L++++  +   +        + Y++ 
Sbjct: 5   AASITTRQGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFV----EDKHVRYVYR 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             ++ Y++ L T+   NI +  A L+     +  YL + +++ I  N   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVS 119

Query: 121 YG 122
            G
Sbjct: 120 MG 121

>KNAG0D03000 Chr4 complement(537905..539596) [1692 bp, 563 aa] {ON}
           Anc_3.575 YFR051C
          Length = 563

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 68/162 (41%), Gaps = 29/162 (17%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIE-----YLFIQHN 63
           GK LLSR++KD   D  L  +  FS L        A+     +H  +E     +++   +
Sbjct: 13  GKALLSRQFKDLSRDRVLELLSNFSNL--------ALASSGTDHTYVEDEHVRFVYKPLD 64

Query: 64  DLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGI 123
           D Y+V L T+   NI    A L+     +G Y+  V E+ + DN   I    DE++  G 
Sbjct: 65  DYYIV-LVTNRQSNIIRDLATLNLFAETVGVYVSGVPEDGVFDNAFEILSAFDEIVVMGH 123

Query: 124 PQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            +      +  Y+  +S             +LE   ++KR A
Sbjct: 124 KEQLSQTQVNTYLAMESHEERIQEIIERNKELEATEERKRRA 165

>KLTH0G00528g Chr7 (36584..38485) [1902 bp, 633 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 633

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 73/165 (44%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLED---ESAVIPPCINHNGIEYLFI 60
           AV     +GKPLLSR+++D     + D+ + LL++ +    +S+     +    + Y++ 
Sbjct: 101 AVSIVTRQGKPLLSRQFRD----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 156

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +    L      +  YL + +E  I +N   I    DE++ 
Sbjct: 157 PFDDYYII-LITNRQSNIIQDLDTLKLFSQSMNTYLSSFDENEIFENAFEILSSFDEVIT 215

Query: 121 YGIPQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            G  +      +  Y++ +S             + E A ++KR A
Sbjct: 216 MGYKENLSISQINTYLSMESHEEKIQEIIERNKEFEAAEERKRRA 260

>Smik_2.430 Chr2 complement(763687..765141) [1455 bp, 484 aa] {ON}
           YBR288C (REAL)
          Length = 484

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 63/145 (43%), Gaps = 46/145 (31%)

Query: 164 VSWR-AEGIKYKKNEAFLDIVESINMLITQKGQVLR---SEIIGAVKIKSRLSGMPDLKL 219
           V WR +   K++ NE +LD++E+ +++  +K   +R     I G + ++S L+  P + +
Sbjct: 199 VPWRTSRASKHENNELYLDLLETFHVVFEKKKSHIRLVNGNIHGTLDVRSYLNDTPLVLV 258

Query: 220 GINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVRL 279
            +N          GN+IG  IP                                H+CV +
Sbjct: 259 KLNTM--------GNDIG--IP------------------------------SLHECVEI 278

Query: 280 SK--FENEKIITFIPPDGEFDLMNY 302
           +     +   ITFIPPDG+F L+ Y
Sbjct: 279 NDGGVFSPSNITFIPPDGKFRLLEY 303

>YFR051C Chr6 complement(250163..251803) [1641 bp, 546 aa] {ON}
           RET2Delta subunit of the coatomer complex (COPI), which
           coats Golgi-derived transport vesicles; involved in
           retrograde transport between Golgi and ER
          Length = 546

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 56/115 (48%), Gaps = 8/115 (6%)

Query: 11  KGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYV 67
           +GKPLLSR++KD   D  L  +  F  L++++  +   +        + Y++   ++ Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLSNFQNLVSEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  VALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYG 122
           + L T+   NI +  A L+     +  YL + +++ I  N   I    DE++  G
Sbjct: 68  I-LITNRQSNIIKDLATLNLFSQTINSYLSSFQDQEIFHNAFEILSSFDEIVSMG 121

>AFR274C Chr6 complement(926082..927680) [1599 bp, 532 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR051C
           (RET2)
          Length = 532

