Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0L009407.125ON54952627730.0
Smik_6.4677.125ON54851718780.0
NCAS0E021307.125ON52652818640.0
Skud_16.187.125ON55052718630.0
YPL260W7.125ON55151718620.0
Suva_16.447.125ON54952618590.0
NDAI0E036707.125ON52252518090.0
CAGL0H09108g7.125ON53252217670.0
TDEL0H028707.125ON58752317510.0
SAKL0F05390g7.125ON59552817500.0
KLLA0D14355g7.125ON58851817320.0
ZYRO0C05192g7.125ON58852616890.0
KLTH0F12540g7.125ON59551416430.0
Kwal_55.208327.125ON57551516180.0
KAFR0L004607.125ON51152316090.0
Ecym_83527.125ON57952516100.0
TBLA0A009307.125ON58651715300.0
Kpol_322.77.125ON53451215160.0
TPHA0C016107.125ON55153214570.0
ADL019W7.125ON52547713700.0
Kpol_1062.587.125ON4914413991e-41
KAFR0D003001.31ON542117742.0
KAFR0B058508.343ON38552742.0
KAFR0H008603.370ON57876742.3
NDAI0F032302.92ON1125162723.7
Kwal_23.53617.537ON76755698.1
YKL033W (TTI1)2.541ON103893698.6
Kpol_1006.73.370ON54072698.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0L00940
         (549 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....  1072   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   728   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   722   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   722   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   721   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   720   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   701   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   685   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   679   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   678   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   671   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   655   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   637   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   627   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   624   0.0  
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   624   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   593   0.0  
Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   588   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   565   0.0  
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   532   0.0  
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   158   1e-41
KAFR0D00300 Chr4 complement(41181..42809) [1629 bp, 542 aa] {ON}...    33   2.0  
KAFR0B05850 Chr2 (1209414..1210571) [1158 bp, 385 aa] {ON} Anc_8...    33   2.0  
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    33   2.3  
NDAI0F03230 Chr6 (775461..778838) [3378 bp, 1125 aa] {ON} Anc_2....    32   3.7  
Kwal_23.5361 s23 complement(1127422..1129725) [2304 bp, 767 aa] ...    31   8.1  
YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subu...    31   8.6  
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    31   8.7  

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score = 1072 bits (2773), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/526 (100%), Positives = 526/526 (100%)

Query: 1   MISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKV 60
           MISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKV
Sbjct: 1   MISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKV 60

Query: 61  RELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 120
           RELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA
Sbjct: 61  RELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 120

Query: 121 SLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIK 180
           SLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIK
Sbjct: 121 SLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIK 180

Query: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240
           DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV
Sbjct: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240

Query: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300
           ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL
Sbjct: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300

Query: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360
           KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS
Sbjct: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360

Query: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420
           LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ
Sbjct: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420

Query: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480
           SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY
Sbjct: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480

Query: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV
Sbjct: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/517 (70%), Positives = 433/517 (83%), Gaps = 14/517 (2%)

Query: 10  QPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKK 69
           Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD IRK 
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 70  NHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 129
           +H+  A +  TLIHN +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL
Sbjct: 68  SHETPAKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 130 QHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRN 189
           +HL E+ ++THHDL PIK+RL+EISKIVE+  + +   +D   ND+   +++ID ER +N
Sbjct: 128 EHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDG--NDDR--LREIDNERKKN 183

Query: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQ 249
           K+E++LLL+AKLKHC D Y+ +ESKLE+IDP+L+SVMEKLF+IRRGLLSLVAS++   S+
Sbjct: 184 KIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKTMSK 243

Query: 250 ISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDE 309
            S  ++++  R  + S       N  G    K+ +S + V EK  VL+++L  LE++RD+
Sbjct: 244 -SSANINSLLREQNDSQ-----ANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDD 297

Query: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369
            GKFKSLET +VA NGQ VLNGLLDDC+DL++DLSHQ   G    LS+DP LQP+YE+L+
Sbjct: 298 SGKFKSLETHQVAVNGQSVLNGLLDDCHDLINDLSHQTNGG----LSLDPYLQPIYEQLI 353

Query: 370 EIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRR 429
           +IKTTLENLMITRRWTLRETDLFSYQKKLNEIDN R+NG+FPT++ DS+GQSILLYLLRR
Sbjct: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413

Query: 430 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 489
           CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN
Sbjct: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473

Query: 490 LRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           LR DGIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 474 LRTDGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  722 bits (1864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/528 (68%), Positives = 430/528 (81%), Gaps = 32/528 (6%)

Query: 2   ISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVR 61
           ++ + ++T   Q VPKEEE ILNY LDVR+ LS+LK+NRTQYLNS +VQ TYQ VLTKVR
Sbjct: 1   MNMYPSNTTHPQEVPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVR 60

Query: 62  ELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 121
           ELD IRK +HD  + +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 61  ELDEIRKNSHDTPSKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 120

Query: 122 LSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKD 181
           LSTV+SLL+HL E+ I+THHDL PIKDRLNEISKIVE+SC +    Q  L +DEEQ +KD
Sbjct: 121 LSTVQSLLEHLSESNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQ--LNDDEEQNLKD 178

Query: 182 IDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVA 241
           ID ER +NK+EQ+LLL+AKL+HC+D Y ++ESKLE+IDP+LTS MEKLFQIRRGLLSL A
Sbjct: 179 IDTERNKNKIEQDLLLRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAA 238

Query: 242 SSR---NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRN 298
           S++   N  S  SE++L                       + K+ +S + V +K   L  
Sbjct: 239 STKKNMNQGSLTSEKEL-----------------------ENKHLVSQEYVNKKLHALEA 275

Query: 299 DLKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMD 358
           +++ LEA+RDE GKFKSLET++VAENGQ VLNGLLDDC DL++DLSHQ    NG  L++D
Sbjct: 276 EVQALEANRDESGKFKSLETNEVAENGQNVLNGLLDDCLDLINDLSHQT---NG-HLNLD 331

Query: 359 PSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSR 418
           P+LQP+YE L++IKTTLENLMITRRWTLRETDLF+YQK+L EIDN+RV GRFPT+  DS+
Sbjct: 332 PTLQPIYEMLIDIKTTLENLMITRRWTLRETDLFTYQKQLGEIDNMRVEGRFPTKHIDSK 391

Query: 419 GQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELY 478
           GQ ILLYLLRRCYAIIYKLLESSEPVSE+LQPIHNQLSTVRRCL+ELKRMGGV+N+RELY
Sbjct: 392 GQFILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLSTVRRCLMELKRMGGVDNDRELY 451

Query: 479 PYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           PYQMKLASLDNLR DG FYDS+GNIPEGQG LNALLA CFDI+HELKV
Sbjct: 452 PYQMKLASLDNLRVDGKFYDSEGNIPEGQGTLNALLAACFDIMHELKV 499

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  722 bits (1863), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/527 (69%), Positives = 432/527 (81%), Gaps = 24/527 (4%)

Query: 5   FQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELD 64
           F ++ Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD
Sbjct: 2   FSSAGQHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELD 61

Query: 65  AIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 124
            IRK +HD  A +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 62  DIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 121

