Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0K012903.188ON61161130590.0
KNAG0K01300singletonON59761216920.0
KLTH0G16038g3.188ON60961716520.0
SAKL0C10472g3.188ON60861716490.0
Suva_2.1423.188ON60361416440.0
Smik_2.1343.188ON59761116310.0
KAFR0C008703.188ON61262116280.0
Kwal_56.231173.188ON60762516280.0
YBR015C (MNN2)3.188ON59761416250.0
TDEL0D043303.188ON59861616230.0
NCAS0E015903.188ON60852516150.0
Skud_2.1273.188ON59661415880.0
ZYRO0A04950g3.188ON61852815500.0
NDAI0G017903.188ON60761415420.0
TBLA0F007403.188ON65352915210.0
NCAS0A03650singletonON60751615100.0
CAGL0I04532g3.188ON61252914900.0
TPHA0A043803.188ON64253214680.0
Ecym_53143.188ON61562914100.0
Kpol_1036.503.188ON67653014060.0
KLLA0E17755g3.188ON63852414020.0
NDAI0A065003.188ON63752313640.0
AER018C3.188ON60652313401e-178
KAFR0E01030singletonON64052613291e-176
TPHA0C04560singletonON57352413221e-176
Kpol_1045.703.188ON61752013191e-175
NDAI0A007801.150ON58753610421e-134
KAFR0G002801.150ON57954410361e-133
KLTH0F03938g1.150ON56254510291e-132
Kwal_33.136931.150ON55853710121e-130
NCAS0B084501.150ON58654010131e-129
TBLA0D030301.150ON60553610051e-128
Kpol_2002.571.150ON6055429981e-127
SAKL0C04598g1.150ON6115459791e-124
TPHA0E034801.150ON7095369791e-123
YJL186W (MNN5)1.150ON5865479511e-120
Skud_10.311.150ON5865449421e-119
Smik_10.461.150ON5865499271e-117
ZYRO0D17160g1.150ON5795329231e-116
Ecym_81281.150ON5925419231e-116
AEL148W1.150ON5734799131e-115
KLLA0C16467g1.150ON6075089021e-113
CAGL0M02871g1.150ON6005168891e-111
Suva_6.2661.150ON5865258791e-110
KNAG0C009001.150ON6235108711e-108
SAKL0H22616gsingletonON7415888541e-104
TDEL0C03020na 1ON6605868371e-102
TBLA0J011901.150ON6164938331e-102
TBLA0A002703.188ON9575428081e-95
ZYRO0F13244gna 1ON6645937864e-95
KLLA0F24574gna 2ON7116077251e-85
SAKL0C08888gna 2ON6795976983e-82
KLTH0C08976gna 2ON7025946977e-82
Kwal_56.22779na 2ON6956016242e-71
Ecym_3545na 2ON6705996214e-71
CAGL0L08096g1.150ON5645335873e-67
AEL082Wna 2ON6816085051e-54
NDAI0H012707.123ON6562741323e-07
NCAS0F007807.123ON6392561305e-07
AEL345WsingletonON6452591281e-06
Suva_5.322na 3ON5532121225e-06
CAGL0C04004gsingletonON6322561216e-06
Kwal_55.209847.123ON6193251191e-05
KNAG0G01070singletonON6323091153e-05
CAGL0C03938gsingletonON6372621144e-05
KNAG0D05360singletonON5333101134e-05
TDEL0F05640singletonON5543161135e-05
CAGL0C03916gsingletonON6282691127e-05
TDEL0B00160singletonON5623371082e-04
CAGL0C03982gsingletonON6292921073e-04
Suva_14.418na 4ON5803221046e-04
CAGL0C03894g7.123ON6272631047e-04
KNAG0J02990singletonON6442901038e-04
KNAG0G010607.123ON6942591030.001
Kpol_298.4singletonON6312651000.002
CAGL0C03960gsingletonON6232241000.002
CAGL0H09262gsingletonON625266980.003
AFL235WsingletonON381211980.003
ZYRO0G04048g7.123ON641283980.003
KLTH0G07986gna 5ON569280980.004
NDAI0A085507.123ON664271980.004
CAGL0H09240gsingletonON642192970.004
Skud_7.10na 3ON566201970.004
Kwal_23.2926na 5ON568303970.004
Smik_9.1807.123ON630238960.005
Smik_14.393na 4ON580230950.007
TDEL0H032607.123ON641130950.008
YNR059W (MNT4)na 4ON580173940.009
TBLA0C06250singletonON736382940.011
ABR245CsingletonON641132930.012
CAGL0C04048gsingletonON620143930.015
Smik_7.4na 3ON562145920.015
SAKL0D15180gsingletonON577208920.016
TBLA0A00640singletonON747146910.025
CAGL0C04026gsingletonON636156890.039
YGL257C (MNT2)na 3ON558144880.047
Suva_9.1917.123ON625267880.050
TBLA0G03680singletonON751142870.062
KLTH0F13486g7.123ON623103860.083
Skud_14.395na 4ON580247850.12
CAGL0G04279gsingletonON660231850.12
KLLA0E09813gsingletonON746261850.12
TBLA0H00130singletonON687144840.15
YIL014W (MNT3)7.123ON630272840.16
Suva_5.87na 6ON766186830.18
TPHA0L008207.123ON730316830.19
KNAG0D03070singletonON650272830.22
AAR183CsingletonON648151800.42
Skud_9.1587.123ON629264790.58
KLLA0D13376gna 7ON663199771.1
KNAG0E03170singletonON746267761.3
NCAS0I004807.123ON657245752.0
Smik_5.115na 6ON762300742.8
KAFR0K012407.123ON666134723.7
Kpol_1015.13singletonON743248715.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0K01290
         (611 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}            1182   0.0  
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             656   0.0  
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   640   0.0  
SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...   639   0.0  
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   637   0.0  
Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...   632   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   631   0.0  
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   631   0.0  
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   630   0.0  
TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...   629   0.0  
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    626   0.0  
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   616   0.0  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   601   0.0  
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    598   0.0  
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   590   0.0  
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   586   0.0  
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   578   0.0  
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   570   0.0  
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   547   0.0  
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   546   0.0  
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   544   0.0  
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   530   0.0  
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   520   e-178
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              516   e-176
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              513   e-176
Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...   512   e-175
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    405   e-134
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   403   e-133
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   400   e-132
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   394   e-130
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   394   e-129
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   391   e-128
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   389   e-127
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   381   e-124
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   381   e-123
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   370   e-120
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   367   e-119
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   361   e-117
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   360   e-116
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   360   e-116
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   356   e-115
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   352   e-113
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   347   e-111
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   343   e-110
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   340   e-108
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   333   e-104
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              327   e-102
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   325   e-102
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...   315   1e-95
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   307   4e-95
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   283   1e-85
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   273   3e-82
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   273   7e-82
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   244   2e-71
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   243   4e-71
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   230   3e-67
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   199   1e-54
NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123     55   3e-07
NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123     55   5e-07
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    54   1e-06
Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C ...    52   5e-06
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    51   6e-06
Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {...    50   1e-05
KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {O...    49   3e-05
CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {...    49   4e-05
KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON}               48   4e-05
TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa] ...    48   5e-05
CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {...    48   7e-05
TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON}                 46   2e-04
CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {...    46   3e-04
Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059...    45   6e-04
CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {...    45   7e-04
KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON}              44   8e-04
KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {O...    44   0.001
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    43   0.002
CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {...    43   0.002
CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {...    42   0.003
AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homol...    42   0.003
ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {...    42   0.003
KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {...    42   0.004
NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa] ...    42   0.004
CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {...    42   0.004
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    42   0.004
Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}...    42   0.004
Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W ...    42   0.005
Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059...    41   0.007
TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {O...    41   0.008
YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putat...    41   0.009
TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON}             41   0.011
ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON} N...    40   0.012
CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {...    40   0.015
Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL2...    40   0.015
SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]...    40   0.016
TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON}               40   0.025
CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {...    39   0.039
YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}  MN...    39   0.047
Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W ...    39   0.050
TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {O...    38   0.062
KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]...    38   0.083
Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059...    37   0.12 
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    37   0.12 
KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} simila...    37   0.12 
TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON}        37   0.15 
YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}  MNT3Alpha-...    37   0.16 
Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W (...    37   0.18 
TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {...    37   0.19 
KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON}               37   0.22 
AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON} N...    35   0.42 
Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W ...    35   0.58 
KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} simi...    34   1.1  
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    34   1.3  
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 33   2.0  
Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W ...    33   2.8  
KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {...    32   3.7  
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    32   5.8  

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score = 1182 bits (3059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/611 (94%), Positives = 577/611 (94%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXX 60
           MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSG        
Sbjct: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGTATVSAPS 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPEC 120
                                     LDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPEC
Sbjct: 61  AKTAASAVAGGAGGGVPAAAGAAAAALDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPEC 120

Query: 121 RLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNSYKG 180
           RLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNSYKG
Sbjct: 121 RLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNSYKG 180

Query: 181 SGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFI 240
           SGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFI
Sbjct: 181 SGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFI 240

Query: 241 DRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLV 300
           DRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLV
Sbjct: 241 DRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLV 300

Query: 301 LWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTM 360
           LWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTM
Sbjct: 301 LWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTM 360

Query: 361 PDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYG 420
           PDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYG
Sbjct: 361 PDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYG 420

Query: 421 LPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQ 480
           LPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQ
Sbjct: 421 LPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQ 480

Query: 481 KRISFDKSYSLEDFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYT 540
           KRISFDKSYSLEDFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYT
Sbjct: 481 KRISFDKSYSLEDFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYT 540

Query: 541 NLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLE 600
           NLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLE
Sbjct: 541 NLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLE 600

Query: 601 KTHLEAVNKKD 611
           KTHLEAVNKKD
Sbjct: 601 KTHLEAVNKKD 611

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/612 (52%), Positives = 422/612 (68%), Gaps = 32/612 (5%)

Query: 4   VNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXXXX 63
           +NRR  KL +   F+V  C++    TH+ +DG  +V  Y + LQ +L G           
Sbjct: 10  LNRRLAKLFKAVFFLVIVCLVCAGLTHHFHDGPKTVDEYKEFLQGYLGGNANTTVTVVN- 68

Query: 64  XXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLE 123
                                   D+ K+K +Y+ VF+N++ FSP G T + Y  +C L 
Sbjct: 69  ------------------------DADKIKSYYNTVFENLLLFSPKGETARAYGDKCILN 104

Query: 124 GDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNSYKGSGI 183
             IG+  D+   F+RL Y+NL++CL LS  ++S L+ SH  FV SLDV  P   Y+G GI
Sbjct: 105 EAIGTTSDNIPKFERLSYENLLDCLKLSNEELSALKLSHNFFVQSLDVKYPKGMYQGDGI 164

Query: 184 VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRI 243
           V VGGGK+SLMA+L+++++R  GT+LPVEVFIPPNE  ETEFC   LP+ NA+CIFIDRI
Sbjct: 165 VMVGGGKYSLMAYLVIKHLRSSGTSLPVEVFIPPNEEDETEFCETALPELNAQCIFIDRI 224

Query: 244 LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWP 303
           LP  MI+ F F+GYQFKSLALV+SSFEN LLLDADN+PV+ L+ IF +EPFKS GL+LWP
Sbjct: 225 LPSAMIKTFHFKGYQFKSLALVSSSFENVLLLDADNYPVRRLDDIFKQEPFKSTGLILWP 284

Query: 304 DFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDV 363
           DFWRRTT PL+Y+I+GV ++L + VR SFDDLTPPEVY  +  D S +P +D  G MPDV
Sbjct: 285 DFWRRTTTPLFYNISGVAIDLTSPVRYSFDDLTPPEVYFNSTMDRSKIPVNDFAGAMPDV 344

Query: 364 STESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPF 423
           STESGQL++NK  HL TILL+LYYNVNGP WYYPI +Q+A GEGDK+TFIAAANFYGLP+
Sbjct: 345 STESGQLLINKRTHLKTILLSLYYNVNGPAWYYPIIAQRAPGEGDKDTFIAAANFYGLPW 404