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           AV      GKPL+SR++KD   D  +  +  F  L+ +    S+     +    + Y++ 
Sbjct: 5   AVSITTRSGKPLVSRQFKDISRDRIMELLSNFQGLVAN----SSRQHTFVEEEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +    L+     +  +LK   E+ I DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSHLKGFSEDEILDNAFDILGSFDEIIS 119

Query: 121 YGIPQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            G  +      +  +++ +S             + E A ++KR A
Sbjct: 120 LGCKENLSLSQINTFLSMESHEEKLQEIIERNKEFEAAEERKRRA 164

>NCAS0A04870 Chr1 (973552..975021) [1470 bp, 489 aa] {ON} Anc_2.522
           YBR288C
          Length = 489

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 69/352 (19%), Positives = 126/352 (35%), Gaps = 99/352 (28%)

Query: 152 NAARPPSELNNSVSWRAEGIKYKKNEAFLDIVESINMLITQKG---------------QV 196
           NA+      +  V WR  GIK  K E ++D+ E + +   +                 ++
Sbjct: 177 NASSSSRGEDMVVPWRRNGIKDAKEELYVDLKEEVYVTYRKSDRHHGRDGIRTSNPSMEL 236

Query: 197 LRSEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSIT 256
           +   I G + ++  L+G P + L      +F     GN++G  IP               
Sbjct: 237 VSGHIKGTIDVRCYLNGNPTVSL------MFDTM--GNDLG--IP--------------- 271

Query: 257 NDGKKRKTNIELEDLKFHQCVRLS-------------KFENEKIITFIPPDGEFDLMNYR 303
                           FH CV                 F+ ++++ F+PPDG+F L  Y 
Sbjct: 272 ---------------SFHACVEQEDQVQEQKQEQEPESFQGKRLLRFLPPDGKFRLAQYV 316

Query: 304 L----TTSIKPLIWCDVSIQVH-------SKSRIEIRCRAKAQIKKKSVAANVQILIPVP 352
           +       +   +  D  IQV        +K   E+R   +  I       ++ + +   
Sbjct: 317 IDLDGQGGMSRRMDRDGLIQVSFEDGLGLNKDEFEVRLHVRESIAVVDPVEDLVVTLQFS 376

Query: 353 --DDADTPSFKYSHGSIKYVPEQSAILWKIKSFPGGKEYAMFAEMGLPSM-----DSYEE 405
             +D++    + +HG+     E     W+  S          +   LP +     DS   
Sbjct: 377 NGNDSNVKMLRATHGTFVGQDEDRQCSWRFDS-------DEISAGTLPVLRGCIDDSKHV 429

Query: 406 PKVKR----PVQVKFEIPYFTTSGIQVRYLKIN--EPKLQYKSYPWVRYITQ 451
            + KR     V V++  P    SG +V  L ++   P+++ K +  VR +T+
Sbjct: 430 QQKKRSCLTSVAVRYGYPGELASGCRVTRLDVDVASPRVRGKVFKGVRCVTR 481

>NCAS0F04010 Chr6 complement(800653..802296) [1644 bp, 547 aa] {ON}
           Anc_3.575 YFR051C
          Length = 547

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 70/165 (42%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           A       GKPLLSR++++   D  +  +  F  L++ +  +   +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKDRVMELLSNFQGLVSSISSDHTFV----EDEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +  + L+     +  YL + +E  + DN   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLSTLNLFSQTVNSYLSSYDETELYDNAFEILSSFDEIVV 119

Query: 121 YGIPQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            G  +      +  Y++ +S             +LE   ++KR A
Sbjct: 120 MGYKENLTAAQVSTYLSMESHEERIQEIIERNKELEATEERKRRA 164

>TDEL0D06430 Chr4 complement(1151544..1153154) [1611 bp, 536 aa]
           {ON} Anc_3.575 YFR051C
          Length = 536

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 72/157 (45%), Gaps = 20/157 (12%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVV 68
           GKPLLSR++++   D  L  +  F +L+T++  +   +        + Y++   +D Y++
Sbjct: 13  GKPLLSRQFREITKDRVLELLSNFQSLVTNISSDHTFV----EDEHVRYVYRPFDDYYII 68

Query: 69  ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYG------ 122
            L T+   NI    + L+     +  YL + +E  I +N   I    DE++  G      
Sbjct: 69  -LITNRQSNIIMDLSTLNLFSQTVNSYLSSYDEAEIFENAFEILSSFDEIVVMGYKENLS 127