Query: 125 VESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDA 184
           VESLL+HL E+ ++THHDL PIK+RL+EISKIVE+  +     +DA  ND    I++ID 
Sbjct: 122 VESLLEHLNESNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDA--NDAR--IREIDN 177

Query: 185 ERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSR 244
           ER +NK+E++LLL+AKLKHC D Y+ +ESKLE+IDP+L++VMEKLF+IRRGLLSLVAS++
Sbjct: 178 ERKQNKIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAK 237

Query: 245 NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQK-----KNAISHKLVREKFEVLRND 299
                       T S++S+  N      N+L +        K+ +S + V EK  VL+N+
Sbjct: 238 K-----------TMSKSSANINSLLQEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNE 286

Query: 300 LKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDP 359
           L  LE++RD+ GKFKSLET +V E GQ VLNGLLDDC+DL+SDLSHQ   G    L++DP
Sbjct: 287 LSELESNRDDSGKFKSLETHEVTEKGQSVLNGLLDDCHDLISDLSHQTNGG----LALDP 342

Query: 360 SLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRG 419
            LQP YE+L++IKTTLENLMITRRWTLRETDLFSYQKKLNEID+ R+NG+FPT++ DS+G
Sbjct: 343 HLQPTYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRINGKFPTKSQDSKG 402

Query: 420 QSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYP 479
           QSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYP
Sbjct: 403 QSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYP 462

Query: 480 YQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           YQMKLASLDNLR +GIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 463 YQMKLASLDNLRTNGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 68/143 (47%), Gaps = 16/143 (11%)

Query: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369
           +GKF +   D     GQ +L  LL  C  ++  L    E        +  +LQP++ +L 
Sbjct: 390 NGKFPTKSQDS---KGQSILLYLLRRCYAIIYKLLESSE-------PVSEALQPIHNQLS 439

Query: 370 EIKTTLENLMITRRWTLR-ETDLFSYQKKLNEIDNLRVNGRFPTETAD-SRGQSILLYLL 427
            ++  L  L + R   +  E +L+ YQ KL  +DNLR NG F     +   GQ IL  LL
Sbjct: 440 TVRRCL--LELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDGNIPEGQGILNALL 497

Query: 428 RRCYAIIYKLLESSEPVSEALQP 450
             C+ I+++L   +E    AL P
Sbjct: 498 AECFDIMHELKVEAE--ERALNP 518

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/517 (69%), Positives = 431/517 (83%), Gaps = 14/517 (2%)

Query: 10  QPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKK 69
           Q  Q VPKEEE ILNY L+VR++L++LK+NRTQYLNS +VQ TYQ VLTKVRELD IRK 
Sbjct: 8   QHPQIVPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKN 67

Query: 70  NHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 129
           +H+  A +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL
Sbjct: 68  SHETPAKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLL 127

Query: 130 QHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRN 189
           +HL E+ ++THHDL PIK+RL EISKIVE    Q N+     E+  +  +++ID ER +N
Sbjct: 128 EHLNESNVFTHHDLSPIKERLEEISKIVE----QKNSSPAYDEDGNDDRLREIDNERKKN 183

Query: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQ 249
           K+E++LLL+AKLKHC D Y+ +E KLE+IDP+L++VMEKLF+IRRGLLSLVAS++     
Sbjct: 184 KIEEDLLLRAKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKT--- 240

Query: 250 ISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDE 309
           +S+ D++T+S    Q+++     N       K+ +S + V EK  VL+N+L  LE++RD+
Sbjct: 241 MSKSDINTNSLLQEQNDLQT---NNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDD 297

Query: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369
            GKFKSLE+ +VAE GQ VLNGLLDDC+DLV+DLSHQ   G    L++DP LQP+YE+L+
Sbjct: 298 SGKFKSLESHQVAEKGQSVLNGLLDDCHDLVNDLSHQKNGG----LTLDPYLQPIYEQLI 353

Query: 370 EIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRR 429
           +IKTTLENLMITRRWTLRETDLFSYQKKLNEIDN R+NG+FPT++ DS+GQSILLYLLRR
Sbjct: 354 DIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRR 413

Query: 430 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 489
           CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN
Sbjct: 414 CYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDN 473

Query: 490 LRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           LR +GIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 474 LRTEGIFYDSDGNIPEGQGILNALLAECFDILHELKV 510

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/526 (69%), Positives = 437/526 (83%), Gaps = 17/526 (3%)

Query: 1   MISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKV 60
           M SS     Q  Q VPKEEE ILNY L+VR+ L++LK+NRTQYLNS +VQ TYQ VLTKV
Sbjct: 1   MFSS--AGQQHPQIVPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKV 58

Query: 61  RELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 120
           RELD IRK +HD  A +  TLIH+ +LHNRVDSVLDDVFQL+SLCFLTVGLKNSAPATYA
Sbjct: 59  RELDDIRKNSHDTPAKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYA 118

Query: 121 SLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIK 180
           SLSTVESLL+HL E+ ++THHDL PIK+RL EI KIVE++    N  +D   ND++  ++
Sbjct: 119 SLSTVESLLEHLNESNVFTHHDLSPIKERLEEIRKIVEKNTG-PNYDEDG--NDDQ--LR 173

Query: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240
           +ID ER +N++E++LLL+AKLKHC D Y+ +ESKLE+IDP+L++VMEKLF+IRRGLLSLV
Sbjct: 174 EIDNERNKNRIEEDLLLRAKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLV 233

Query: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300
           AS++     +S+ +++ SS     +++     N+L  +  K+ +S + V EK   L+N+L
Sbjct: 234 ASAKKT---MSQSNVNISSLLQKHNDLETN-NNDLMDD--KHLVSQEYVNEKLTALKNEL 287

Query: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360
             LE++RDE GKFKSLE+ KVAENGQ VLNGLLDDC+DLV+DLSHQ   G    L++DP+
Sbjct: 288 NELESNRDESGKFKSLESHKVAENGQSVLNGLLDDCHDLVNDLSHQTNGG----LTLDPT 343

Query: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420
           LQP+YE+L++IKTTLENLMITRRWTLRETDLFSYQKKLNEID+ RV G+FPT+T DS+GQ
Sbjct: 344 LQPIYEQLIDIKTTLENLMITRRWTLRETDLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQ 403

Query: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480
           SILLYLLRRCYAIIYKLLESSEPVSEALQP+HNQLSTVRRCLLELKRMGGVNNERELYPY
Sbjct: 404 SILLYLLRRCYAIIYKLLESSEPVSEALQPVHNQLSTVRRCLLELKRMGGVNNERELYPY 463

Query: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           QMKLASLDNLR DGIFYDSDGNIPEGQGILNALLA CFDI+HELKV
Sbjct: 464 QMKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDIMHELKV 509

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/525 (66%), Positives = 429/525 (81%), Gaps = 28/525 (5%)

Query: 2   ISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVR 61
           +S++ +++   Q VPKEEEGIL Y LDVR  L  LK+NRTQYLNS  VQKTYQEVLTKVR
Sbjct: 5   LSNYPSNSTHPQLVPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVR 64

Query: 62  ELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 121
           ELD IRK NH   + +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS
Sbjct: 65  ELDEIRKNNHATPSNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYAS 124