Query: 424 YQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGL---SRVGNSASQ 480
           YQVK+   +DGY E+G++HGV MLQYD VQDY+LYQ A+ DI  KYG+   S+ G   S+
Sbjct: 405 YQVKTRVGIDGYSEDGQYHGVGMLQYDFVQDYELYQSARRDITAKYGVAGPSKTGQLRSE 464

Query: 481 KRISFDKSYSLEDFKNKYF-REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSY 539
             I++D++YSL+ F+ KYF +E S + VMFIH+NFPKFDPLSLW++++ ++K G+ +R+Y
Sbjct: 465 --IAYDENYSLDTFEEKYFNKEKSGHKVMFIHANFPKFDPLSLWQDKKFINKQGSTYRTY 522

Query: 540 TNLRKFGDFDIELENFKIFKNFFC-GDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVF 598
            NL KF  +DIEL NF  F+  FC G   V++F Y+  AL+        MC YI  RL  
Sbjct: 523 NNLGKFNYWDIELYNFNSFETLFCSGADSVTWFPYMNRALQGNTNDRESMCSYIRMRLDH 582

Query: 599 LEKTHLEAVNKK 610
           LE+TH EA   K
Sbjct: 583 LEQTHHEATVPK 594

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  640 bits (1652), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/617 (51%), Positives = 424/617 (68%), Gaps = 19/617 (3%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQ---EHLSGXXXXX 57
           M  + +RF K+ R ++     C++F+ +T Y+    +S+  Y ++LQ   E  SG     
Sbjct: 1   MVLLTKRFNKIFRFSLVAALCCLIFVLSTRYIDQDLSSLE-YVRYLQNYHETYSGNGNKV 59

Query: 58  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDSMK-LKKFYSRVFQNIIDFSPSGATKKQY 116
                                            + L++FY +VF+N+   SP+G++ +QY
Sbjct: 60  EPEVETPPAPAANDKIKSPSGGPVLSAQDQKRRQALQEFYKQVFKNLRQHSPTGSSSRQY 119

Query: 117 KPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPS 175
             +C+L GDIG+R +DY+++ +L   NL NCL LS  + + L+ +H  FV+SL  + LP 
Sbjct: 120 DEKCQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTMLKETHYDFVESLKSLVLPK 179

Query: 176 NSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNA 235
            +YKG GIVTVGGGKFS+++FLI++ +R +GT LPVEVFIPPN+  E EFC  LLPKYNA
Sbjct: 180 GTYKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIPPNDEGEEEFCNTLLPKYNA 239

Query: 236 KCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFK 295
           KCI+I  +LP+++I+ FDF+GYQFKS++++ASSFEN LLLDADNFP+K L++IF EEP+K
Sbjct: 240 KCIYISDVLPEDIIENFDFKGYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYK 299

Query: 296 SKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHD 355
           S G+VLWPDFWRRTT P YY+IA + VN K RVRN  DD+TPP+ YT++M +L  VP HD
Sbjct: 300 STGMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDITPPQAYTKDMKNLENVPLHD 359

Query: 356 LEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAA 415
           LEGT+PDVSTESGQLM+ K++HL TILL+LYYNVNGPTWYYPIFSQKA+GEGDKETFIAA
Sbjct: 360 LEGTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAA 419

Query: 416 ANFYGLPFYQVKSSTSVDGYFE--NGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSR 473
           ANFYGLPFYQVKS T+VDGY +  N  F GVAMLQ+D VQDY  Y+ AK DI+ KY    
Sbjct: 420 ANFYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYA--- 476

Query: 474 VGNSASQKRISFDKSYSLEDFKNKYFRED--SHNDVMFIHSNFPKFDPLSLWKNRQLVDK 531
                  + I  D SYS +     YF  +     D+MF+HSN PKFDP +LW ++ L+  
Sbjct: 477 ---GKVPQFIKQDTSYSPDAMYKTYFEPEDLKEVDIMFVHSNLPKFDPYTLWNDKDLI-V 532

Query: 532 DGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEY 591
           DG H RSYTNLR+  ++D+ELENFK+FK + C  +  + F YL D+L+     W  MC Y
Sbjct: 533 DGKHIRSYTNLRRLNNYDLELENFKVFKEYLCVSR--TKFKYLDDSLQGDERQWKSMCGY 590

Query: 592 INKRLVFLEKTHLEAVN 608
           I +RL FL++TH +A+N
Sbjct: 591 IKERLNFLDQTHSDAIN 607

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/617 (52%), Positives = 424/617 (68%), Gaps = 20/617 (3%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHL----SGXXXX 56
           M  + +RF K+ ++A      C+LFI    Y+      V  Y  +LQ ++    SG    
Sbjct: 1   MVLLTKRFAKVFKLAAITTLCCLLFILTNKYISQDL-PVDEYKSYLQNYIDKYTSGSGNP 59

Query: 57  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQY 116
                                             KL+ FYS+VF+ +  +SP G + + Y
Sbjct: 60  PAVVPSPPQKGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRVY 119

Query: 117 KPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLD-VTLPS 175
            P C+L+GDIG+R DDY N+ +L  + L  CL LS  + + L+ +H  FV++L  + LP 
Sbjct: 120 DPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLPK 179

Query: 176 NSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNA 235
           +SYKG+GIVTVGGGKFSL+AFLI++ +R M TTLPVEV IPP +  ET+FC  LLPKYNA
Sbjct: 180 DSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYNA 239

Query: 236 KCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFK 295
           KCI+I  +LP  ++  F+F+GYQFKSL+++ASSFEN LLLDADNFP+KPL+ IF+EEP+K
Sbjct: 240 KCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPYK 299

Query: 296 SKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHD 355
           S G+VLWPDFWRRTT P YYDIA +P++   RVRN  D++TPPE+YTE+M DLS VP HD
Sbjct: 300 STGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLHD 359

Query: 356 LEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAA 415
           L+GT+PDVSTESGQLM++K+ HL T+LL+LYYNVNGP+WYYPIFSQKAAGEGDKETFIA 
Sbjct: 360 LDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIAG 419

Query: 416 ANFYGLPFYQVKSSTSVDGYFE-NGE-FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSR 473
           ANFYGLPFYQVKS+T+VDGY + +G+ F GVAMLQ+D VQDY+ YQ A  DI  +Y   +
Sbjct: 420 ANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYS-GK 478

Query: 474 VGNSASQKRISFDKSYSLEDFKNKYFRED--SHNDVMFIHSNFPKFDPLSLWKNRQLVDK 531
             NS     I  DK Y+ E F  KYF  D     D+MF+HSN PKFDPL+LW+ + L+  
Sbjct: 479 TSNS-----IHLDKDYTPESFYRKYFEGDDIKEVDIMFVHSNLPKFDPLTLWREKDLI-V 532

Query: 532 DGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEY 591
           +G H RSYTNL++   +D+ELE+FK+F+++ C  +  S+F YL + L++    W  MC+Y
Sbjct: 533 NGKHIRSYTNLKRLNGYDLELESFKVFQDYLCVQR--SHFKYLDEHLQEE-AQWQSMCDY 589

Query: 592 INKRLVFLEKTHLEAVN 608
           I+ RL FL+ TH +AV+
Sbjct: 590 IHNRLKFLDSTHKDAVS 606

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/614 (54%), Positives = 409/614 (66%), Gaps = 18/614 (2%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXXX 62
            + +RF KL ++A   +  C LF+    Y+ D   SV  Y  HLQ ++            
Sbjct: 2   LLTKRFSKLFKLAFIALLLCGLFVVTNKYM-DENTSVKDYKSHLQSYIDSYANKDSSSPE 60

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRL 122
                                     + KLK FY+ VF  ++  SPSG +K+ Y  +C L
Sbjct: 61  DAAAAAAADDAASLKGNDNAS-----TEKLKSFYNNVFNFLMLDSPSGKSKRVYNEKCPL 115

Query: 123 EGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSYKGS 181
           +GDIG RPD Y +  +L    L  CL LS  ++S L+ SHK +V+ +  + LP  +YKGS
Sbjct: 116 KGDIGDRPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDYVEHIASLILPKGTYKGS 175

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFID 241
           GI TVGGGKFSLMAFLI++ +R MGTTLPVEV IPP +  ETEFC+++LPKYNAKCI+I 
Sbjct: 176 GIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCSKILPKYNAKCIYIS 235

Query: 242 RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVL 301
            ILP E I+KF F+GYQFKSLAL+ SSFEN LLLDADNFP+K L++IF EEP+ S GLV+
Sbjct: 236 DILPAETIEKFVFKGYQFKSLALITSSFENLLLLDADNFPIKSLDNIFLEEPYVSTGLVM 295

Query: 302 WPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361
           WPDFWRRTT PLYYDIAG+PVN + RVRNS DD+TPP VYT+++ DL  VP  D+EG +P
Sbjct: 296 WPDFWRRTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYTKDLKDLDAVPLSDMEGAIP 355

Query: 362 DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 421
           DVSTESGQLM+NK+KHL T LL+L+YNVNG  WYYPIFSQKAAGEGDKETFIAAANFYGL
Sbjct: 356 DVSTESGQLMINKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKETFIAAANFYGL 415

Query: 422 PFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQK 481
           PFYQVK+ T V+GY ++  FHGVAMLQ+D VQDY  Y  A   I+ KY    + +SA   
Sbjct: 416 PFYQVKTKTGVEGYHDSDGFHGVAMLQHDFVQDYSRYLTASKTINNKYKDLIIKSSAP-- 473

Query: 482 RISFDKSYSLEDFKNKYF-REDSHN----DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHF 536
            I FDK YSLE +  ++F  EDSH     DVMFIHSN PKFDP  L K+  L   D    
Sbjct: 474 -IKFDKDYSLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDPYDLSKSNFLT-TDNKPA 531

Query: 537 RSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRL 596
           RS+T+L K   +DIELENFK    + C ++    F YL DAL +   GW  MC+YI KRL
Sbjct: 532 RSFTSLGKIHKYDIELENFKALHEYVCVNKNP--FKYLDDALGQDEKGWKKMCDYIAKRL 589

Query: 597 VFLEKTHLEAVNKK 610
            FLE TH +A+  K
Sbjct: 590 QFLESTHEKAIAGK 603

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score =  632 bits (1631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/611 (53%), Positives = 408/611 (66%), Gaps = 24/611 (3%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXXX 62
            + +RF KL ++   V+  C LF+    Y+ D   SV  Y K+L ++++           
Sbjct: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYM-DENTSVKDYKKYLLDNIN---------SY 51

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRL 122
                                   + + KLK FY+ VF  ++  SP+G + ++Y   C+L
Sbjct: 52  SSKHSSSSDNAGADDSSSLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQL 111

Query: 123 EGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSYKGS 181
            GDIG RPD Y    +L  + L  CL LS  +++ L  SHK +VD +  + LP  +YKGS
Sbjct: 112 SGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGS 171

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFID 241
           GI TVGGGKFSLM+FLI++ +R MGTTLPVEV IPP +  E+EFC ++LP YNAKCI++ 
Sbjct: 172 GIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVS 231

Query: 242 RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVL 301
            ILP E I+KF F+GYQFKSLALVASSFEN LLLDADNFP+KPL++IFNEEP+ S GLV+
Sbjct: 232 DILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVM 291

Query: 302 WPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361
           WPDFWRRTT PLYY+IA + VN+KNRVRNS DDLTPP +YT+N NDL GVP  DL+GT+P
Sbjct: 292 WPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIP 351

Query: 362 DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 421
           DVSTESGQLM+NK KHL T LL+L+YNVNGP WYYPIFSQKAAGEGDKETFIAAANFYGL
Sbjct: 352 DVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGL 411

Query: 422 PFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQK 481
            FYQVK+ T V+GY +   FHGVAMLQ+D VQDY  Y  A   I  KY    + +SA+  
Sbjct: 412 SFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKY--KDIKSSAA-- 467

Query: 482 RISFDKSYSLEDFKNKYF-----REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHF 536
            I +DK+YSLE +  ++F     +   H DVMFIHSN PKFDP +L +   L   D    
Sbjct: 468 -IKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLT-TDDKPA 525