Query: 123 IPQITEPRMLKKY------ITQKSFKLEKAHKKKRNA 153
           I Q+     L+ +      I +++ + E   ++KR A
Sbjct: 128 ITQVNTYLSLESHEERIQEIIERNKEFEATEERKRRA 164

>Kwal_47.19292 s47 complement(1174899..1176515) [1617 bp, 538 aa]
           {ON} YFR051C (RET2) - vesicle coat component [contig
           344] FULL
          Length = 538

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 72/165 (43%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLED---ESAVIPPCINHNGIEYLFI 60
           AV     +GKPLLSR++++     + D+ + LL++ +    +S+     +    + Y++ 
Sbjct: 5   AVSIVTRQGKPLLSRQFRE----ISKDRVTELLSNFQGLVAKSSSQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +    L      +  YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLDTLKIFSQTMNTYLSSFDEHEIFENAFEILSSFDEVIT 119

Query: 121 YGIPQITEPRMLKKYITQKSF------------KLEKAHKKKRNA 153
            G  +      +  Y++ +S             + E A  +KR A
Sbjct: 120 MGYKENLSMTQINTYLSMESHEEKIQEIIERNKEFEAAEDRKRRA 164

>TPHA0G03700 Chr7 complement(783421..785040) [1620 bp, 539 aa] {ON}
           Anc_3.575 YFR051C
          Length = 539

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 89/199 (44%), Gaps = 23/199 (11%)

Query: 4   AVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPP---CINHNGIEYLFI 60
           A       GKPLLSR++   V +S  D+   LL++ +   A I      +    + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQF---VEMSK-DRVMELLSNFQGLVANISSDHTYVEDEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +  + L+     +  YL + +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYLI-LMTNRQSNIIQDLSTLNLFSQTVNYYLNSFDENEIFENAFEILSSFDEIIV 119

Query: 121 YGIPQITEPRMLKKYITQKSFK------LEKAHKKKRNAARPPSELNNSVSWRAEGIKYK 174
            G  +    + +  YI+ +S +      +EK  + + NA R           RA+ I  K
Sbjct: 120 MGHKENLTIQQVNNYISMESHEERIQEIIEKNKESEANAERK---------RRAKEIARK 170

Query: 175 KNEAFLDIVESINMLITQK 193
           ++E  + +  S+  + TQ+
Sbjct: 171 EHERKMGMPPSVYDIATQQ 189

>Ecym_6007 Chr6 (17110..18723) [1614 bp, 537 aa] {ON} similar to
           Ashbya gossypii AFR274C
          Length = 537

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/140 (22%), Positives = 60/140 (42%), Gaps = 8/140 (5%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           AV      GKPLLSR+++D   D  +  +  F  L+     E       +    + Y++I
Sbjct: 5   AVSITTKSGKPLLSRQFRDITKDRVMELLSNFQNLVASSSREHT----FVEEEHVRYIYI 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +    L+     +   LK   EE + ++   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDMDTLNLFSQTVNSNLKGFSEEDMLNSAFDILGSFDEIIS 119

Query: 121 YGIPQITEPRMLKKYITQKS 140
            G  +      +  +++ +S
Sbjct: 120 LGYKESLSLSQINTFLSMES 139

>CAGL0L02145g Chr12 (252110..253741) [1632 bp, 543 aa] {ON} similar
           to uniprot|P38153 Saccharomyces cerevisiae YBR288c APM3
           AP-3 complex subunit mu3 subunit
          Length = 543

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 84/229 (36%), Gaps = 82/229 (35%)

Query: 118 MMDYGIPQITEPRM-LKKYITQKSFKLEKAHKKKRNAARPPSELNNSVS----------- 165
           M D  I +I   R  L K I+  +  ++ A  K+RN     + +  S+            
Sbjct: 160 MYDSRIKEIVPERSDLSKLISSTAHTIQSAVNKQRNTPGFGNGMGQSMGSKVSHIGSTLK 219