Query: 122 LSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKD 181
           LSTV+SLL+HL E+ I+THHDL PIK+RL++ISKIVEESC+Q   + +  ++   Q + +
Sbjct: 125 LSTVQSLLEHLNESNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDE 184

Query: 182 IDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVA 241
            + E+ +NK+EQ+LLL+AKL+HC+D Y+E+ESKLE+IDP+L S++EKLFQIRRGLLSLVA
Sbjct: 185 TELEQNQNKIEQDLLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVA 244

Query: 242 SSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLK 301
           S++  +S +S+++LD                       +K+ IS + + +K   L  + K
Sbjct: 245 SAKK-NSLLSQKELD-----------------------EKHLISPEYLNKKLLELEKEFK 280

Query: 302 NLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSL 361
           +LE++RDE GKFKSLET ++ ENGQ VL GL DDCNDL++DLSHQ    NG +L++DP L
Sbjct: 281 DLESNRDEFGKFKSLETGEIPENGQNVLKGLEDDCNDLINDLSHQT---NG-RLTLDPDL 336

Query: 362 QPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQS 421
           QPVYE+L+EIKTTLE LMITRRWTLRETDLF+YQKKL EIDNLRV G+FP++++DS+GQ 
Sbjct: 337 QPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQKKLGEIDNLRVKGKFPSKSSDSKGQF 396

Query: 422 ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ 481
           I+LYLLRRCYAIIYKLLE SEPVSE+LQPIHNQLSTVRRCLL++KR+GGV+NERELYPYQ
Sbjct: 397 IILYLLRRCYAIIYKLLECSEPVSESLQPIHNQLSTVRRCLLDIKRLGGVSNERELYPYQ 456

Query: 482 MKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           MKLASLDNLR+DGIFYDSDGNIPEGQG LNALLA CFDI+HE+KV
Sbjct: 457 MKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLAACFDIVHEMKV 501

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  685 bits (1767), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/522 (65%), Positives = 415/522 (79%), Gaps = 32/522 (6%)

Query: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66
           + T   Q+VPKEEEGILNY L+VR+ LS+LKKNRTQYLNS +V  TYQEVLT+VRELD I
Sbjct: 9   SGTNHPQDVPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGI 68

Query: 67  RKKNHDAV--ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 124
           RK + D     T   TLIH+ D+HNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST
Sbjct: 69  RKSSTDVTRRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 128

Query: 125 VESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDA 184
           V+ LL+HL E+ ++THHDL+PIK+RL+EISKIVE+S        ++   DE    K+ID 
Sbjct: 129 VQCLLEHLCESNVFTHHDLRPIKERLDEISKIVEKSV-------ESRPEDEVAEFKEIDT 181

Query: 185 ERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSR 244
           ER +N++EQ+LLLKAKL+HC+D YN++ESKLE+I P L+ +ME+LF++RRGLLSL ASS+
Sbjct: 182 ERNKNRIEQDLLLKAKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSK 241

Query: 245 NMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLE 304
                I +E+    ++                 +  K+ +S + +    E  + ++  +E
Sbjct: 242 ---KNIPDENYKEPAKL----------------DDSKHVLSQEYLSNSLEKYKKEVAKME 282

Query: 305 AHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPV 364
           A RDE+G+F S  T K  + GQ +LNGLLDDCNDL++DLSHQ   G    L++DP LQP+
Sbjct: 283 AMRDENGQFVSKSTGKAEQRGQNILNGLLDDCNDLINDLSHQTNGG----LTLDPYLQPI 338

Query: 365 YERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILL 424
           YE+L++IKTTLENLMITRRWTLRETDLF+YQK+L EIDN+RV+G+FPT++ DS+GQSI+L
Sbjct: 339 YEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEIDNMRVHGKFPTKSPDSKGQSIIL 398

Query: 425 YLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 484
           YLLRRCYAIIYKLLESSEPVSE+LQP+HNQLSTVRRCLLELKRMGGVNNERELYPYQMKL
Sbjct: 399 YLLRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKL 458

Query: 485 ASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           ASLDNLR+DG FYDSDGNIPEGQGILNALLAGCFDI+HELKV
Sbjct: 459 ASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDILHELKV 500

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  679 bits (1751), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/523 (64%), Positives = 413/523 (78%), Gaps = 36/523 (6%)

Query: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66
           +++Q  Q+VPKEEE ILNY L VR  L QLK+NR QYLNS EVQ  YQ+VLTKVRELD I
Sbjct: 10  SNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKVRELDQI 69

Query: 67  RKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 126
           RK NHD  + +  TLIH+ +LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTV+
Sbjct: 70  RKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQ 129

Query: 127 SLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEE---QAIKDID 183
            LL+HL E+ ++T HDL+PI++RL EISKIVE S  +     D LE+ +E   +A +   
Sbjct: 130 RLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPEADRKFY 189

Query: 184 AERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASS 243
            ER +NK+E++LLL+AKL+HC+D Y+  ESK+E+IDP LT++MEKLF+IRRGLLSL ASS
Sbjct: 190 EERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLLSLAASS 249

Query: 244 RNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNL 303
           +                       +NP         +K+ +S + V E+ E L + L  L
Sbjct: 250 KR----------------------SNP-------SLEKSPLSQEHVHEQVEKLESQLTEL 280

Query: 304 EAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQP 363
           E+HRDE+GKFKSLETDKV + GQ VLNGLLDDC+DL+SDLSHQ   G    + +D  LQP
Sbjct: 281 ESHRDENGKFKSLETDKVEDKGQNVLNGLLDDCHDLISDLSHQKNGG----IELDAKLQP 336

Query: 364 VYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSIL 423
           +YE+L++IKT+LENL++TRRWTLRETDLF++QK+L+EID+LRV+G+FPT++  S+GQSIL
Sbjct: 337 IYEQLIDIKTSLENLLVTRRWTLRETDLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSIL 396

Query: 424 LYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMK 483
           LYLLRRC+AIIYKLLESSEPVSE+LQPIHNQLSTVRRCLLELKRMGGVNN+RELYPYQMK
Sbjct: 397 LYLLRRCFAIIYKLLESSEPVSESLQPIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMK 456

Query: 484 LASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           LASLD+LR DG FYDSDGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 457 LASLDDLRTDGKFYDSDGNIPEGQGTLNALLAECFDIVHELKI 499

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  678 bits (1750), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/528 (64%), Positives = 416/528 (78%), Gaps = 36/528 (6%)

Query: 8   STQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIR 67
           S+   Q VPKEEE ILNYFLDVR+ LS+LK+NR+Q+LNS +V +TYQ+VLTKVRELD  R
Sbjct: 2   SSNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTR 61

Query: 68  KKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVES 127
           K +H+  A++  TLIH+ DLHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ 
Sbjct: 62  KSSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 121

Query: 128 LLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQ--------DALENDEEQAI 179
           LL+HL E+ ++THHDL+PIK+RL+E+S+IVE++  +             +A E++++  +
Sbjct: 122 LLEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIEL 181

Query: 180 KDIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSL 239
           K  D E+ +NK+E++LLL+AKLKHC+  Y  +ESKLE+IDP L S+MEKLFQIRRGLLSL
Sbjct: 182 KKADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSL 241