Query: 537 RSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRL 596
           RS+T L K  ++DIELENFK+ K + C   K + F YL D L +    W  MC+YI KRL
Sbjct: 526 RSFTALHKVQNYDIELENFKVLKEYVC--DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRL 583

Query: 597 VFLEKTHLEAV 607
            FLE TH + +
Sbjct: 584 QFLESTHDKVI 594

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/621 (51%), Positives = 424/621 (68%), Gaps = 23/621 (3%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXX 60
           M  VN+RF KL    + V  G    +    Y+ + + SV  Y ++LQ +++         
Sbjct: 1   MAVVNKRFSKLF--ILLVSIGFFFLLTNRLYINNDSVSVKDYKEYLQSYINNNAGDSTDA 58

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXLDSM-KLKKFYSRVFQNIIDFSPSGATKKQYKPE 119
                                      ++  +L++FY+ VFQ  I++SPSG + + Y+  
Sbjct: 59  QGTKGGDESVPAASKGKNPVLMSTVESNTKNRLREFYNEVFQYFINYSPSGKSARHYQDA 118

Query: 120 CRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSY 178
           C+L   +G+RP +Y+++ +L Y  L  CL++S +D+ NL+ SHK FV++L  + LP NSY
Sbjct: 119 CQLSEKMGNRPHEYASWYKLSYTELNKCLSISKSDVLNLKTSHKEFVENLGKLVLPKNSY 178

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGP-ETEFCTELLPKYNAKC 237
           KG+GIVTVGGGKFSLM+ L+++ +R +GTTLPVEVFIPP E   E EFC ++LP+Y+AKC
Sbjct: 179 KGNGIVTVGGGKFSLMSLLVIRTLRNLGTTLPVEVFIPPQEEKGEMEFCNKILPQYHAKC 238

Query: 238 IFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSK 297
           I+I  ILP +MI  F+F GYQFKSLA++ASSFEN LLLDADNFP+KPL+ IF EEP+ S 
Sbjct: 239 IYISDILPQQMIDNFEFAGYQFKSLAIIASSFENLLLLDADNFPIKPLDHIFEEEPYVST 298

Query: 298 GLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLE 357
           GLVLWPDFWRRTTQPLYY+IA V V+ K RVRNS DD+TPP VYT++MNDLS +P HDL+
Sbjct: 299 GLVLWPDFWRRTTQPLYYEIADVSVDFKTRVRNSIDDITPPPVYTKDMNDLSNIPLHDLK 358

Query: 358 GTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAAN 417
           GT+PDVSTESGQLM++K+KHL T+LLALYYNVNGP+WYYPIFSQKA+GEGDKETF+AAAN
Sbjct: 359 GTIPDVSTESGQLMISKSKHLPTVLLALYYNVNGPSWYYPIFSQKASGEGDKETFLAAAN 418

Query: 418 FYGLPFYQVKSSTSVDGYF--ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVG 475
           FY LP+YQ+++   VDGY   EN  F GVAMLQ+D  QDYK Y  AK+++ +KYG  R  
Sbjct: 419 FYDLPYYQIRTEVGVDGYHQPENKGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYGKDRYS 478

Query: 476 NSASQKRISFDKSYSLEDFKNKYFREDSHN--------DVMFIHSNFPKFDPLSLWKNRQ 527
           +     +I +D +Y ++ F   YF   S          DVMFIHSN PKF+PL+ WK   
Sbjct: 479 S-----KIKYDPNYDVDSFYRTYFDSGSEPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSD 533

Query: 528 LVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWND 587
           L+  DG H RS+TNL++  ++DIELENFKI+    C  ++  +F YL DAL       + 
Sbjct: 534 LI-IDGKHIRSFTNLKRLKNYDIELENFKIYHEVLC--EQGLHFKYLDDALGNNKNDKSS 590

Query: 588 MCEYINKRLVFLEKTHLEAVN 608
           MC+YI+ RL FL+ TH  A++
Sbjct: 591 MCKYISDRLDFLQSTHEAAIS 611

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  631 bits (1628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/625 (50%), Positives = 420/625 (67%), Gaps = 37/625 (5%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHY------------VYDGANSVSGYGKHLQE 48
           M F+ +RF K+ ++++     C+ F+ +T Y            + D   + +GYGK  QE
Sbjct: 1   MVFLTKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLEYGKLVDTFMADAGYGKDAQE 60

Query: 49  HLSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSP 108
            ++G                                     + ++KFY+ VF ++   SP
Sbjct: 61  -VAGSSSDGTADNNGIGAGAKVSTSSNEKR----------KIAMRKFYTDVFNSLKKHSP 109

Query: 109 SGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDS 168
           +G +K++Y  +C+L GDIG+R DDY N+ +L   NL  CL +S  +   L+  H+ +V+S
Sbjct: 110 TGVSKREYGAQCKLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVES 169

Query: 169 LD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCT 227
           L+ + LP  +YKG GIVTVGGGKFS++AFLI++ +R + T+LPVEVFIPP +  ET FC 
Sbjct: 170 LESLVLPKGAYKGDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCN 229

Query: 228 ELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNS 287
           ELLP+YNAKCI+I  +LP E+I  F+F+GYQFKS+A++ASSF+N LLLDADNFP+K L++
Sbjct: 230 ELLPQYNAKCIYISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDN 289

Query: 288 IFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMND 347
           +FNEEP+KSKG+VLWPDFWRRTT P+YYDIA + VN K RVRN  DD+TPP VYT++M+D
Sbjct: 290 VFNEEPYKSKGMVLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMSD 349

Query: 348 LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEG 407
           LS VP HDLEGT+PDVSTESGQLM+ K+ HLGTILL+LYYNVNGP+WYYPIFSQKA+GEG
Sbjct: 350 LSNVPLHDLEGTIPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEG 409

Query: 408 DKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGVAMLQYDCVQDYKLYQIAKDDI 465
           DKETFIAAANFY LPFYQVKS T+VDGY +  +  F GVAMLQ+D VQDY     A+ +I
Sbjct: 410 DKETFIAAANFYDLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEI 469

Query: 466 DVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDS--HNDVMFIHSNFPKFDPLSLW 523
              +           +   +D SYS +    K+F +D+    D+MF+HSN PKFDP  LW
Sbjct: 470 RSHFA------GKDTQYAKYDPSYSPDAVYKKFFSDDNIGETDIMFVHSNLPKFDPYQLW 523

Query: 524 KNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPT 583
            ++ L+  DG H RSY NL++   +D+ELENFKIF  + C  Q  + F YL D L     
Sbjct: 524 HDQDLI-VDGKHIRSYRNLKRLNGYDLELENFKIFNEYLCTTQ--ARFKYLDDKLNGDQR 580

Query: 584 GWNDMCEYINKRLVFLEKTHLEAVN 608
            W DMC YI +RL +LE+THL+A++
Sbjct: 581 NWKDMCSYIGERLKYLEQTHLDAIH 605

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/614 (53%), Positives = 412/614 (67%), Gaps = 24/614 (3%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXXX 62
            + +RF KL ++   V+  C LF+    Y+ D   SV  Y ++L  ++            
Sbjct: 2   LLTKRFSKLFKLTFIVLILCGLFVITNKYM-DENTSVKEYKEYLDRYVQSYSNKYSSSSD 60

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRL 122
                                     + KLK FY+ VF  ++  SP G+T KQY   C L
Sbjct: 61  AASADDSTPLRDNDEAG---------NEKLKSFYNNVFNFLMVDSPKGSTAKQYNEACLL 111

Query: 123 EGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTL-PSNSYKGS 181
           +GDIG RPD Y +  +L    L  CL LS  ++++L  SHK +V+ +   + P  +YKGS
Sbjct: 112 KGDIGDRPDHYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVSPKGTYKGS 171

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFID 241
           GI TVGGGKFSLMAFLI++ +R MGTTLPVEV IPP +  ETEFC ++LPKYN+KCI++ 
Sbjct: 172 GIATVGGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCNKILPKYNSKCIYVS 231

Query: 242 RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVL 301
            ILP E I+KF F+GYQFKSLAL+ASSFEN LLLDADNFP+KPL++IFNEEP+ S GLV+
Sbjct: 232 DILPRETIEKFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVM 291

Query: 302 WPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361
           WPDFWRRTT PLYYDIAG+ V+ K RVRNS DD+TPP VYT+++ DLS VP  DL+GT+P
Sbjct: 292 WPDFWRRTTHPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTKDLKDLSDVPLSDLDGTIP 351

Query: 362 DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 421
           DVSTESGQLM+NK KHL T LL+L+YNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL
Sbjct: 352 DVSTESGQLMINKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 411

Query: 422 PFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQK 481
            FYQV++ T V+GY +   FHGVAMLQ+D VQDY  Y  A + I  KYG ++  ++    
Sbjct: 412 SFYQVRTRTGVEGYHDEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGGTKSADA---- 467

Query: 482 RISFDKSYSLEDFKNKYF-RED----SHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHF 536
            I FDK+YSLE +  ++F  ED    +H DVMFIHSNFPKFDP  L K+  L   +G   
Sbjct: 468 -IKFDKNYSLEKYTEEFFDNEDLNAKNHVDVMFIHSNFPKFDPYDLSKSNFLT-TNGKPA 525

Query: 537 RSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRL 596
           RSYT L+K  ++DIELENFK+   + C ++    F YL D L +  T W  +C YI  RL
Sbjct: 526 RSYTALKKVKNYDIELENFKVLNEYVCVNKNP--FKYLDDLLGQDKTEWKRVCGYITDRL 583

Query: 597 VFLEKTHLEAVNKK 610
            FLE TH +A+  K
Sbjct: 584 AFLESTHDKAIAGK 597

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/616 (51%), Positives = 419/616 (68%), Gaps = 29/616 (4%)

Query: 1   MNFVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXX 60
           M  + +R+ K L++A  V+  CV FIA + ++ +G  SVS Y  +++ +L          
Sbjct: 1   MALITKRYRKALKLATVVLVLCVTFIATSRFMDEGL-SVSEYQDYIKSYLGNAQPADTIS 59

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPEC 120
                                       + KLKKFY +VF+++ ++SPS  + ++Y  +C
Sbjct: 60  RNPAVDVGLNAGREPIANG--------GNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQC 111

Query: 121 RLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSYK 179
            L GDIG RP++Y+ + +L    L  CL +S AD++ LR SH  +V +L  + LP NSYK
Sbjct: 112 SLSGDIGFRPENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYK 171

Query: 180 GSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIF 239
           G GIVTVGGGKFSLMA L+++ +R + TTLPVEVFIPP++  ET+ C  +  KYNAKCIF
Sbjct: 172 GQGIVTVGGGKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIF 231

Query: 240 IDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGL 299
           +  ILP   ++KF F GYQFKSLAL+ASSFE+ L LDADNFPVK L+ IF ++P+ S GL
Sbjct: 232 LSDILPAPSLKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGL 291

Query: 300 VLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGT 359
           VLWPDFWRRTTQPL+YDIAG+ V+ K RVRN FDDLTPPEVYT+N+ DLS VPFHDLEG+
Sbjct: 292 VLWPDFWRRTTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGS 351

Query: 360 MPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY 419
           +P+VSTESGQLM++K+KHL TILLALYYNVNGP+WYYP+FSQ+A+GEGDKETF+ AA+FY
Sbjct: 352 IPEVSTESGQLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFY 411

Query: 420 GLPFYQVKSSTSVDGYFE-NGE-FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNS 477
           GLP+YQ+KS+T V+GY   +G+ F GVAMLQ+D  QDY  Y+ A+  I  KYG       
Sbjct: 412 GLPYYQLKSATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKYG------- 464

Query: 478 ASQKRISFDKSYSLEDFKNKYFREDSHN-----DVMFIHSNFPKFDPLSLWKNRQLVDKD 532
            +Q +IS+D SYSL +F   YF  D  N     D+MF HS+ PKF+P +LWKN+ L+  +
Sbjct: 465 -AQAKISYDSSYSLHEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLI-WE 522

Query: 533 GNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYI 592
           G H RSYT L K   +D+ELENFK    + C   K +   YL + L  T   W  MC+YI
Sbjct: 523 GKHIRSYTALSKINRYDLELENFKAINEYVC--VKRTNVKYLNENL-ATSAEWASMCDYI 579