Query: 166 -------WR-AEGIKYKKNEAFLDIVESINMLITQK-----------------GQV--LR 198
                  WR  + I   +NE + D+ E I ++  +K                 G +  +R
Sbjct: 220 GDDSVAPWRNGKNIHNDRNELYADVREVIQVVYQKKYSSKKNDSRRKIFGRRSGHLEYVR 279

Query: 199 SEIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITND 258
             I G+V ++  L+G P +++ +   G+           + IP                 
Sbjct: 280 GNISGSVDMRCFLTGNPLVEIALKQGGL----------DIGIPG---------------- 313

Query: 259 GKKRKTNIELEDLKFHQCV-RLSKFENEKI--ITFIPPDGEFDLMNYRL 304
                         FH CV + S  + EKI  ++FIPPDG F LM Y +
Sbjct: 314 --------------FHDCVDKTSLLKQEKISKLSFIPPDGRFTLMQYNI 348

>Suva_12.6 Chr12 (7704..9344) [1641 bp, 546 aa] {ON} YFR051C (REAL)
          Length = 546

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 11  KGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYV 67
           +GKPLLSR++KD   D  L  +  F  L+ ++  +   +        + Y++   ++ Y+
Sbjct: 12  QGKPLLSRQFKDLSKDRVLELLANFQNLVAEISSDHTFVED----KHVRYVYRPFDNYYI 67

Query: 68  VALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYG 122
           + L T+   NI +  A L+     +  YL +  ++ I  N   I    DE++  G
Sbjct: 68  I-LITNRQSNIIKDLATLNLFSQTINSYLSSFHDQEIFHNAFEILSSFDEIVSMG 121

>SAKL0F00594g Chr6 (54485..56122) [1638 bp, 545 aa] {ON} similar to
           uniprot|P43621 Saccharomyces cerevisiae YFR051C RET2
           Delta subunit of the coatomer complex (COPI) which coats
           Golgi-derived transport vesicles involved in retrograde
           transport between Golgi and ER
          Length = 545

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 20/165 (12%)

Query: 4   AVYFCDDKGKPLLSRRYKDDVPLSAIDKFSTLLTDLED---ESAVIPPCINHNGIEYLFI 60
           AV      GKPLLSR+++D     + D+ + LL++ +     S+     +    + Y++ 
Sbjct: 5   AVSITTRSGKPLLSRQFRD----ISKDRVTELLSNFQGLVANSSSQHTFVEDEHVRYVYK 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             +D Y++ L T+   NI +    L+     +   L++ +E  I +N   I    DE++ 
Sbjct: 61  PFDDYYII-LITNRQSNIIQDLDTLNLFSQTVNSSLRSFDENEIFENAFEILGSFDEIIA 119

Query: 121 YG------IPQITEPRMLKKY------ITQKSFKLEKAHKKKRNA 153
            G      + QI     ++ +      I +++ + E A ++KR A
Sbjct: 120 MGYKENLSLTQINNFLSMESHEEKIQEIIERNKEFEAAEERKRRA 164

>NDAI0B06320 Chr2 complement(1524899..1526521) [1623 bp, 540 aa]
           {ON} Anc_3.575 YFR051C
          Length = 540

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVV 68
           GKPLLSR+++D   D  +  +  F  L+ ++  +       +    + Y++   +D Y++
Sbjct: 13  GKPLLSRQFRDLTKDRVMELLSNFQGLVANISSDHTF----VEDEHVRYVYKPFDDYYII 68

Query: 69  ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYG 122
            L T+   NI +  + L+     +   L   +E  I DN   I    DE++  G
Sbjct: 69  -LITNRQSNIVQDLSTLNLFSQTVNSSLSNFDENEIYDNAFEILSSFDEIVVMG 121

>TBLA0E00140 Chr5 (17316..18947) [1632 bp, 543 aa] {ON} Anc_3.575
           YFR051C
          Length = 543

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 32/134 (23%), Positives = 59/134 (44%), Gaps = 8/134 (5%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVV 68
           GKPLLSR++ D   D  +  +  F  L+     E   +        + YL+   +D Y++
Sbjct: 13  GKPLLSRQFTDVTKDRVMELLSNFQGLVAKGSSEHTYVED----EHVRYLYKPFDDYYLI 68