Query: 240 VASS-RNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRN 298
            AS+ RN  S+ S ED                       +++ + +S   V  K   L+ 
Sbjct: 242 AASTKRNARSKESLED-----------------------KKRTHTVSPNFVNSKLNELQV 278

Query: 299 DLKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMD 358
           +L  LE+HRD  GKFKSLETDKV E GQ VLNGLLDDC+DL++DLSHQ   G    +S+D
Sbjct: 279 ELSELESHRDPSGKFKSLETDKVEERGQSVLNGLLDDCHDLINDLSHQTSRG----ISLD 334

Query: 359 PSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSR 418
             LQP+Y+ L++IKTTLENL++TRRWTLRETDLF+YQK+L EIDNLRV+G+FPTE+ DS+
Sbjct: 335 HKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLFTYQKRLGEIDNLRVHGKFPTESGDSK 394

Query: 419 GQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELY 478
           GQSILLYLLRRCYAIIYKLLESSEPVSEALQ IHNQLSTVRRCLLELKRMGGVNN+RELY
Sbjct: 395 GQSILLYLLRRCYAIIYKLLESSEPVSEALQRIHNQLSTVRRCLLELKRMGGVNNDRELY 454

Query: 479 PYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           PYQMKLASLDN+R DG FYD+DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 455 PYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHELKI 502

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/518 (64%), Positives = 415/518 (80%), Gaps = 26/518 (5%)

Query: 15  VPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHDAV 74
           VP EEE IL YFLDVR+ LS++K+NR+Q+LNS +V  TYQ+VLTKVRELD +RK +H   
Sbjct: 10  VPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHATP 69

Query: 75  ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHLEE 134
           + +  TLIH+++LHNRVDSV+DDVFQLLSL FLTVGLKNSAPATYASLSTV+SLL+HL E
Sbjct: 70  SNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLEHLNE 129

Query: 135 AKIYTHHDLKPIKDRLNEISKIVEE----SCAQTNAIQDALENDEEQAIKDIDAERTRNK 190
           + +YTHHDL+PIK+RLNE+S IVE+    S + T ++    ++  E A++  D E  +NK
Sbjct: 130 SNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQK-DEELNKNK 188

Query: 191 LEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQI 250
           +E++LLL+AKLKHC+D YN +ESKLE+I P L S ME LFQIRRGLLSL +S++      
Sbjct: 189 IEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTK------ 242

Query: 251 SEEDLDTSSRTSSQSNIANP--LGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRD 308
                    R   +  + +P  L  E  + +KKN +  +++ EK + L+  L+ LE+HRD
Sbjct: 243 ---------RPHQKQLVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRD 293

Query: 309 EDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERL 368
            +GKFKSLETDKV E GQ VLNGLLDDC+DLV+DLSHQ + G    +S+D  LQP+Y++L
Sbjct: 294 INGKFKSLETDKVEEKGQNVLNGLLDDCHDLVNDLSHQKDGG----ISLDTKLQPIYDQL 349

Query: 369 LEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLR 428
           ++IKTTLENL++TRRWTLRETDLF+YQKKL EIDNLRVNG+FPT+  DS+GQSILLYLLR
Sbjct: 350 VDIKTTLENLLVTRRWTLRETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLR 409

Query: 429 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 488
           RCYAIIYKLLESSEPVSE+LQ +HNQLSTVRRCLLELKRMGGV+N+RELYPYQMKLASLD
Sbjct: 410 RCYAIIYKLLESSEPVSESLQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLD 469

Query: 489 NLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           N+R DG FYD+DGNIPEGQG LNALLA CFDIIHELK+
Sbjct: 470 NMRVDGKFYDTDGNIPEGQGTLNALLAECFDIIHELKI 507

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/526 (61%), Positives = 414/526 (78%), Gaps = 32/526 (6%)

Query: 7   TSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAI 66
           TS+Q  Q+VP+EEEG+LNYFL++RT LSQLK+NRT+YL+S +VQ TY++VLT+VRELD +
Sbjct: 11  TSSQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDV 70

Query: 67  RKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVE 126
           RK NH+  +++  TLIHNA+LHNRVDSVLDDVFQLLSLCFLTVGLKNSAPA Y+SLSTV+
Sbjct: 71  RKSNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQ 130

Query: 127 SLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDA----LEN--DEEQAIK 180
            LL+HL E+ ++T HDL+PIK+RL EI KIVE+SC +           L+N  D ++A +
Sbjct: 131 RLLEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEADR 190

Query: 181 DIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLV 240
           ++  E  RNK+E++LLL+AKL+HC+D Y   E+K+E +DP+L+++M+KLFQIRR LLSL 
Sbjct: 191 NLSEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSLA 250

Query: 241 ASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDL 300
           AS++            T+S  S++  + N           K+ ++ + V  + E+L+ +L
Sbjct: 251 ASAKK-----------TTSSASAEKELEN-----------KHVLAPESVNTRVELLQKEL 288

Query: 301 KNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPS 360
             +E++RDE GKFKS E+++ AE GQ VLNGLL DC DL+ DLSHQ   G    + +DP 
Sbjct: 289 NEIESYRDETGKFKSPESEQSAEKGQNVLNGLLSDCYDLLGDLSHQKNGG----IELDPR 344

Query: 361 LQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQ 420
           LQP+Y +L++IKTTLENL+ITRRWTLRETDLF+YQK+L EID+LRVN +FPT++ D++GQ
Sbjct: 345 LQPIYAKLIDIKTTLENLLITRRWTLRETDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQ 404

Query: 421 SILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPY 480
           +ILLYLLRRCYAIIYKLLESSEPVSE+LQP+HNQLSTVRRCLL L+RMGG+NN RELYPY
Sbjct: 405 TILLYLLRRCYAIIYKLLESSEPVSESLQPLHNQLSTVRRCLLSLQRMGGINNSRELYPY 464

Query: 481 QMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           QMKLASLD LR DG FYD DGNIPEGQ  LNALLA CFDIIHE+K+
Sbjct: 465 QMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHEMKI 510

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 65/132 (49%), Gaps = 11/132 (8%)

Query: 318 TDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIKTTLEN 377
           TD     GQ +L  LL  C  ++  L    E        +  SLQP++ +L  ++  L  
Sbjct: 396 TDSGDNKGQTILLYLLRRCYAIIYKLLESSE-------PVSESLQPLHNQLSTVRRCL-- 446

Query: 378 LMITRRWTLRET-DLFSYQKKLNEIDNLRVNGRFPTETAD-SRGQSILLYLLRRCYAIIY 435
           L + R   +  + +L+ YQ KL  +D LRV+G+F     +   GQ+ L  LL  C+ II+
Sbjct: 447 LSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIH 506

Query: 436 KLLESSEPVSEA 447
           ++   +E  +E+
Sbjct: 507 EMKIEAEEKTES 518

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/514 (62%), Positives = 391/514 (76%), Gaps = 32/514 (6%)

Query: 13  QNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHD 72
           Q VP EEE  L YFL+VR  LS+LK+NR+QYLNS +V  TYQ+VLTKVRELDAIRK +H 
Sbjct: 6   QEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIRKSSHH 65

Query: 73  AVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHL 132
             A +  TLIHN +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL+HL
Sbjct: 66  RPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLEHL 125