Query: 593 NKRLVFLEKTHLEAVN 608
             RL +L+ TH++AV+
Sbjct: 580 RDRLAYLQSTHVQAVS 595

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/525 (59%), Positives = 388/525 (73%), Gaps = 17/525 (3%)

Query: 91  KLKKFYSRVFQNIIDFSPSGATKKQY-KPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           K+K F++ VFQ+IID+SP G TKK Y K +C L+GD+GSRP++Y ++ +L Y NL NCL 
Sbjct: 97  KMKAFFNTVFQHIIDYSPKGKTKKIYNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCLE 156

Query: 150 LSGADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTT 208
           +S  + +NL+ SH SF ++L+ + LP  +YKG GIV VGGGKFSL+++L+++ IR +GTT
Sbjct: 157 VSDTEFTNLKTSHASFTENLNKLVLPKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTT 216

Query: 209 LPVEVFIPPNEGP-ETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVAS 267
           LP+EVFIPPNE   E+EFC++ +   +AKCI+I  ILP +M+ KF+F+GYQFKSLA++AS
Sbjct: 217 LPIEVFIPPNEVEGESEFCSQTISDLDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIAS 276

Query: 268 SFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNR 327
           SFEN LLLDADN P+K LN+IF +EP+ S+GLVLWPDFWRRTTQP+YY IAG+PVNL+ R
Sbjct: 277 SFENLLLLDADNTPIKNLNTIFKQEPYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKR 336

Query: 328 VRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYY 387
           VRN  DDLTP  VYT+   D+  +PFHD EGTMPDVSTESGQLMVNK+KHL T+LLALYY
Sbjct: 337 VRNDIDDLTPVGVYTKP--DMVDIPFHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYY 394

Query: 388 NVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAML 447
           NVNGP WYYPIFSQKAAGEGDKETFIA ANFY LP+YQVKS   VDGY     F GVAML
Sbjct: 395 NVNGPNWYYPIFSQKAAGEGDKETFIAGANFYDLPYYQVKSKVGVDGYHRKEGFRGVAML 454

Query: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF-REDSHND 506
           Q+D VQDY  Y++A  DI  +Y        ++   + FDKSY+++ F +KYF   D   D
Sbjct: 455 QHDFVQDYNRYKLASADIAREY--------SNPSSVVFDKSYTVQKFYDKYFDNTDEDID 506

Query: 507 VMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQ 566
           VMFIHSN PKFDPL LWK+  L++ DG   RSYTNLRK G  DIE ENFK  K   C  +
Sbjct: 507 VMFIHSNLPKFDPLPLWKDNDLIE-DGKPVRSYTNLRKLGYHDIEYENFKTLKELLC--E 563

Query: 567 KVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKKD 611
           K   F YL D  +  P      C+YI  R  +LE+TH EA++  +
Sbjct: 564 KNVDFKYLADEFKSNPQARMSFCKYITDRYKYLEETHQEALSASE 608

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/614 (52%), Positives = 400/614 (65%), Gaps = 25/614 (4%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXXX 62
            + +RF KL ++A   +  C LF+    Y+ D   SV  Y  +LQ++L            
Sbjct: 2   LLTKRFSKLFKLAFIALILCGLFVITNKYM-DENTSVREYKSYLQDYLDSHSNKHPSTDA 60

Query: 63  XXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRL 122
                                     + KLK FY +VF  +I  SP+G + + Y   C L
Sbjct: 61  PVTDDSSSSKVNDNAA----------TRKLKDFYDKVFNFLILDSPTGKSARNYGKACLL 110

Query: 123 EGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSYKGS 181
            GDIG RPD Y    +L    L  CL LS  +IS L  SH+ +V+ +  + LP  +YKGS
Sbjct: 111 NGDIGDRPDQYEELHKLSAKQLSKCLELSPDEISRLTKSHRDYVEHIATLLLPKGTYKGS 170

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFID 241
           GI TVGGGKFSLMAFLI++ +R  GT LPVEV IPP +  E+EFC ++LPKYN+KCI++ 
Sbjct: 171 GIATVGGGKFSLMAFLIIKTLRNRGTNLPVEVLIPPGDEGESEFCNKILPKYNSKCIYVS 230

Query: 242 RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVL 301
            ILP E I+KF F GYQFKSLAL+ASSFEN LLLDADNFP+K L++IFNEEP+ S GLV+
Sbjct: 231 DILPVETIKKFHFEGYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVSTGLVM 290

Query: 302 WPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361
           WPDFWRRTT PLYY+IAG+PVN+  RVRNS DD+TPP VYT+++ +L  VP  DL+GT+P
Sbjct: 291 WPDFWRRTTHPLYYEIAGIPVNMNKRVRNSQDDITPPAVYTKDLKNLDDVPLSDLDGTIP 350

Query: 362 DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 421
           DVSTESGQLM+NK+K L T LL+L+YNVNGP WYYPIFSQKAAGEGDKETFIAAANFYG 
Sbjct: 351 DVSTESGQLMINKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGE 410

Query: 422 PFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQK 481
           PFYQV++ T V+GY EN +FHGVAMLQ+D VQDY  Y IA    + KY   +     S  
Sbjct: 411 PFYQVRTRTGVEGYHENKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNTMK-----SSA 465

Query: 482 RISFDKSYSLEDFKNKYF-----REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHF 536
            I FDKSYS E++  ++F        +H DVMFIHSN PKFDP  L +   L   D    
Sbjct: 466 SIKFDKSYSFENYFEEFFENEDTNAKNHVDVMFIHSNLPKFDPYDLSETNFLT-IDKKPA 524

Query: 537 RSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRL 596
           RSYT L K  ++DIELENFK  K + C ++    F YL DAL +    W  MC+YI +RL
Sbjct: 525 RSYTALHKIQNYDIELENFKALKEYVCTNKNP--FKYLDDALGEDKVKWKKMCDYITERL 582

Query: 597 VFLEKTHLEAVNKK 610
            FLE TH +A+  K
Sbjct: 583 EFLESTHDKAIADK 596

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  601 bits (1550), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/528 (55%), Positives = 386/528 (73%), Gaps = 17/528 (3%)

Query: 89  SMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           + KLK+FY  VF ++ +FSP G +++ YK +C L GDIG RP++Y  +  L +D+L NCL
Sbjct: 101 TAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENCL 160

Query: 149 NLSGADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGT 207
            +S  +++ L+ +H ++VD L  + LP N YKG GIVTVGGGKFSL+A L+++++R +GT
Sbjct: 161 EISPEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELGT 220

Query: 208 TLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVAS 267
           TLPVEVFIPP++  E +FC E+LP+YNAKC+++  +LP  +I    F GYQFKSL+L+AS
Sbjct: 221 TLPVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLSLIAS 280

Query: 268 SFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNR 327
           SFE+ L LDADNFPVK LN +F+  P+K+ G VLWPDFWRRTTQP+YYDIA + VN + R
Sbjct: 281 SFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRKR 340

Query: 328 VRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYY 387
           +RN FDDLTPPEVYT+N   +  +PFHD EGT+PDVSTESGQLM++K+ HL TILLALYY
Sbjct: 341 IRNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALYY 400

Query: 388 NVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGVA 445
           NVNGP+WYYP+FSQ+AAGEGDKETF+AAANFYGLPFYQVK++T V+GY    N  F GVA
Sbjct: 401 NVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRGVA 460

Query: 446 MLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDS-- 503
           MLQ+D  QDY  YQ A D I+ KYG    G +A  K I +DK YSL++F   +F  ++  
Sbjct: 461 MLQHDLNQDYLRYQAAADAIEAKYG----GKTA--KSIKYDKLYSLDNFYKTFFGSENSA 514

Query: 504 --HNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNF 561
               DVMF HS+ PKFDP  LW   +LV +DG HFRSYT+L K  ++D+EL        F
Sbjct: 515 LKECDVMFAHSHAPKFDPYGLWTQNELV-QDGKHFRSYTSLEKINNYDLELSAIDSIHKF 573

Query: 562 FCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNK 609
            C D KV+ F YL + ++ +     +MC+YI+KR  FL  TH +A++K
Sbjct: 574 VCLD-KVN-FKYLSEKIQ-SKQEHQEMCDYISKRREFLLSTHQQAISK 618

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/614 (47%), Positives = 406/614 (66%), Gaps = 21/614 (3%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFI-AATHYVYDGANSVSGYGKHLQEHLSGXXXXXXXXX 61
           F  R+F +LL++   +   C   I   + Y  + + SV  Y ++LQ +++          
Sbjct: 2   FFTRKFARLLKITTILCLLCFFCIWIPSEYSTNSSISVQEYKEYLQGYINKLPIQSNSNV 61

Query: 62  XXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECR 121
                                    +    ++ FY+ VFQNIID+SPSG T + Y  +C+
Sbjct: 62  NDDTQKEFQHLVSGENKEDIPS---IKKNTVEDFYNVVFQNIIDYSPSGKTARNYSSKCK 118

Query: 122 LEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLD-VTLPSNSYKG 180
           L+  I SRPD Y ++++L   NL+NCL +S  + +NL  SH +FV+ ++ + LP  +Y  
Sbjct: 119 LDQGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHHNFVEHVNKLVLPKGTYNN 178

Query: 181 SGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPP-NEGPETEFC-TELLPKYNAKCI 238
            GIV VGGGKF+ MA+L+++ +R  GTTLPVE+FIPP +   E  FC +E+L + +AKCI
Sbjct: 179 DGIVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPIDTVKEETFCKSEMLSELSAKCI 238

Query: 239 FIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKG 298
           ++  ILP EMI+KFDF+GYQFKSLA++ASSFEN LLLDADNFP+K L+ IF  EP+ S G
Sbjct: 239 YMSNILPQEMIEKFDFKGYQFKSLAIIASSFENLLLLDADNFPIKSLDKIFKHEPYNSTG 298

Query: 299 LVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEG 358
           LV+WPDFWRRTTQP+YY +A + VN+  RVRN  DD+TP +VY+++  D + +PFHD EG
Sbjct: 299 LVMWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDDITPTKVYSDDNFDFTKIPFHDFEG 358

Query: 359 TMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANF 418
           TMPD STESGQLM+NK+KHL T+LLALYYNVNGP WYYPIFSQ A GEGDKETFIAAA F
Sbjct: 359 TMPDDSTESGQLMINKSKHLPTVLLALYYNVNGPNWYYPIFSQNAHGEGDKETFIAAATF 418

Query: 419 YGLPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSA 478
           Y LPFYQV++    DGY     F GVAM Q+D +QDY+ YQIA+ +I  +Y        +
Sbjct: 419 YRLPFYQVRTKVGADGYHTKDRFQGVAMAQHDFIQDYEHYQIAQREIKKRY--------S 470

Query: 479 SQKRISFDKSYSLEDFKNKYFREDSHN----DVMFIHSNFPKFDPLSLWKNRQLVDKDGN 534
           + K I +D  Y+++ F +++F +D+      D+MF+HSN PKFDPL LW++  L+D+ G 
Sbjct: 471 NVKDIKYDAEYAVQKFYDEFFNKDTTKYGEIDIMFLHSNLPKFDPLKLWEDSALIDETGK 530

Query: 535 HFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINK 594
           HFRS+++ +    +DIE ENFKI K+  C   K  +FSYL + L++ P  W  MC+YI  
Sbjct: 531 HFRSFSDPKIVKKYDIEYENFKIIKDVICD--KGIHFSYLDEELQEKPQDWVSMCQYIKD 588

Query: 595 RLVFLEKTHLEAVN 608
           R +FL+ TH +A +
Sbjct: 589 RYIFLKDTHQDATS 602

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  590 bits (1521), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/529 (54%), Positives = 379/529 (71%), Gaps = 22/529 (4%)

Query: 91  KLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           K+ KFY  +F  + + +  G + + YK EC+L+GD+G+RPD+Y  + +L    L NCL +
Sbjct: 129 KVYKFYQDIFNILKNTTIPGKSDRVYKLECQLKGDVGTRPDNYKEWYKLTSKELSNCLEV 188