Query: 69  ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITE 128
            + T+   NI +  + L      +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 69  II-TNRQSNIIQDLSTLSLFSQTMNTYLASFDETDIFENAFEILSSFDEIIVMGYKENLT 127

Query: 129 PRMLKKYITQKSFK 142
              ++ Y+T +S +
Sbjct: 128 MAQVETYLTMESHE 141

>CAGL0A04741g Chr1 complement(464302..465912) [1611 bp, 536 aa] {ON}
           similar to uniprot|P43621 Saccharomyces cerevisiae
           YFR051c RET2
          Length = 536

 Score = 38.1 bits (87), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 42/203 (20%), Positives = 87/203 (42%), Gaps = 15/203 (7%)

Query: 4   AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFI 60
           A       GKPLLSR++++   +  +  +  F  L++++  +   +        + Y++ 
Sbjct: 5   AASITTRNGKPLLSRQFRELTKERTMELLSNFQGLVSNISSDHTFL----EDEHVRYVYR 60

Query: 61  QHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMD 120
             ++ Y++ L T+   NI +  + L+     +  YL + +E  I DN   I    DE++ 
Sbjct: 61  PFDNYYII-LITNRQSNIIQDLSTLNLFSSTVNSYLASYDELEIFDNSFEILSSFDEIVT 119

Query: 121 YGIPQITEPRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNEAFL 180
            G  +      ++ Y+  +S +       +RN     +E       RA+ I  K+ E  L
Sbjct: 120 MGYKENLSISQVETYLAMESHEERIQEIIERNKEIEATE---ERKRRAKEIARKEQERKL 176

Query: 181 DI----VESINMLITQKGQVLRS 199
            I     E+ N++   + + + S
Sbjct: 177 GIYGGEFETANLVANSQNRFMAS 199

>Kpol_507.7 s507 (49309..50910) [1602 bp, 533 aa] {ON}
           (49309..50910) [1602 nt, 534 aa]
          Length = 533

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/150 (24%), Positives = 67/150 (44%), Gaps = 8/150 (5%)

Query: 12  GKPLLSRRYKDDVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVVALA 71
           GKPLLSR++K+      I+  S     L  +S+     +    + Y++   +D Y++ L 
Sbjct: 13  GKPLLSRQFKELTKERVIELLSNF-QGLVSKSSSDHTYVEDEHVRYVYRPFDDYYLI-LV 70

Query: 72  TSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITEPRM 131
           T+   NI +  + L+     +  YL + +EE I  N   I    DE++  G  +      
Sbjct: 71  TNRQSNIIQDLSTLNLFSQSVNYYLNSFDEEEIFINAFEILSSFDEIIVMGNKENLTVSQ 130

Query: 132 LKKYITQKSFK------LEKAHKKKRNAAR 155
           +  Y+  +S +      +E+  + + NA R
Sbjct: 131 VNTYLAMESHEERIQEIIEQNKEAEANAER 160

>Kpol_380.13 s380 complement(21263..22870) [1608 bp, 535 aa] {ON}
           complement(21263..22870) [1608 nt, 536 aa]
          Length = 535

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 75/169 (44%), Gaps = 11/169 (6%)

Query: 12  GKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIEYLFIQHNDLYVV 68
           GKPLLSR++ +   D  +  +  F  L+ ++  +   +        + Y++   +D Y++
Sbjct: 13  GKPLLSRQFTEITKDRVMELLSNFQGLVANISSDHTYVES----EHVRYVYKPFDDYYLI 68

Query: 69  ALATSLTVNIAEVFAFLHKLMGVLGEYLKTVEEESIRDNFVIIYELMDEMMDYGIPQITE 128
            L T+   NI +  + L+     +  YL + +E  I +N   I    DE++  G  +   
Sbjct: 69  -LVTNRQSNIIQDLSTLNLFSQTVNYYLNSFDEGEIFENAFEILSSFDEIIVMGNKEDLT 127

Query: 129 PRMLKKYITQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEGIKYKKNE 177
              +  Y+  +S + +     +RN     +E N     RA+ I  K++E
Sbjct: 128 ISQVNTYLAMESHEEKIQEIIERN---KETEANAERKRRAKEIARKEHE 173