Query: 133 EEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRNKLE 192
           +E+ ++THHDL+PIK+RL+EIS+IV    +Q++ +     +D       I  E+ RNK+E
Sbjct: 126 DESNVFTHHDLRPIKERLDEISEIV----SQSSYLDGTEISDGRIDFAKIQDEKDRNKIE 181

Query: 193 QNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQISE 252
           ++LLL+AKL+HC+  Y  +ESKLE+IDP L S MEKLFQ+RRGLLSL AS          
Sbjct: 182 EDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAAS---------- 231

Query: 253 EDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGK 312
               T     S+  +  P           + +  + ++++   L  +L  +E+HRD  GK
Sbjct: 232 ----TKRNAMSKQGVKTP----------DSLLPQEGIKQRLHELEAELTEIESHRDSSGK 277

Query: 313 FKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIK 372
           F SLET ++A  GQ VLNGLLDDC+DL++DLSH     N   +S+D  LQP+Y+ L++IK
Sbjct: 278 FVSLETGEIAGKGQNVLNGLLDDCHDLINDLSHH---ANNF-VSLDSKLQPIYDNLIDIK 333

Query: 373 TTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYA 432
           TTLENL++TRRWTLRETDLFSYQK+L+EID LRV G+FPTE AD++GQ+ILLYLLRRCYA
Sbjct: 334 TTLENLLVTRRWTLRETDLFSYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYA 393

Query: 433 IIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQ 492
           IIYKLLE SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R 
Sbjct: 394 IIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRV 453

Query: 493 DGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           DG FYD DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 454 DGKFYDEDGNIPEGQGTLNALLAECFDILHELKI 487

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/515 (61%), Positives = 391/515 (75%), Gaps = 33/515 (6%)

Query: 13  QNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHD 72
           Q VP EEE  L YFL+VR  LS+LK+NR+QYLNS EV   YQ+VLTKVRELD IRK++H 
Sbjct: 6   QEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIRKRSHS 65

Query: 73  AVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHL 132
           A   +  TLIHN +LHNRVDSVLDDVFQLLSL FLTVGLKNSAPATYASLSTV+ LL+HL
Sbjct: 66  APRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRLLEHL 125

Query: 133 EEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALE-NDEEQAIKDIDAERTRNKL 191
           +E+ ++THHDL+PIK+RL+EIS+IV     Q++  ++  E N+       I  E+ RNK+
Sbjct: 126 DESNVFTHHDLRPIKERLDEISEIV----TQSSFFKEGGEINNGSIDFTKISDEKDRNKI 181

Query: 192 EQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQIS 251
           E++LLL+AKLKHC+  Y  +ESKLE+IDP L   MEKLF++RRGLLSL AS++       
Sbjct: 182 EEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKR------ 235

Query: 252 EEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDG 311
                            N +  + G +  ++ +S + V+EK   L   L  +E+ R+  G
Sbjct: 236 -----------------NAMLKD-GHKAPESPLSQESVKEKLHSLEAKLTQIESQRNASG 277

Query: 312 KFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEI 371
            F S +T ++ E GQ VLNGLLDDC+DL++DLSH     N + +++D  LQP+Y+ L+EI
Sbjct: 278 YFVSADTGEIVERGQSVLNGLLDDCHDLINDLSHH---ANNV-VTLDSKLQPIYDNLIEI 333

Query: 372 KTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCY 431
           KTTLENL++TRRWTLRETDLF+YQK+L+EID LRV G+FPTE+ D++GQ+ILLYLLRRCY
Sbjct: 334 KTTLENLLVTRRWTLRETDLFAYQKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCY 393

Query: 432 AIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLR 491
           AIIYKLLE SEPVSEALQ IHNQLSTVRRCLLELKRMGGV N+RELYPYQMKLASLDN+R
Sbjct: 394 AIIYKLLECSEPVSEALQKIHNQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVR 453

Query: 492 QDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
            DG FYD DGNIPEGQG LNALLA CFDI+HELK+
Sbjct: 454 VDGKFYDEDGNIPEGQGTLNALLAECFDILHELKI 488

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/523 (61%), Positives = 395/523 (75%), Gaps = 45/523 (8%)

Query: 6   QTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDA 65
           Q   +  Q VPKEEE  L+Y L VR  LS LK+NR+Q+LNS ++Q TYQ VLTKVRELD 
Sbjct: 3   QPHNRDLQAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDE 62

Query: 66  IRKKNH-DAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLST 124
           IR++ H ++  T + T +H+ +LHNRVD+VLDDVFQLLSLCF+T GLKNSAPATYASLST
Sbjct: 63  IRRQKHGNSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLST 122

Query: 125 VESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALE-NDEEQAIKDID 183
           V+SLL+HL E+KIYTHHDLKPIK+RL+EI+KIV+++C ++N  QDA   +D++  +  ID
Sbjct: 123 VQSLLEHLIESKIYTHHDLKPIKERLDEIAKIVDQNC-ESNTYQDASTLDDDDNEVSRID 181

Query: 184 AERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASS 243
            ER +NK+EQNLLL+AKL HC+  YN +ES+LE++DP+  S++EKLFQIRR L+SLV  S
Sbjct: 182 NERNKNKIEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEIS 241

Query: 244 RNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNL 303
           +              S T  Q  I                       +K + L+  L  +
Sbjct: 242 K--------------SNTGVQDQID----------------------KKLKHLQLQLNEI 265

Query: 304 EAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQP 363
           E +RD DG F S+E+      G  VLNGL DDC+DL+SDL+H  +T       +DP LQ 
Sbjct: 266 ENNRDPDGNFVSIESGNPIIKGSNVLNGLSDDCHDLISDLTHHTKT------FLDPDLQN 319

Query: 364 VYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSIL 423
           VY+ L+++K +LENLM+TRRWTLRETDLFSY KKLNEIDNLRV+G+FPT++  ++GQ+IL
Sbjct: 320 VYDNLIDVKGSLENLMVTRRWTLRETDLFSYLKKLNEIDNLRVDGKFPTKSGSTKGQAIL 379

Query: 424 LYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMK 483
           LYLLRRCY +IYKLLESSEPVSEALQPIHNQLSTVRRCLL+LKRMGGVNNERELYPYQMK
Sbjct: 380 LYLLRRCYTLIYKLLESSEPVSEALQPIHNQLSTVRRCLLDLKRMGGVNNERELYPYQMK 439

Query: 484 LASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           LASLDNLR+DG FYDS GNIPEGQGILNALLAGCFDI+HELK+
Sbjct: 440 LASLDNLRKDGKFYDSKGNIPEGQGILNALLAGCFDILHELKI 482

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/525 (60%), Positives = 402/525 (76%), Gaps = 32/525 (6%)

Query: 5   FQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELD 64
             ++ Q  Q +PKEEE IL+YFL++R  LS+LK+NR Q+L S +V  TYQEVLTKVRELD
Sbjct: 1   MSSANQGEQGIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELD 60

Query: 65  AIRKKNHDAVATNVP--TLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASL 122
            IRK  H++     P  TLIH+ DLHNRVDSV+DDVFQLLSLCFLTVGLKNSAPATYASL
Sbjct: 61  KIRKTTHESSPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASL 120