Query: 151 SGADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209
                  L+ SH  +VD +  + LP  +Y G GIVTVGGGKFS++AFLI++ +R +GT+L
Sbjct: 189 PYETAKMLQESHADYVDKIGSLVLPKVAYGGKGIVTVGGGKFSVLAFLIIRTLRNLGTSL 248

Query: 210 PVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269
           PVEVFIPP++  ET+FC  +LP+YNAKCI++  ILP E + +F+F+GYQFKSLA++ASSF
Sbjct: 249 PVEVFIPPSDEGETDFCNNVLPQYNAKCIYMTDILPKEFVDEFEFKGYQFKSLAMIASSF 308

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           ++ L+LDADNFP+K L++IF +EP+ S GLV+WPDFWRRTT P+YY IA VPVN K RVR
Sbjct: 309 DDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVPVNEKKRVR 368

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389
           N+FDDLTP E+YTE+++DLS VPFHDLEGT+PDVSTESGQLM+NK KH+ T+LLALYYN 
Sbjct: 369 NTFDDLTPVEIYTEDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATVLLALYYNF 428

Query: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGE--FHGVAML 447
           NGPTWYYPIFSQKAAGEGDKETFIAAANFYGL +YQV++S  VDGY ++ +  F GVAML
Sbjct: 429 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDKGFRGVAML 488

Query: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFRE-DSHN- 505
           Q+D VQDY+ Y+ A+++ID+KYG        ++K + +D +YS +DF   YF   D  N 
Sbjct: 489 QHDFVQDYERYERARNEIDIKYG-------GAKKVMKYDYNYSPDDFYKTYFDSGDDSNV 541

Query: 506 -------DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIF 558
                  D+MF+HSN PKFDP +LW    L   DG+HFRSY  L     +D+E ENFKIF
Sbjct: 542 NQPIKEVDIMFVHSNLPKFDPFTLWDENDLT-LDGSHFRSYLKLPHLTHYDLEYENFKIF 600

Query: 559 KNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAV 607
               C  +  + F YL D  +   +    MC YI  RL +L  TH  A+
Sbjct: 601 HQSLCVLK--NQFKYLEDKFQGKESNRESMCNYIMDRLKYLTDTHEMAL 647

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 3  FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGAN-SVSGYGKHLQEHLS 51
           + RRF KLL++   V+    LFIA  +Y+ D  + SVS Y + LQ +++
Sbjct: 2  ILTRRFFKLLKLISAVIVLTGLFIATNNYLDDAVSVSVSDYTQRLQSYIN 51

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/516 (55%), Positives = 381/516 (73%), Gaps = 16/516 (3%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQY-KPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           +K F+  VFQ+I+D+SP+G +++ Y K +C L   +G  PD+Y ++ +L Y+NL NCL +
Sbjct: 98  IKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVGYSPDNYKDWYKLSYENLGNCLEI 157

Query: 151 SGADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209
           S  + +NL+ +H SF++ +D +TLP++ Y+G GIV V GGKFSL+++L+V+ IR+ GTTL
Sbjct: 158 SDDEYTNLQSNHASFIEEMDKLTLPNDIYQGDGIVLVAGGKFSLLSYLVVKTIRKFGTTL 217

Query: 210 PVEVFIPPNE-GPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASS 268
           PVEVFIPP+E   E EFC  +L +++AKC++I  ILP+ MI  FDF+GYQFKSLA++ASS
Sbjct: 218 PVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILPESMISHFDFKGYQFKSLAIIASS 277

Query: 269 FENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRV 328
           FEN LLLDADNFPVK L++IF +EP+ + GL+LWPDFWRRTTQP++Y+IAG+ VNL+ RV
Sbjct: 278 FENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDFWRRTTQPMFYEIAGISVNLQKRV 337

Query: 329 RNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYN 388
           RN+ D+LTP +VY ++  ++  VP+HD EG MPDVSTESG+LMVNK +HL T+LLALYYN
Sbjct: 338 RNAIDNLTPVQVYDKSDQEMD-VPYHDFEGAMPDVSTESGELMVNKVEHLKTVLLALYYN 396

Query: 389 VNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQ 448
           VNGP WYYPIFSQ  AGEGDKETFIA A FY LPFYQVK+   VDGY +   F GVAMLQ
Sbjct: 397 VNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQVKTKVGVDGYHKEDGFRGVAMLQ 456

Query: 449 YDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFR-EDSHNDV 507
           +D VQDY  Y++A+  ID KY  S          + +DK Y+++ F ++YF  E +  DV
Sbjct: 457 HDFVQDYDRYKLAQLKIDKKYLPSN--------EVLYDKDYTVQKFYDEYFNIEGNETDV 508

Query: 508 MFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQK 567
           +F+HS+ PKFDP+SLWK+  L+ KDG H RSYTNL KFG +DIE ENFK  K   C  + 
Sbjct: 509 LFVHSHLPKFDPVSLWKDNDLI-KDGKHLRSYTNLNKFGYYDIEYENFKTMKELLC--ES 565

Query: 568 VSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTH 603
            ++F Y+ +A +  P    D C+YI  R  FL +TH
Sbjct: 566 DTHFYYIDEAFKDKPEEKADFCKYIVDRYEFLNETH 601

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/529 (54%), Positives = 377/529 (71%), Gaps = 19/529 (3%)

Query: 90  MKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           +K+K FY  VF++I+D+SP+G T +++   C   GDI +RPD Y N+ +L Y  L +C+ 
Sbjct: 84  LKIKDFYKTVFEHILDYSPAGKTAREFDDSCFDSGDISTRPDSYKNWKKLSYHQLSHCMK 143

Query: 150 LSGADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTT 208
           +S ++I++LR +HKS+VD + ++ LP  SYKG GIVTVGGGKF+LMA  +++ +R +GTT
Sbjct: 144 ISPSEINHLRGNHKSYVDKINELVLPKGSYKGEGIVTVGGGKFTLMALTMIKALRTLGTT 203

Query: 209 LPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASS 268
           LPVEVFIPP+EG E+ FC  +LP+YNAKCI+I  ILPD+MIQKF F+GYQFKSLA++ SS
Sbjct: 204 LPVEVFIPPDEG-ESTFCESVLPQYNAKCIYISDILPDDMIQKFTFKGYQFKSLAMITSS 262

Query: 269 FENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRV 328
           FEN LLLDADN PVK ++ IF  + F+S GL+LWPDFWRRTT P YY+IA +P N   RV
Sbjct: 263 FENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDFWRRTTMPAYYEIANLPYNQNKRV 322

Query: 329 RNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYN 388
           RN+FDD+TPPEVYT+   DLS VPFHD+EGT+PD STESGQL+++K KHL T+LL+LYYN
Sbjct: 323 RNAFDDITPPEVYTKPDGDLSEVPFHDMEGTLPDPSTESGQLLISKAKHLPTLLLSLYYN 382

Query: 389 VNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYF--ENGEFHGVAM 446
           VNGP WYYPIFSQ+ AGEGDKETFI+AA+FY L +YQVK+S  VDGYF  +   + GV M
Sbjct: 383 VNGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQVKTSVGVDGYFRHDGSGYRGVGM 442

Query: 447 LQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFR------ 500
           LQ+D +QD K Y  A +  + KY   R    + +  IS+D SY   +F +K+F       
Sbjct: 443 LQHDFIQDSKQYMEAFEYSNTKYNNLR----SEKGSISYDPSYDPNEFFDKFFSRKKPDG 498

Query: 501 -EDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFK 559
            ++S  DVMF+H N PKFDP   W    LV +   HFRS+ N +    FDIELENFK F 
Sbjct: 499 GDESKADVMFVHCNLPKFDPYVSWDTNDLVYQT-KHFRSFNNKKVIAQFDIELENFKFFN 557

Query: 560 NFFCG-DQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAV 607
              C  +     F YL + L +    W  MC+YI+KRL +L+++H EA+
Sbjct: 558 ETLCPYENGKGKFKYLDNKLSE--ERWPQMCDYISKRLQYLKESHNEAL 604

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/532 (54%), Positives = 377/532 (70%), Gaps = 28/532 (5%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           LK+FYS+VF +I  +SP G   ++YK  C L  +I  RP++  ++ +L    L NCL  +
Sbjct: 127 LKEFYSQVFDSIRKYSPVGKCARKYKESCILTDNIPDRPENSEHWFKLTKKALENCLEFT 186

Query: 152 GADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLP 210
             +   L+ +H +FV+S+  +TLP   Y   GIV VGGGKFS++AFLI++ +R +GTTLP
Sbjct: 187 PDEFKMLKSTHDNFVNSISKLTLPKQGYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTTLP 246

Query: 211 VEVFIPP-NEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269
           VEVFIPP +E  + +FC ++LP +NAKCIFI  +LP+E I+ FDF+GYQFKSLAL++SSF
Sbjct: 247 VEVFIPPVDEAEKDDFCKDVLPNFNAKCIFISDVLPEEQIKTFDFKGYQFKSLALISSSF 306

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           E+ LLLDADNFPVK L++IF++EP+KSKGL+LWPDFWRRTT P+YY IA VPV+   RVR
Sbjct: 307 EDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYYQIADVPVDYTKRVR 366

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389
           NS DDLTPPE+YTEN   L  VP HDL+GT+PD STESGQL++NK +H+ T+LL+LYYN+
Sbjct: 367 NSIDDLTPPEIYTEN---LDTVPLHDLQGTIPDPSTESGQLLINKKQHVPTLLLSLYYNI 423

Query: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGVAML 447
           NGP WYYP+F+QKAAGEGDKETFIAAA +Y LPFYQVK+ T VDGY +  N  F GVAML
Sbjct: 424 NGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDGYHQADNKGFRGVAML 483

Query: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF-------- 499
           Q+D VQDYK +  AKD I   Y          + RI FDK+YSLED+   Y         
Sbjct: 484 QHDFVQDYKRFLKAKDKIQSIY-------KTVESRI-FDKNYSLEDYYKNYILKTNSFDK 535

Query: 500 REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFK 559
            ++   D+MF+HSN PKFDP+SLWK  +L+  +G H R Y  + K  ++DIELENFK F 
Sbjct: 536 NDEGEVDIMFVHSNLPKFDPISLWKQNELI-VNGEHIRGYRAIEKLNNYDIELENFKTFN 594

Query: 560 NFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKKD 611
            + C ++  + F ++   LE        MC+YI  RL +LEKTH +++ KKD
Sbjct: 595 QYLCVEK--TKFVHVEKHLE-NEQDRKSMCDYIKSRLEYLEKTH-DSIFKKD 642

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/629 (45%), Positives = 392/629 (62%), Gaps = 37/629 (5%)

Query: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVY-DGANSVSGY-----------GKHLQ--- 47
            + RRF K LR+ V  +  C LF+ +   +  + + S+  Y           GK  Q   
Sbjct: 1   MLTRRFSKTLRLTVLTLIVCSLFLISNRTITGELSQSIHAYLEDWIVLNGGDGKDRQILQ 60

Query: 48  ---EHLSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLDSMKLKKFYSRVFQNII 104
              + ++G                                      KL+ FY +VF  + 
Sbjct: 61  EVIDAINGEDETHRESASRSDNAEKSIPDKLLSHSTPTAEEESRQAKLRGFYEKVFNMLS 120

Query: 105 DFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKS 164
             +PSG++ K     C+L  DIG R +D   + +L Y++L  CL +S  D   L+  H  
Sbjct: 121 KHAPSGSSSKIRGENCQLTKDIGGRLEDQKWWYKLSYEHLSKCLQVSRKDRKMLKKKHSD 180

Query: 165 FV-DSLDVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPET 223
           +V D   + LP +SY G+GIVTVGGGKFS++AFL++  +R +GTTLPVEV IPPNE  E 
Sbjct: 181 YVADLASLVLPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTTLPVEVLIPPNEESEH 240

Query: 224 EFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVK 283
           EFC  +LP++NAKCI++  +LP  ++  F+ +GYQ KS A++ASSF+N LLLDADN P+K
Sbjct: 241 EFCNNVLPEFNAKCIYLSDVLPKSVLTSFEVKGYQLKSFAIIASSFQNLLLLDADNLPIK 300