>Ecym_7266 Chr7 (559988..560022,560112..561630) [1554 bp, 517 aa]
           {ON} similar to Ashbya gossypii AGL061W
          Length = 517

 Score = 35.4 bits (80), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 31/146 (21%), Positives = 54/146 (36%), Gaps = 45/146 (30%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESINMLITQKG----QVLRSEIIGAVKIKSRLSGMPDLKL 219
           V WR   +    NE ++D+VE++ + + Q       V    I G + +K  L G P +++
Sbjct: 195 VPWRIPNLSNVNNEIYVDMVETLTLNLKQSRPNSFHVFHGVISGKIDLKCYLRGNPTMQI 254

Query: 220 GINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDGKKRKTNIELEDLKFHQCVR- 278
            +                        H +G A                 +    H+C+  
Sbjct: 255 NL------------------------HSAGHA----------------FKPSALHRCLDP 274

Query: 279 LSKFENEKIITFIPPDGEFDLMNYRL 304
            S   +   + FIPPDG+F L+ Y +
Sbjct: 275 SSSSFDSSSLRFIPPDGKFTLLEYTI 300

>NDAI0K01930 Chr11 (437535..439373) [1839 bp, 612 aa] {ON} Anc_2.522
           YBR288C
          Length = 612

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 62/163 (38%), Gaps = 58/163 (35%)

Query: 164 VSWRAEGIKYKKNEAFLDIVESI-----NMLITQKGQ-------------------VLRS 199
           V WR   IK  KNE ++D+ E I     N +  +KG+                   ++  
Sbjct: 259 VPWRNGNIKNAKNELYIDMKEDIHVNFRNQIKNRKGRTYDNNNSNGIRVNNPSCMKLMNG 318

Query: 200 EIIGAVKIKSRLSGMPDLKLGINDRGIFTKYLEGNNIGVNIPDPQEHGSGVAESSITNDG 259
            I G + ++S L+G P +++ +N          GN++G     P  H     E  +  D 
Sbjct: 319 YITGVIDVRSYLNGNPIVEMKLN--------TCGNDMGT----PSLHPCVELEGDMNGDD 366

Query: 260 KKRKTNIELEDLKFHQCVRLSKFENEKIITFIPPDGEFDLMNY 302
            K      ++ LK                 FIPPDG+F L  Y
Sbjct: 367 DK-----VMDSLK-----------------FIPPDGKFCLARY 387

>KNAG0A06970 Chr1 complement(1086674..1088191) [1518 bp, 505 aa]
           {ON} Anc_2.522 YBR288C
          Length = 505

 Score = 33.9 bits (76), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 26/60 (43%), Gaps = 10/60 (16%)

Query: 250 VAESSITNDGKKRKTNIELEDLKFHQCVRLSKF----ENEKIITFIPPDGEFDLMNYRLT 305
           + E +  N G       +L     H CV L        +   + FIPPDG+F LM Y +T
Sbjct: 270 IVEVTFNNHG------CDLGTPALHDCVELDGVPEGPADHTTLKFIPPDGKFRLMEYSVT 323

>CAGL0J08888g Chr10 complement(877386..878783) [1398 bp, 465 aa]
           {ON} similar to uniprot|P53378 Saccharomyces cerevisiae
           YLR212c TUB4 gamma tubulin
          Length = 465

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 33/61 (54%), Gaps = 8/61 (13%)

Query: 170 GIKYKKNEAF---LDIVESINMLITQKGQVLR-----SEIIGAVKIKSRLSGMPDLKLGI 221
           G +YKKN A+   LD+++  N L+TQ+  ++      S +IG V     L  +P ++  +
Sbjct: 284 GQRYKKNTAYDVLLDLLDPFNSLVTQRSDMVTHFNVFSTVIGEVDQNHILRALPKMQQRL 343

Query: 222 N 222
           N
Sbjct: 344 N 344

>KAFR0J00130 Chr10 (23191..24822) [1632 bp, 543 aa] {ON} Anc_3.575
          YFR051C
          Length = 543

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 44/103 (42%), Gaps = 17/103 (16%)