Query: 123 STVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDI 182
           STV+SLL HL E+ +YTH+DLKPIK+RL+EIS+IVE++ +  N   D    D      D+
Sbjct: 121 STVQSLLDHLNESNVYTHNDLKPIKERLDEISEIVEKN-SYWNIPTDG--GDGNAFADDL 177

Query: 183 DAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVAS 242
           + +R  N +E+NLLL+AKL++C+  YN++E+KLE I   L   ME+LFQIRRGLLSL AS
Sbjct: 178 EDKRKENNIEENLLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAAS 237

Query: 243 SRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKN 302
           ++   S++ +E+ D +              +EL        +SH+ + E+ + L  +L +
Sbjct: 238 AK---SRVEQEEQDEND-------------DELC------ILSHEKINERLKALETELAD 275

Query: 303 LEAHRDEDGKFKSL-ETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSL 361
           + +HR+E GKF S+ + + V E GQ VLNGLLDDC+DL+ DLSHQ   G    L +DP +
Sbjct: 276 VRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDDCHDLIRDLSHQTSAG----LDLDPHI 331

Query: 362 QPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQS 421
           QP+Y+ L+ IKT LENL++TRRWTLRETDLF+YQKKL E+D+LRVNG+FP+E++DS+GQ+
Sbjct: 332 QPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLAELDSLRVNGKFPSESSDSKGQA 391

Query: 422 ILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQ 481
           ILLYLLRRCYAIIYKLLESSEPVSE+L+ IHNQLSTVR CLLELKRMGGV+NERELYPYQ
Sbjct: 392 ILLYLLRRCYAIIYKLLESSEPVSESLERIHNQLSTVRHCLLELKRMGGVDNERELYPYQ 451

Query: 482 MKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           MKLASLDN+R DG FYD DGNIPEGQG LNALLA CFDI+HE+K+
Sbjct: 452 MKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFDILHEMKI 496

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 69/142 (48%), Gaps = 14/142 (9%)

Query: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369
           +GKF S  +D     GQ +L  LL  C  ++  L    E        +  SL+ ++ +L 
Sbjct: 377 NGKFPSESSDS---KGQAILLYLLRRCYAIIYKLLESSE-------PVSESLERIHNQLS 426

Query: 370 EIKTTLENLMITRRWTL-RETDLFSYQKKLNEIDNLRVNGRFPTETAD-SRGQSILLYLL 427
            ++  L  L + R   +  E +L+ YQ KL  +DN+RV+G+F     +   GQ  L  LL
Sbjct: 427 TVRHCL--LELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALL 484

Query: 428 RRCYAIIYKLLESSEPVSEALQ 449
             C+ I++++   +E   EA Q
Sbjct: 485 AECFDILHEMKIEAEVREEAAQ 506

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 398/517 (76%), Gaps = 30/517 (5%)

Query: 13  QNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHD 72
           Q VP EEE ILN+ L+VR  L++LK+NRTQ+LN+ +VQ TYQ VLTKVRELD IRK +  
Sbjct: 16  QIVPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLT 75

Query: 73  AVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHL 132
             A    TLIH++ LHNRVDSVLDDVFQLLSLCFLTVG+KNSAPATY+SLSTV+ LL+HL
Sbjct: 76  TPAKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLEHL 135

Query: 133 EEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALE---NDEEQAIKDIDAERTRN 189
            E++++T HDL+PIK+RL+EI +IVE+S  + +   D+     + +E  + +I+ ERTRN
Sbjct: 136 NESRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIEIENERTRN 195

Query: 190 KLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQ 249
           ++E++LL++AKL+ C++ +N++ES+LE I+P L+S+++KL+ IRRGLLSL + + +  S+
Sbjct: 196 RIEEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLSK 255

Query: 250 ISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHK-LVREKFEVLRNDLKNLEAHRD 308
                 D +   S+  N+++               SHK LV  K   ++  L  +E+ RD
Sbjct: 256 S-----DNNHIASTNHNVSDK--------------SHKELVLLK---MKKQLVEIESQRD 293

Query: 309 EDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERL 368
           E+G +KSLET+KV   GQ ++N L+DDCNDL++DLSH   T NG  +  DP LQ +Y+ L
Sbjct: 294 ENGYYKSLETNKVEMEGQGIVNKLVDDCNDLINDLSH---TQNG-NIITDPYLQQIYKNL 349

Query: 369 LEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLR 428
           ++IKT L NLM+TRRWTLRETDLFSYQKKL EID+LRVNG+F + T+D++GQSI+LYLLR
Sbjct: 350 IDIKTNLANLMVTRRWTLRETDLFSYQKKLAEIDSLRVNGKFKSATSDAKGQSIILYLLR 409

Query: 429 RCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLD 488
           RCYAIIYKLLESSEP+SE+LQ IH QLSTVRRCL+ LKR+GGV + +ELYPYQMKLASLD
Sbjct: 410 RCYAIIYKLLESSEPISESLQSIHTQLSTVRRCLMTLKRLGGVTDIKELYPYQMKLASLD 469

Query: 489 NLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELK 525
            LR DG FYD++G+IPEGQGILNA+LA CFD++HELK
Sbjct: 470 ELRIDGKFYDANGDIPEGQGILNAMLAECFDMVHELK 506

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/149 (29%), Positives = 72/149 (48%), Gaps = 20/149 (13%)

Query: 310 DGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLL 369
           +GKFKS  +D     GQ ++  LL  C  ++  L    E        +  SLQ ++ +L 
Sbjct: 388 NGKFKSATSDA---KGQSIILYLLRRCYAIIYKLLESSE-------PISESLQSIHTQL- 436

Query: 370 EIKTTLENLMITRRWTLRETD---LFSYQKKLNEIDNLRVNGRFPTETAD-SRGQSILLY 425
              +T+   ++T +     TD   L+ YQ KL  +D LR++G+F     D   GQ IL  
Sbjct: 437 ---STVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNA 493

Query: 426 LLRRCYAIIYKLLESSEPV--SEALQPIH 452
           +L  C+ ++++L   +E    SE   PI+
Sbjct: 494 MLAECFDMVHELKCDAEAYSSSENATPIN 522

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/512 (60%), Positives = 384/512 (75%), Gaps = 38/512 (7%)

Query: 15  VPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHDAV 74
           VPKEEE IL Y LDVR  L++LK NR+Q+LNS EVQ  +QEVLTKVRELD IRK+     
Sbjct: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79

Query: 75  ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHLEE 134
           A    T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LL+HL+E
Sbjct: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139

Query: 135 AKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRNKLEQN 194
           + I+T+HDL+PIKDRL+EIS IVE +  +        + D      + + +R +NK+E++
Sbjct: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRN------YDFDLTNPADETEEKRNKNKIEED 193

Query: 195 LLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQISEED 254
           LLL+AKLKHC+D YN++ SKLE+I P L+S+MEKL+ IRR LLSL + SR +D++   ED
Sbjct: 194 LLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLASPSRKIDTR---ED 250

Query: 255 LDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGKFK 314
                   SQ N                  S K  +E    L  +L+ LE+HRDE+G FK
Sbjct: 251 F-------SQFN------------------SSKESQEALSSLEQELEELESHRDENGNFK 285