Query: 284 PLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTE 343
            L+ IF  +P+KS GLVLWPDFWRRTT P+YY++AG+P+N   RVRNS DD+TP  VYT 
Sbjct: 301 NLDDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIPINYNKRVRNSIDDVTPASVYTS 360

Query: 344 NMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKA 403
           N   LS VP HDLEG +PD+STESGQLM++K  HLGT LL+LYYNVNGPTWYYP+FSQ A
Sbjct: 361 NPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTALLSLYYNVNGPTWYYPLFSQGA 420

Query: 404 AGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKD 463
           +GEGDKETFIAAA+FY LPFYQV++ T VDGY  +  + GVAMLQ+D  QDY+ Y  +K+
Sbjct: 421 SGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHRSSGYRGVAMLQHDFRQDYERYTHSKE 480

Query: 464 DIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF---REDSHNDVMFIHSNFPKFDPL 520
           D + KY     G++A      ++ SY++ DF N YF         DVMF+HSN PK +PL
Sbjct: 481 DTEAKYA---AGSAA------YESSYNVNDFYNTYFGTYNSQEPLDVMFVHSNLPKLEPL 531

Query: 521 SLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEK 580
           SL  +   + +DG H RSY+NL++   +DIEL +F+ F  + C D++V +  Y    +++
Sbjct: 532 SLSTD---LMEDGQHIRSYSNLKRLHGYDIELRSFQTFNEYLC-DKRVKFKYYEKTLIDE 587

Query: 581 TPTGWNDMCEYINKRLVFLEKTHLEAVNK 609
               W  MC+YI  RL FLE+TH EA+NK
Sbjct: 588 --ESWTSMCDYIKGRLSFLERTHDEALNK 614

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  546 bits (1406), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/530 (55%), Positives = 373/530 (70%), Gaps = 22/530 (4%)

Query: 88  DSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNC 147
           ++  LK+FY RVF+ I   SP G +K+ YK  C L GDIG RP+ Y  + +L    L NC
Sbjct: 154 NTKSLKQFYGRVFELIQAHSPLGKSKRNYKEACLLNGDIGDRPEFYEVWYKLSMKELGNC 213

Query: 148 LNLSGADISNLRHSHKSFV-DSLDVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMG 206
           L +S A++S L+  H  ++ D   ++LP NS++G GIV VGGGKFSL++FLI+  IR  G
Sbjct: 214 LEISKAEMSKLKAKHAKYIADISSLSLPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQG 273

Query: 207 TTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVA 266
           TTLPVEVF+P ++G + EFC +LLP+ NAKCI++  +LP+E I +F F GYQFKS+AL+ 
Sbjct: 274 TTLPVEVFMPNDKGEDAEFC-KLLPELNAKCIYLSDVLPEETIDQFKFGGYQFKSIALLL 332

Query: 267 SSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKN 326
           SSF++ LLLDADN+P+K L+ IF +EP+KS GLVLWPDFWRRTT P YY IAG+ VN K 
Sbjct: 333 SSFDDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYYKIAGITVNSKK 392

Query: 327 RVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALY 386
           RVRNS DD+TPPEVYTENM +L  VP HDLEG++PD STESGQLM+NK+KHL TILL+LY
Sbjct: 393 RVRNSIDDITPPEVYTENMGNLVNVPLHDLEGSIPDGSTESGQLMINKSKHLATILLSLY 452

Query: 387 YNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGV 444
           YNVNGP WYYP+FSQKAAGEGDKETF+AAA F  LPFYQVK++T VDGY +  N  F GV
Sbjct: 453 YNVNGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTGVDGYHQADNKGFRGV 512

Query: 445 AMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFRED-- 502
           AMLQ+D  QDY  Y+ AK+ I+ +Y          +   ++DK YSL DF  KY   +  
Sbjct: 513 AMLQFDFHQDYLRYKRAKEAIEYQY--------QDKNLRTYDKRYSLNDFYRKYIMINDD 564

Query: 503 -----SHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKI 557
                S  DVMF+HSN PKFDP+ LW+ + L++  G H RS+ NL++  ++DIELENF I
Sbjct: 565 RNGGTSEADVMFVHSNLPKFDPVGLWRGQDLIEH-GKHIRSFRNLQRLNNYDIELENFTI 623

Query: 558 FKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAV 607
           F    C  ++   F YL D L      W DMC+YI  R+ FL  +H  A+
Sbjct: 624 FYKHLCLKRRS--FKYLEDELGDNEEDWKDMCKYIKDRVTFLNMSHQRAI 671

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/524 (51%), Positives = 369/524 (70%), Gaps = 19/524 (3%)

Query: 91  KLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           +++ FY +VF+ + +F P G     Y  +C L GDIG R ++   + +L  + L NCL L
Sbjct: 129 QVQGFYGQVFKYLKEFGPVGVNIATYNQKCSLNGDIGYRQENTDQWWKLTTEELNNCLQL 188

Query: 151 SGADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209
           S      L+ +H ++V +L  + LP ++Y G GIVTVGGGKFS+MAFLI++ +R  GTTL
Sbjct: 189 SQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMAFLIIKTVRNFGTTL 248

Query: 210 PVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269
           PVEVFIPP++  + EFC  LLP+YNAKCI++    P ++I+K DF+GYQFKSLA++ASSF
Sbjct: 249 PVEVFIPPSDEGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDFKGYQFKSLAIIASSF 308

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           +N LLLDADNFP+KPL+ IF E+ +K  GL+LWPDFWRRTT P YY IA  P++   R+R
Sbjct: 309 KNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTPIS-SERIR 367

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389
           N+ DD+TPP VYT+++ DLS VP HDL+GT+PD STESGQLM+NK KH  T+LL+LYYNV
Sbjct: 368 NTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINKLKHFPTVLLSLYYNV 427

Query: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGVAML 447
            GP+WYY IFSQ+++GEGDKETFIAAA+FY LPFYQV+S   VDGY    N  F GV ML
Sbjct: 428 YGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYHRHNNEGFRGVCML 487

Query: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSL-EDFKNKYFREDSHND 506
           Q+D  QDYK Y+ A+++I  KY         + +   +D  Y+  E++  KYF  D   D
Sbjct: 488 QHDFAQDYKRYRQAQNEIGTKY---------TNEPDDYDPKYNYQENYLGKYFTNDP-VD 537

Query: 507 VMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQ 566
           VMF+HS+ PKFDP+ L  ++ L+ +DG H RSY NL++   +D+ELE FK FK + C D+
Sbjct: 538 VMFVHSHLPKFDPVELALSQDLI-QDGKHIRSYRNLKRMNGYDLELEVFKTFKEYVC-DK 595

Query: 567 KVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKK 610
           +V +F Y   A+ K  + W  +C Y+N+RLV+L ++H EA+  +
Sbjct: 596 RV-HFKYFEKAV-KLESNWGIICNYVNERLVYLIESHSEAMEGR 637

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/523 (51%), Positives = 355/523 (67%), Gaps = 16/523 (3%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           + KF+ +VF  I +FSP      +Y P   +   IGSR +D  NF +L  ++L +CL +S
Sbjct: 126 IHKFFDQVFNYINEFSPETKLDIKYNPSRLVTDAIGSRRNDVKNFFKLSRNSLYDCLQIS 185

Query: 152 GADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLP 210
             +I  L++ H+ F +S+  + LP N+Y+  GIV VGGGK+SL++ L ++ +R+  TTLP
Sbjct: 186 DQEIDMLKNYHQGFTNSIAPLELPKNTYQNDGIVIVGGGKYSLLSLLAIKTLRKFNTTLP 245

Query: 211 VEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFE 270
           VEV+I  +E  + EFC E+LP+YNAKCI I  IL +++I  F F GYQ+KSLA+++SSFE
Sbjct: 246 VEVYISQDEEGDLEFCDEILPQYNAKCISIKNILSNDLINTFKFAGYQYKSLAVLSSSFE 305

Query: 271 NTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRN 330
           N LLLDADNFP+KPL+ IF +EP+ SK +V+WPDFWRRTT P YYDIA + VN  +R+RN
Sbjct: 306 NLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYYDIAHIFVNKSSRIRN 365

Query: 331 SFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
           S+DD+TP  VYT+    L  +PFHD EGT+PD+STESGQL++NK +HL  ILLALYYNVN
Sbjct: 366 SYDDVTPSNVYTDYSKSLDEIPFHDFEGTLPDLSTESGQLLLNKKEHLKAILLALYYNVN 425

Query: 391 GPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYF--ENGEFHGVAMLQ 448
           GP WYYPIFSQ  AGEGDKETF+A ANFY L +YQVK+   V G+F  E+G + GVA+LQ
Sbjct: 426 GPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPRVSGHFNKEDGSYRGVAILQ 485

Query: 449 YDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFR-EDSHNDV 507
            D V DYK Y  A DDI+ KY         S   I  D+ Y L++F +KYF  E    DV
Sbjct: 486 SDFVDDYKRYSHAMDDINSKY------KDLSPNEIKLDEDYDLQNFLDKYFELEGKQADV 539

Query: 508 MFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQK 567
           MFIH+NFPKFDP+ L      +  +G HFRS+ NL+    +D+ELE FKI  N  C ++K
Sbjct: 540 MFIHANFPKFDPVDLESGSSFI-HEGKHFRSFDNLKDIKYYDLELETFKILNNIICVERK 598

Query: 568 VSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKK 610
             +F Y+ D   K       +C+YI  RL FLE+TH EA+  K
Sbjct: 599 --HFKYIDD---KGVEERGKVCKYIEDRLKFLEETHEEAITPK 636

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  520 bits (1340), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 252/523 (48%), Positives = 356/523 (68%), Gaps = 26/523 (4%)

Query: 95  FYSRVFQNIIDFSPSGATKKQYKPECR-----LEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           FY +VF+ + + SPSG    +   +C+     L+G +    DD S++  L  ++L  CL 
Sbjct: 101 FYQKVFELLAEHSPSGQISHKSGRQCQVSQVVLQGHL----DDTSHWPLLTREHLSKCLK 156

Query: 150 LSGADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTT 208
           ++  D   +   H  +VD+L ++ L   +Y G+GIVTVGGGKFS++A L+++++R++GT+
Sbjct: 157 MTQKDKQMVSDKHMHYVDALSNLKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTS 216

Query: 209 LPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASS 268
           LPVEV IPP E  E ++C++LLP+  AKCI++  +LP  +I    F GYQ KS A++ASS
Sbjct: 217 LPVEVLIPPGEEEEYDYCSKLLPEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASS 276

Query: 269 FENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRV 328
           F++ LLLDADN P+  L+ IF  +P+   GLVLWPDFWRR+T P YY+IA V V+   RV
Sbjct: 277 FKDLLLLDADNIPILNLDDIFQSKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRV 336

Query: 329 RNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYN 388
           RN  D+LTP  VYT+NM DLS +P HD+EGT+PD STESGQL+++K +HL T+LL+LYYN
Sbjct: 337 RNHIDNLTPASVYTQNMKDLSSIPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYN 396

Query: 389 VNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQ 448
           VNG TWYYP+FSQ A GEGDKETFIAAANFY  P+YQV++ST  +GY     F GVAMLQ
Sbjct: 397 VNGETWYYPLFSQGAPGEGDKETFIAAANFYRKPYYQVRTSTGAEGYHTKKGFSGVAMLQ 456

Query: 449 YDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDSHN--D 506
           +D  +DY+ Y+ A++D+  KY  S+           +D  Y++E F  KYF + +    D
Sbjct: 457 HDFREDYRRYEAAREDVKTKYAKSQ----------QYDPEYTVEGFYKKYFEDPNQPPVD 506

Query: 507 VMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQ 566
           VMF+H+N PKF+PL +   +QL+ ++G+HFRSY++L K  ++DIELE+F++   + C  +
Sbjct: 507 VMFVHANLPKFEPLKM-SEKQLLMENGSHFRSYSHLDKLHNYDIELESFRVLNEYLCV-R 564

Query: 567 KVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNK 609
           KV    +  D L + P  WN MC+Y+  RL FLE TH EA+ K
Sbjct: 565 KVQ-LKFYKDKLSR-PAKWNSMCKYVEDRLKFLESTHEEALRK 605