Query: 4  AVYFCDDKGKPLLSRRYKD---DVPLSAIDKFSTLLTDLEDESAVIPPCINHNGIE---- 56
          A       GKPLLSR++KD   D  L  +  F  L++        +    NH  +E    
Sbjct: 5  AASITTSNGKPLLSRQFKDLSRDRVLELLSNFQNLVS--------LKHSSNHTFVEDDHV 56

Query: 57 -YLFIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLKT 98
           Y++   +D Y++ L T+   NI +  + L+     +  +L  
Sbjct: 57 RYVYKPFDDFYII-LITNRQSNIVQDLSTLNLFSQTINAFLNN 98

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
           Anc_8.68 YFL008W
          Length = 1232

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 23/92 (25%), Positives = 47/92 (51%), Gaps = 7/92 (7%)

Query: 117 EMMDYGIP-QITEPRMLKKYI-----TQKSFKLEKAHKKKRNAARPPSELNNSVSWRAEG 170
           E +D  I  Q+   ++L+K +     T  +FKLE     ++N+     + N+ + +    
Sbjct: 327 ENLDLDITRQLDSIKLLEKNLSTIKLTYDNFKLEINQSNEKNSTYQFKDSNDELEYSNLN 386

Query: 171 IKYKKNEAFLDIVESINMLITQKGQVLRSEII 202
            KY  N  F ++ E +N+LI +K +++  ++I
Sbjct: 387 AKYLNNGGF-ELEEKLNLLINEKNEIIDQKLI 417

>Kwal_26.9448 s26 complement(1221754..1223409) [1656 bp, 551 aa]
           {ON} YMR296C (LCB1) - Probable component of serine
           palmitoyltransferase, which catalyzes the first step in
           biosynthesis of long-chain sphingolipids [contig 73]
           FULL
          Length = 551

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 52/116 (44%), Gaps = 14/116 (12%)

Query: 38  DLEDESAVIPPCINHNGIEYLFIQHNDLYVVALATSLTVNIAEVFAFLHKLMGVLGEYLK 97
           D    ++VIP       +    I  ++   VAL  +L ++ + V+ F H  M  L E L 
Sbjct: 210 DFCTAASVIPAFTKRGDV----IVADNRITVALQNALQLSRSTVYYFNHNDMESLEELLD 265

Query: 98  TVEEESIRDN-------FVIIYELMDEMMDY-GIPQITEPRMLKKY--ITQKSFKL 143
            ++E  ++DN       F++   L   + D   +P++ E +   KY  +  ++F L
Sbjct: 266 QLQEREVKDNLPTIPRKFIVTEGLFHSLGDIPNLPKLVELKRKYKYRLVVDETFSL 321

>TBLA0C07130 Chr3 complement(1731931..1733085) [1155 bp, 384 aa]
           {ON} Anc_5.7 YGR283C
          Length = 384

 Score = 30.8 bits (68), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 25/96 (26%), Positives = 47/96 (48%), Gaps = 13/96 (13%)

Query: 335 QIKKKSVAANVQILIPV-------PDDA--DTPSFKYSHGSIKYVPEQSAILWKIKSFPG 385
           ++K + V  NV++ +         PD+A  D    K S+G    V +Q A ++   +FPG
Sbjct: 208 ELKSQLVPINVRVTVDTVERKVVSPDEAYGDFVGAKASYGYHVRVAKQFADVFTECAFPG 267

Query: 386 GKEYAMFAEMGLPSMDSYEEPKVKRPVQVKFEIPYF 421
           G   A++   G    D Y +  +K+ ++ + ++PY 
Sbjct: 268 GYSQAVWVNSG----DYYYDGSLKKYLKTETQVPYL 299

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 10/46 (21%)

Query: 279 LSKFENEKIITFIPPDGEFDLMNYRLTTSIKPLI----------WC 314
           L KFE +K+   IP D EF+ +  RLT S+  ++          WC
Sbjct: 399 LRKFEEDKMNGIIPMDAEFNAIKIRLTASLPQILLSVIVYIIFGWC 444

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,801,414
Number of extensions: 2291084
Number of successful extensions: 7065
Number of sequences better than 10.0: 129
Number of HSP's gapped: 7089
Number of HSP's successfully gapped: 187
Length of query: 461
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 348
Effective length of database: 40,524,141
Effective search space: 14102401068
Effective search space used: 14102401068
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)