Query: 315 SLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIKTT 374
           SLET +V   GQ VL GL+D+C+DL++D ++   +GNG  L +DP L+P+Y+ L+ IKT 
Sbjct: 286 SLETGEVVLKGQNVLAGLVDNCHDLINDFNN---SGNGSDL-VDPELEPIYDELINIKTN 341

Query: 375 LENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYAII 434
           L NLMITRRWTLR+TDLF YQKKL  IDN RVNG+FPT++ D++GQ+ILLYLLRRCYAII
Sbjct: 342 LANLMITRRWTLRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAII 401

Query: 435 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQDG 494
           YKLLESS PVSE+LQ IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG
Sbjct: 402 YKLLESSVPVSESLQSIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDG 461

Query: 495 IFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
            F+D++G IPEGQG LNALLA CFDI+HEL++
Sbjct: 462 KFFDANGEIPEGQGTLNALLAECFDIMHELEI 493

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/532 (56%), Positives = 380/532 (71%), Gaps = 44/532 (8%)

Query: 2   ISSFQTSTQPAQNVPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVR 61
           I+S     + +  VP+ E  IL Y +DVR  L+QLK NR++YLNS EV+  +QEVLTKVR
Sbjct: 4   ITSVTDFKEMSYGVPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKVR 63

Query: 62  ELDAIRKKN------HDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSA 115
           ELD IRK         D+    + TL+ N  LHN+VDS++DDVFQLLSLCFLTVGLKNSA
Sbjct: 64  ELDDIRKSKLKDDGQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNSA 123

Query: 116 PATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDE 175
           PATY SLSTV+ LL+HL+E+ I+T+HDL+PIK+RL+EISKIV     Q N+ ++   N++
Sbjct: 124 PATYTSLSTVQKLLEHLDESNIFTNHDLRPIKERLDEISKIV-----QNNSYKNYEFNED 178

Query: 176 EQAIKDIDAERTR-NKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRR 234
           E     +D +  + N +E++LLL+AKLK C D +  + SKLE+IDP L S+MEKL+ IRR
Sbjct: 179 EINPNQVDDDEIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRR 238

Query: 235 GLLSLVASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFE 294
            LLSL + +  +D             T+   +I N       +E+ +  + H        
Sbjct: 239 NLLSLASPTHKID-------------TTENISIFN------NNEESRKMLKH-------- 271

Query: 295 VLRNDLKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLK 354
            L ++L  LE HRDEDG FKSLET++V   GQ  L GL+D+C+DL++D ++     +G  
Sbjct: 272 -LSDELTELETHRDEDGNFKSLETNEVKLKGQNALAGLVDNCHDLINDFTN----SSGDN 326

Query: 355 LSMDPSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTET 414
             +D +LQP+Y  L+ IKT L NLMITRRWTLRETDLF YQK+L EID+ RVNG+FP+E+
Sbjct: 327 QILDKNLQPIYNNLINIKTNLANLMITRRWTLRETDLFQYQKRLKEIDDQRVNGKFPSES 386

Query: 415 ADSRGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNE 474
            +++GQSILLYLLRRCYAIIYKLLESSEPVSE+LQPIHNQLST RRCLL LKRMGGVN+ 
Sbjct: 387 GNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLSTTRRCLLALKRMGGVNSP 446

Query: 475 RELYPYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           RELYPYQ+KLASLD LR DG FYDS G IPEGQG LNALLA CFD++HEL++
Sbjct: 447 RELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTLNALLAECFDMLHELEI 498

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  532 bits (1370), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/477 (59%), Positives = 355/477 (74%), Gaps = 36/477 (7%)

Query: 52  TYQEVLTKVRELDAIRKKNHDAV-ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVG 110
           TYQ VLTKVR LD +RK+ H A   T   TLIH+A LHNRVDSVLDDVFQLLSL FLTVG
Sbjct: 3   TYQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVG 62

Query: 111 LKNSAPATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDA 170
           LKN+APATYASLSTV+ LL+H+EEA +YT+ DL+PIK+RL+EI +IVE+     N+    
Sbjct: 63  LKNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEK-----NSYMSM 117

Query: 171 LENDEEQAIKDIDAERTRNKLEQNLLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLF 230
           +E+  E  + ++  E+  NKLE++LL++AKL+HCVDSY +V+SK   I P L  + +KLF
Sbjct: 118 VED--EAPLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLF 175

Query: 231 QIRRGLLSLVASSRNMDSQISEEDLDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVR 290
            IRR LLSL AS++  D    E   + S+  +S + +A+ L +                 
Sbjct: 176 HIRRELLSLAASAKT-DRAAGEGSTERSTTPASPNTLASRLKD----------------- 217

Query: 291 EKFEVLRNDLKNLEAHRDEDGKFKSLE-TDKVAENGQLVLNGLLDDCNDLVSDLSHQIET 349
                L + +  +E+HRD+ GKF S +  D V + GQ  LNGLLDDC +L  DLSHQ   
Sbjct: 218 -----LESMILEVESHRDDSGKFISPDDPDTVPQKGQSALNGLLDDCRNLFGDLSHQT-- 270

Query: 350 GNGLKLSMDPSLQPVYERLLEIKTTLENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGR 409
            +G+ L +DP LQP+YE LLEIKTTLENL++TRRWTLRETDLF+YQK+L E+DNLRVN +
Sbjct: 271 -SGV-LHLDPQLQPIYEELLEIKTTLENLLVTRRWTLRETDLFAYQKRLAELDNLRVNRK 328

Query: 410 FPTETADSRGQSILLYLLRRCYAIIYKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMG 469
            P+ ++ S+GQ+++LYLLRRCYA IYKLLESSEPVSE+LQ IHNQLSTVRRCL ELKRMG
Sbjct: 329 SPSSSSASKGQALILYLLRRCYATIYKLLESSEPVSESLQKIHNQLSTVRRCLFELKRMG 388

Query: 470 GVNNERELYPYQMKLASLDNLRQDGIFYDSDGNIPEGQGILNALLAGCFDIIHELKV 526
           GV++ER+LYPYQMKLASLDN+R DG FYD+DGNIPEGQG LNALLA CFDI+HE+K+
Sbjct: 389 GVDSERDLYPYQMKLASLDNMRVDGKFYDADGNIPEGQGTLNALLAECFDILHEMKI 445

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  158 bits (399), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 125/441 (28%), Positives = 225/441 (51%), Gaps = 65/441 (14%)

Query: 117 ATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVE------ESCAQTNAIQDA 170
           + Y+S+  ++ LL  L ++ ++T +DL P+K RL+EI  I+E      + C + +   + 
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILEADYSLLQECEENDNEDNE 132

Query: 171 LENDEEQAIK----------DIDAERTRNKLEQNLLLKA-----------KLKHCVDSYN 209
              D ++ I+          DI   +T    E   L K            +L  C   +N
Sbjct: 133 DNEDNDENIQGVNEIGGNSGDIPTPQTSYDYENGKLQKCDDSNLKKYIFQELDDCYKVHN 192

Query: 210 EVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQISEEDLDTSSRTSSQSNIAN 269
            +E K ++ID  L+S+++K+  +R+ LL +V S                S       + +
Sbjct: 193 VIELKTDNIDVNLSSLLDKVLVVRKDLLYIVFSR-------------VKSVFPQCFVLKD 239