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  516 bits (1329), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 266/526 (50%), Positives = 348/526 (66%), Gaps = 31/526 (5%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           +++FY  +F  II  SP+  +KK Y  EC ++  IG RP D+ ++ +L YDNL  CL LS
Sbjct: 107 IQEFYDEIFNAIISNSPTEESKKVYGKECIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLS 166

Query: 152 GADISNLRHSHKSFVDSLDVT-------LPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRR 204
             ++  L   HKS+V +++         L     K +GIV VGGGK+SL++ L V  IR+
Sbjct: 167 DEEVDMLHTKHKSYVSAINQIVEDSKELLNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRK 226

Query: 205 MGTTLPVEVFIPPNE---GPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKS 261
            GTTLPVEVFIP ++   G    FC ELLP+YNAKCIF   +L +++I+ F F GYQ KS
Sbjct: 227 FGTTLPVEVFIPRDDELKGDFQSFCNELLPQYNAKCIFTSNVLSEKLIENFHFNGYQHKS 286

Query: 262 LALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVP 321
           LAL+ASSF+N LLLD+DN P+K L+SIF  EPF   G+VLWPDFWRRTT P +Y IAG+P
Sbjct: 287 LALLASSFDNILLLDSDNHPIKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIP 346

Query: 322 VNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTI 381
           +N   RVRN  DDLTP EVY     ++  VPFHD EGT PD+S+ESGQL++N+N+HL +I
Sbjct: 347 INKNTRVRNCIDDLTPLEVYNNEEINIYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSI 406

Query: 382 LLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NG 439
           LLALYYN NGP WYY IFSQ AAGEGDKETFIA A+FYGLP+YQVK+  SV GY +  N 
Sbjct: 407 LLALYYNYNGPAWYYSIFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNS 466

Query: 440 EFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF 499
           EF GVA+LQ+D VQDY+ YQ A   +   Y           + +++D++YSL  F NKYF
Sbjct: 467 EFRGVAILQHDLVQDYQRYQEASIGLGKTYEFP--------ENVTYDENYSLGTFYNKYF 518

Query: 500 REDSHN------DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELE 553
              ++       D  F+H+NFPKFDP+SL +    +  +G HFRS+T+L K   +DIE E
Sbjct: 519 DGGNNEPDVKEVDFAFVHANFPKFDPVSLAEGSSFI-FEGQHFRSFTDLTKLNGYDIEYE 577

Query: 554 NFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFL 599
           NF    +F C ++K  YF Y+  ++ K    +  MC YI+ RL FL
Sbjct: 578 NFVTLHDFVCVNRK--YFPYIEKSISKEE--YEKMCRYISDRLQFL 619

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  513 bits (1322), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 257/524 (49%), Positives = 352/524 (67%), Gaps = 25/524 (4%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           +KK +S +F  I   SP     ++    C L+G +G+  +D  N+ RL   ++  CL LS
Sbjct: 56  IKKTFSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKNWHRLSQKSMEGCLELS 115

Query: 152 GADISNLRHSHKSFVDSLD-VTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLP 210
            ++I+ L+  H +++ SL+ + +    YKG GI  VGGGKFSL+AFL+V+ IR+  TTLP
Sbjct: 116 DSEINTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLLAFLVVKTIRKFETTLP 175

Query: 211 VEVFIPPNE-GPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269
           +E+FIPP +   E EFC +LLP+ NAKCI++  ILP + I+K++F+ YQ+KSLA++ASSF
Sbjct: 176 IEIFIPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKKYEFKRYQYKSLAILASSF 235

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           ++ LL+DADNFP+K L+ IF+ EP+ S GL+LWPDFWRR+  P +Y+I G+ ++ K RVR
Sbjct: 236 DDLLLIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSANPKFYEITGIELDTKKRVR 295

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389
           N+ DDLTPPEVYTE+ + L+ VPFHD  GT+PD STESGQ+M+NK KH+ T+LLALYYNV
Sbjct: 296 NAIDDLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESGQMMINKGKHMKTLLLALYYNV 355

Query: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE-NGE-FHGVAML 447
           NGP+WYYPI SQ AAGEGDKET IAAA      FYQVK  T V+GY + NG  F GVAML
Sbjct: 356 NGPSWYYPILSQGAAGEGDKETVIAAALHNKAKFYQVKFKTGVEGYHQSNGRGFRGVAML 415

Query: 448 QYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYF-------- 499
           Q+D VQD+  Y+ A   I   Y        +++    FD  YS++ F  KY         
Sbjct: 416 QHDFVQDFARYEDATARIKELY--------STESFKQFDSGYSIDAFYEKYISQVNTDIP 467

Query: 500 REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFK 559
            E    DV+F+HS+ PKFDP+ LW+++ L++ DG HFRSYT+L+K   FDIEL+NF+IF 
Sbjct: 468 EEKRKIDVLFVHSHLPKFDPVPLWQSQDLIE-DGKHFRSYTSLKKINYFDIELQNFEIFD 526

Query: 560 NFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTH 603
            + C D      ++ Y   E       D+C YI  RL +L++TH
Sbjct: 527 KYICQDT----IAFPYIKNEVKDADMPDLCNYIKNRLSYLQETH 566

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score =  512 bits (1319), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 248/520 (47%), Positives = 342/520 (65%), Gaps = 17/520 (3%)

Query: 92  LKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           +K FYS+V+  +    P G + ++Y  +C L+ DIG R +D   ++ L  DNL  CL + 
Sbjct: 106 MKTFYSKVYDLLRSAGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQID 165

Query: 152 GADISNLRHSHKSFVDSL-DVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLP 210
              ++ L++SH+ ++D L ++    + Y G GIV V GGKFSL++ L+++ IR +   LP
Sbjct: 166 EESLAMLKNSHRKYIDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLP 225

Query: 211 VEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMI-QKFDFRGYQFKSLALVASSF 269
           +EVFIPP +  + E C  LLPKYNAKCIF+   LP++ I +     GYQ K +A+ ASSF
Sbjct: 226 IEVFIPPMDEGDDELCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSF 285

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           +N LLLDADN+P+K ++ IF  EP+ S+GL+ WPD+WRR+T P YYDI    ++   RVR
Sbjct: 286 KNVLLLDADNYPIKNIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVR 345

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNV 389
           N+ DD+TPP VYTE++ +   +P HD EGT+PDVSTESGQLM+NK KHL ++LLA+YYN+
Sbjct: 346 NNLDDITPPSVYTEDLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNM 405

Query: 390 NGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQY 449
            GP WYYPI +QKA+GEGDKETFIA ANF+ LPFYQVK     DGY   G + GVAM Q+
Sbjct: 406 YGPNWYYPILTQKASGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQH 465

Query: 450 DCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDSHN---- 505
           D +QDY  Y+ AK  I+ KY         + K+   DK YS  DF +K+F ED H     
Sbjct: 466 DFIQDYTAYENAKTFIEKKY--------PNTKQDKIDKEYSPFDFTDKFF-EDEHADPVI 516

Query: 506 DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGD 565
           DVMF+H++ PKF+P++LW+   L+ +DG+H RSYT   K   +D+E+ENFK  +   C +
Sbjct: 517 DVMFVHAHLPKFEPVALWEENDLM-QDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLE 575

Query: 566 QKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLE 605
           +    F YL D L      W  +C+YI  R +F+EKTH E
Sbjct: 576 KPFE-FKYLKDKLSDDKEKWQGLCKYIKDRHIFMEKTHEE 614

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  405 bits (1042), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/536 (40%), Positives = 325/536 (60%), Gaps = 35/536 (6%)

Query: 92  LKKFYSRVFQNIIDFSP----SGATKKQYKPECRLEGDIGSRPDDYSNFDR-LGYDNLVN 146
           +++FY  +F +I  + P    S     +   +C+  GDI     D+  F+  L Y+NL  
Sbjct: 62  VERFYIDLFNSINQYRPLNPPSNPDDLRDTEKCKWHGDISVH--DFDKFNEYLSYNNLNE 119

Query: 147 CLNLSGADISNLRHSHKSFVDSL-------DVTLPSNSY-KGSGIVTVGGGKFSLMAFLI 198
           C  LS   ++NL+ SH  FV+S+       D  L S  +    GIVTVGGGK++++   +
Sbjct: 120 CYKLSNIQLNNLKRSHSGFVESILSEFSTKDDKLTSGLFPNNEGIVTVGGGKYTVLLMTM 179

Query: 199 VQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQ 258
           ++ +R+ GTTLP+EV IPP +  + EFC  +LP YN KCI+   +LPD++  K   +G+Q
Sbjct: 180 IEKLRQSGTTLPLEVIIPPQDEGDDEFCNNVLPNYNGKCIYFKDVLPDQLSDKLVIKGFQ 239

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
            K LA++ SSF+  L LDADN  +K L++IFN + FK K L++WPD WRR T P YY IA
Sbjct: 240 LKPLAILLSSFKKALFLDADNLAMKDLDNIFNTQAFKQKRLIVWPDVWRRFTAPAYYKIA 299

Query: 319 GVPVNLKNRVRNSFDDLTPPEVYTENMND----LSGVPFHDLEGTMPDVSTESGQLMVNK 374
            + ++L  R+RN  DD++PP  Y +N  +    L  VPFHDL+GT+PD ++ESGQ++++K
Sbjct: 300 NIKLDLGKRIRNLNDDVSPPSRYDDNSENSAQYLENVPFHDLKGTIPDPTSESGQMVIDK 359

Query: 375 NKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
            +H  T++L+LYYN+ GP WYY +FSQ  +G+GDKETFIAAA+  G P+YQV +     G
Sbjct: 360 IEHFHTLILSLYYNLYGPPWYYRMFSQGTSGQGDKETFIAAAHALGKPYYQVHTKMGFKG 419

Query: 435 YF-ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSY-SLE 492
           Y  E   F GV +LQ+D  QD+K  Q+A          S+  N    +   F + Y +  
Sbjct: 420 YNDEKLGFQGVGLLQHDFEQDFKQLQLA----------SKTINENESEYSKFKQDYKATV 469

Query: 493 DFKNKYFRE-DSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIE 551
           DF +   +  D   D+MF+H++F K++PL L +  + V +DG+HFR ++ L +   FD+E
Sbjct: 470 DFDDSLMKPIDGPIDIMFLHASFFKYEPLDLIREHRYVKEDGSHFRVFSGLERLNYFDLE 529

Query: 552 LENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAV 607
           L NFKI   F C ++ + +F Y Y  +E  P  W+DMC+++ +   +LE TH EA 
Sbjct: 530 LFNFKILNKFLCTEEMI-HFKY-YKNVESKPE-WSDMCKFLKEHTEYLESTHKEAT 582

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  403 bits (1036), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 219/544 (40%), Positives = 325/544 (59%), Gaps = 47/544 (8%)

Query: 95  FYSRVFQNIIDFSPSG--ATKKQYK-PECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           FYS V++ +I   P    + K  ++   C L  D+G   +D   F++L +DNL  C +LS
Sbjct: 48  FYSEVYELLISSKPMDPPSDKNSFRLTSCDLPKDVGI--NDLDRFEKLSFDNLQRCYHLS 105

Query: 152 GADISNLRHSHKSFVDSLDVTLPSNS-------YKGSGIVTVGGGKFSLMAFLIVQNIRR 204
                +L+ +H S+V S+   + ++S        K  GI+TVGGG++S++ F ++Q +R 
Sbjct: 106 NEQAQDLQKAHSSYVKSIKDLIDNHSNIISKDDEKKKGILTVGGGRYSVLLFTMIQKLRE 165

Query: 205 MGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLAL 264
            GTTLPVEV IPP +  + EFC  +LP++NAKCI+    LP  ++ K   + YQ K+L L
Sbjct: 166 TGTTLPVEVLIPPQDEGDDEFCNVILPQFNAKCIYFKDYLPPNLLDKLVLKSYQIKALGL 225

Query: 265 VASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNL 324
           + +SF   L LDADN+P+K LN IF  E F+  GL+ WPD WRR T P YY+IA +  NL
Sbjct: 226 LMTSFNQILFLDADNYPMKNLNYIFETESFQKYGLITWPDIWRRYTPPAYYNIADIDFNL 285