Query: 270 PLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGKFKSLETDKVAE----NG 325
           P           N +S+    +K   ++   +NL+  ++++ ++   ++ +       NG
Sbjct: 240 P-----------NHMSNSTFDKKLNEIQ---RNLDVIKEKNTEYDEGQSQRNKNEGNING 285

Query: 326 QLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIKTTLENLMITRRWT 385
           Q +LNGL+D C +++ D+         +    D     ++E+ L +K  LE +++T R +
Sbjct: 286 QRILNGLVDYCQEVIHDVKLL-----AIDKIDDEKKANLFEKSLLLKIKLETILVTNRHS 340

Query: 386 LRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYAIIYKLLESSEPVS 445
           L+  DLF+  K+L++++  R    +  E +  + +SI+++ LRRC+ IIYK+LESSEPV 
Sbjct: 341 LKSLDLFNLHKELSKLEK-RTIRHYNIEDS-FQAKSIIIFFLRRCHCIIYKILESSEPVP 398

Query: 446 EALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQDGIFYDSDGNIPE 505
             L+P++NQLST+ R LL+LK  GGV    +L P ++KL ++ + R +  F D  GNIP 
Sbjct: 399 HCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPG 458

Query: 506 GQGILNALLAGCFDIIHELKV 526
           GQ  LNALL  C +++  L++
Sbjct: 459 GQRALNALLHECMELLKILEI 479

>KAFR0D00300 Chr4 complement(41181..42809) [1629 bp, 542 aa] {ON}
           Anc_1.31 YDR518W
          Length = 542

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 6/117 (5%)

Query: 51  KTYQEVLTKVRELDAIRKKNHDAVATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVG 110
           K Y       + L  I ++  D VA+N  T  +N+ +   +D  ++DV  L    + T+ 
Sbjct: 402 KYYAPWCGHCKRLAPIYEELADVVASNKKT--NNSFVIADIDDTVNDVANLQIKGYPTII 459

Query: 111 LKNSA----PATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQ 163
           L  +     P TY    ++ESLL  LEE      + +K  KD  N++    EE  A+
Sbjct: 460 LYPAGQKDKPITYEGSRSIESLLTFLEENSGNKINSMKLYKDYQNDLKIAQEEEAAK 516

>KAFR0B05850 Chr2 (1209414..1210571) [1158 bp, 385 aa] {ON}
           Anc_8.343 YDR161W
          Length = 385

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 112 KNSAPATYASLSTVESLLQHLEEAKIYTHHDLKPIKDRLNEISKIVEESCAQ 163
           +N++P  +++L ++    Q  E+A        K  ++R NEISKI  ES  Q
Sbjct: 159 ENTSPEAWSTLGSIRISQQRFEDACGAFRQSWKFFEERKNEISKIASESNTQ 210

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 187 TRNKLEQNL--LLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKL-FQIRRGLLSLVASS 243
           ++ KL+Q++  LLK K+K  +++++EV  K E  DPT +S  EKL   ++R +  L    
Sbjct: 2   SQRKLQQDIDKLLK-KVKEGLETFDEVYEKFESSDPTNSSYREKLESDLKREIKKLQKQR 60

Query: 244 RNMDSQISEEDLDTSS 259
             + + +S+ED+   S
Sbjct: 61  EQIKTWLSKEDVKDKS 76

>NDAI0F03230 Chr6 (775461..778838) [3378 bp, 1125 aa] {ON} Anc_2.92
           YNL163C
          Length = 1125

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 76/162 (46%), Gaps = 15/162 (9%)

Query: 278 EQKKNAISHKLVREKF-EVLRNDLKNLEAHRDEDGKFKSLETDKVAENGQLVLNGLLDDC 336
           E +K AI  ++  EK  EVL +D KN   + D   K  +L   +   N  +  N LLD  
Sbjct: 838 ENQKGAIEQRIFLEKLQEVLESDEKNKGLYGDYLKKIAALGPHRTGCNILVSENELLDSL 897

Query: 337 NDLVSDLSHQIETG----NGLKLSMDPSLQPVY-ERLLEIKTTLENLMITRRWTLRETDL 391
            D  S +  + E      NG +LS++    P+  E +  +   +E++ I     + +++L
Sbjct: 898 FD--STIHGKFEFTDSILNGFQLSVNEG--PLANEPVQGMCVIIEDIHI-----MDDSEL 948

Query: 392 FSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYAI 433
            + +    ++D   ++GRF T T D   +S L +  R  +A+
Sbjct: 949 VAIEDPHYQVDIPNLSGRFITATRDQIHESFLDWSSRIMWAM 990

>Kwal_23.5361 s23 complement(1127422..1129725) [2304 bp, 767 aa]
           {ON} YPR181C (SEC23) - cytoplasmic GTPase-activating
           protein [contig 8] FULL
          Length = 767

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 4/55 (7%)

Query: 306 HRDEDGKFKSLETDKVAENGQLVLNGLLDDCNDLV--SDLSHQIETGNGLKLSMD 358
           H  +  KF SL  D++A+NG  V   +   C D V  S++ H  +T  G+ L  D
Sbjct: 324 HFKKASKFYSLLADRIAQNGHTV--DIFAGCYDQVGMSEMKHLTDTTGGVLLLTD 376

>YKL033W Chr11 (375456..378572) [3117 bp, 1038 aa] {ON}  TTI1Subunit
           of the ASTRA complex, involved in chromatin remodeling;
           telomere length regulator involved in the stability or
           biogenesis of PIKKs such as TORC1; similar to S. pombe
           Tti1p; detected in highly purified mitochondria in
           high-throughput studies
          Length = 1038

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 266 NIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGKFKSLETDKVAENG 325
           +I N +  EL SEQ  +  + K+V     +  N +K +E    E+  +   E+D    + 
Sbjct: 502 HILNDVVTELISEQVDSPRTQKIV--ALWLSTNFIKAMEKQPKEEEVYLQFESDANYSSS 559

Query: 326 QL--VLNGLLDDCNDLVSDLSHQIETGNGLKLS 356
            +  V   +L+ CN+L  D+S +IE G G+K S
Sbjct: 560 MVEEVCLIVLEFCNELSQDISMEIE-GKGIKKS 591

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 43/72 (59%), Gaps = 4/72 (5%)

Query: 187 TRNKLEQNL--LLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKL-FQIRRGLLSLVASS 243
           ++ KL+Q++  LLK K+K  ++ Y+E+  K +  DP+ TS  EKL   ++R +  L    
Sbjct: 2   SQRKLQQDIDKLLK-KVKEGLEDYDEIYEKFQSSDPSNTSYREKLESDLKREIKKLQKHR 60

Query: 244 RNMDSQISEEDL 255
             + + +S+ED+
Sbjct: 61  DQIKTWLSKEDV 72

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.131    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,931,395
Number of extensions: 2474932
Number of successful extensions: 11237
Number of sequences better than 10.0: 529
Number of HSP's gapped: 11687
Number of HSP's successfully gapped: 676
Length of query: 549
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 434
Effective length of database: 40,294,809
Effective search space: 17487947106
Effective search space used: 17487947106
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)