Query: 325 KNRVRNSFDDLTP----PEVYTENMND--------LSGVPFHDLEGTMPDVSTESGQLMV 372
           + RVR   DD++P     +++   +ND         S VPFHDLEGT+ D++TESGQ+++
Sbjct: 286 EKRVRFETDDISPVSRYDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISDLTTESGQMLI 345

Query: 373 NKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSV 432
           +K KHL T+LLA YYN  GP+WYY +FS  ++GEGDKETFI+AA+  G P+YQVKS    
Sbjct: 346 DKKKHLDTLLLAFYYNFYGPSWYYNMFSLGSSGEGDKETFISAAHALGKPYYQVKSKVEF 405

Query: 433 DGYFENGE-FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSL 491
           DG+F + + F G+ ++Q+D  QDY++++ A         L   GN    K   ++  Y L
Sbjct: 406 DGFFHDKDGFQGLGLMQHDFEQDYQVHKNAM--------LEVAGN--PDKYSKYESDYKL 455

Query: 492 E-----DFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFG 546
           E      F  KY  +    D+MF+H++F KF+PL L    +    D +  R +  + +  
Sbjct: 456 ETSFTDQFLRKYNNKKDLVDIMFVHASFFKFEPLELHSKNRYYMSDNSPLRGFKRMDRMN 515

Query: 547 DFDIELENFKIFKNFFCGDQKVSYFSY--LYDALEKTPTGWNDMCEYINKRLVFLEKTHL 604
           +FD+EL NF+I ++  C  + V++  Y   YD  E     W  +CEY++KR+ FL+KTH 
Sbjct: 516 NFDLELFNFQILRDNLCSTKPVAFKVYEDKYDTDE-----WKSVCEYLDKRVTFLKKTHE 570

Query: 605 EAVN 608
           EA+N
Sbjct: 571 EAIN 574

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  400 bits (1029), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/545 (40%), Positives = 320/545 (58%), Gaps = 38/545 (6%)

Query: 87  LDSMKLK-KFYSRVFQNIIDFSPSGATKKQY----KPECRLEGDIGSRPDDYSNFDRLGY 141
           LD+  L+ + YS VF  ++ + P    K +     +  C ++G   +R D     D + Y
Sbjct: 31  LDTPSLRERVYSDVFDALLQYRPVRPPKDRQAAVRQAGCEMKGVGVNRGD---AVDAMLY 87

Query: 142 DNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNS---------YKGSGIVTVGGGKFS 192
           +NL  C   + A    L+  H +F+  L  T    +          +  G VTVGGG+FS
Sbjct: 88  ENLDRCYRPTKAQFEGLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERGFVTVGGGRFS 147

Query: 193 LMAFLIVQNIRRMGTTLPVEVFIPPNEGP-ETEFCTELLPKYNAKCIFIDRILPDEMIQK 251
           L+A+ +++ +R  G+ LP EV IPP +   E  FC E+LP+ NA+C+F +  LP  +++ 
Sbjct: 148 LLAYSMLRALRARGSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDALPRALVET 207

Query: 252 FDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQ 311
           +DF  YQ K++AL+ SSF+  + +DAD+FP++ L+S+F+ E  +  GLVLWPD WRR T 
Sbjct: 208 WDFERYQIKAVALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWPDLWRRATA 267

Query: 312 PLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGV----PFHDLEGTMPDVSTES 367
           P++Y +A + V+L+ RVRN  D+L+P   YT+   D   +    PFHD  GT+PD +TES
Sbjct: 268 PVFYRLANIDVDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGTVPDPTTES 327

Query: 368 GQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVK 427
           GQ++++K +H  T+LLALYYNV GP WYY +FSQ  AGEGDKETF  AA+  GLPFYQVK
Sbjct: 328 GQMVIDKVRHFQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVLGLPFYQVK 387

Query: 428 SSTSVDGYFE-NGE-FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISF 485
           +  + DGYF  NG+ F GVA+ Q+DCV+DY LY  A+D I          +S S  +  +
Sbjct: 388 NKLAFDGYFHPNGDGFRGVALYQHDCVEDYLLYCRARDII------KENQDSFSAYKPDY 441

Query: 486 DKSYSLEDFKNKYFREDSHND--VMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLR 543
           D      DF       + H +  VMF H++F KFDP  L+  +  +D DG HFRS+ N++
Sbjct: 442 DPE---PDFYKSLMAPEGHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNIK 498

Query: 544 KFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTH 603
           + G+FDIEL  F+  +   C D  +  F YL D        W  +C+Y+  R+ +L+ TH
Sbjct: 499 RIGNFDIELFVFEGLQKAICSDNPIR-FKYLEDKF--IHADWPKVCQYVEDRVKYLQDTH 555

Query: 604 LEAVN 608
             AV 
Sbjct: 556 DPAVG 560

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  394 bits (1012), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 211/537 (39%), Positives = 314/537 (58%), Gaps = 36/537 (6%)

Query: 93  KKFYSRVFQNIIDFSPSGATKKQYKP----ECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           +K YS +F  +    P  A K   +      C ++G   ++ DD S      Y+NL  C 
Sbjct: 37  EKVYSDLFSALEKHKPIDAPKNMREAVKQQGCNMKGVGVNKGDDVSP---TVYENLDACF 93

Query: 149 NLSGADISNLRHSHKSFVDSLDVTLPSNSYKG---------SGIVTVGGGKFSLMAFLIV 199
             S A    L+  H +++ +L  T    +  G          G VTVGGG+FSL+++ ++
Sbjct: 94  RPSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPNDKGFVTVGGGRFSLLSYTMI 153

Query: 200 QNIRRMGTTLPVEVFIPP-NEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQ 258
           + +R  G+TLP+EV IPP +E  E  FC E+LPK N +C+F    LP  +++ + F+ YQ
Sbjct: 154 RTMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPSIVEDWKFKSYQ 213

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
            K +AL+ SSF+  + +DAD+ P+K L+ +F  + FK  GLVLWPD WRR T P++Y +A
Sbjct: 214 IKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMTAPVFYRLA 273

Query: 319 GVPVNLKNRVRNSFDDLTPPEVY-TENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKH 377
            +  +L  RVRN  DD++P   Y   N  +   +PFHD  GT+PD +TESGQ++++K +H
Sbjct: 274 NIDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQMVIDKVRH 333

Query: 378 LGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE 437
             T+LLALYYNV GP WYY +FSQ  AGEGDKETF +AA+   LP+YQV++  S DGY +
Sbjct: 334 FQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTKLSFDGYSD 393

Query: 438 --NGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLE-DF 494
             +G F GVA+ Q+DC QDY+ Y+ A++ +           S   K  +F + Y  E DF
Sbjct: 394 PKDGGFRGVALYQHDCTQDYETYEQARELV----------KSQPDKYSAFKEDYDSEPDF 443

Query: 495 KNKYFREDSHN--DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIEL 552
                + +     +VMF H++F KFDP  L+K +  +++DG  FRS+  L +   FDIEL
Sbjct: 444 YQSLMKPEGKPEVEVMFAHASFHKFDPWQLFKEKVYLNEDGTQFRSFRRLHRIKHFDIEL 503

Query: 553 ENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNK 609
            NF++ +   C +Q +  F Y  D  ++    W  +C+Y+  R+ +L+KTH EAV K
Sbjct: 504 FNFEVLEEAMCSEQPIR-FRYFEDKFKR--EEWPKVCQYVKDRVEYLKKTHDEAVKK 557

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  394 bits (1013), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 212/540 (39%), Positives = 322/540 (59%), Gaps = 31/540 (5%)

Query: 91  KLKKFYSRVFQNIIDFSPSGATKK----QYKPECRLEGDIGSRPDDYSNFDRLGYDNLVN 146
           +++ FY  +F +I  + P          + K +C+  GDI    D     +RL  +NL  
Sbjct: 56  QVEAFYLDLFNSINQYRPLNPPGNWEDLRDKDKCKWSGDISVNDDGRDANERLSMENLDE 115

Query: 147 CLNLSGADISNLRHSHKSFV-------DSLDVTLPSNSYKGS-GIVTVGGGKFSLMAFLI 198
           C  LS   ++NL+ +H  +V       D  +  L ++ +  + GIVT+GGG+++++   +
Sbjct: 116 CFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNVGIVTIGGGRYTVLLMTM 175

Query: 199 VQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQ 258
           +  +R  GT+LP+EV IPP +  + +FC  +LPK+N KC+F   +LPDE+ +K   + YQ
Sbjct: 176 IAKLRDTGTSLPIEVIIPPEDEGDDDFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSYQ 235

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
            K LA++ SSF+  L LDADN+ +K L+ IF  EPF   GL++WPD+WRR T P YY IA
Sbjct: 236 IKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKIA 295

Query: 319 GVPVNLKNRVRNSFDDLTPPEVYTENMND----LSGVPFHDLEGTMPDVSTESGQLMVNK 374
            + ++ K R+RN  DD+TPP  Y   + D    L  VP HDLEGT+PD ++ESGQ++++K
Sbjct: 296 DINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVIDK 355

Query: 375 NKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
            KH  T+LL+LYYN+ GP+WYY IFSQ  +G+GDKETFIAAA+    P+YQV +S  + G
Sbjct: 356 VKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLKG 415

Query: 435 YFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDF 494
           +F   EF G+ +LQ D  QDY  +Q+ K  I              ++   F + Y + D 
Sbjct: 416 FFYENEFRGIGLLQRDFQQDYAQHQLVKQTI----------QDHLEEYSEFKEDYKVADE 465

Query: 495 KNKYFREDSHN---DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIE 551
            NK      +    DVMF+H++F K++P  L+  R+ V+ DG HFR +++L++F  FD+E
Sbjct: 466 FNKKLMIPPNGQPLDVMFVHASFYKYEPWDLYNERRYVNSDGTHFRGFSDLKEFNYFDME 525

Query: 552 LENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKKD 611
           L NFKI ++  C   K   F +  D +      W++MC Y+   + FL++TH EAV K++
Sbjct: 526 LFNFKILRDTLCSPNKKVEFKFYNDKV--FSPEWDNMCTYLKDHVNFLQETHSEAVAKEE 583

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  391 bits (1005), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 210/536 (39%), Positives = 316/536 (58%), Gaps = 41/536 (7%)

Query: 95  FYSRVFQNIIDFSPSGAT----KKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           FY+ +F  I    P   +    K+  + EC+LE DI    +   +  R+ +++L+NCL++
Sbjct: 76  FYTFMFSAIARGKPVNPSVKDLKQSKRSECKLESDISMTDNSPGSLSRVSFNSLLNCLSI 135

Query: 151 SGADISNLRHSHKSFVDSLDVTLPSNSY---------KGSGIVTVGGGKFSLMAFLIVQN 201
           S   + NL++ H +F+  L+  +   +           G GIVT+GGGKFS++A  +++ 
Sbjct: 136 SRPQLDNLKYVHSNFIQLLEAKMSELTKPEFLDQIFPNGRGIVTIGGGKFSVLAMNVIKV 195

Query: 202 IRRMGTTLPVEVFIPP-NEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFK 260
           +R+ G+TLPVEV IPP +E  E +FC   LP YNAKC+F   +LP    +    +GYQ K
Sbjct: 196 LRKTGSTLPVEVVIPPQDEKNEVDFCNNFLPNYNAKCVFFKDVLPKHYAENLRLKGYQIK 255

Query: 261 SLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGV 320
            +AL+ SSF+  + LD+DN+P+K L+ +F+ + +K  GL+LWPD WRR T P+YYDIA V
Sbjct: 256 VMALLISSFKEIIFLDSDNYPLKSLDHVFDADIYKEAGLILWPDIWRRVTNPMYYDIANV 315

Query: 321 PVNLKNRVRNSFDDLTPPEVYT---------ENMNDLSGVPFHDLEGTMPDVSTESGQLM 371
            V++  RVR   DD++PP  YT         + + + + +PFHDL GT+PD STESGQ++
Sbjct: 316 SVDINQRVRYGTDDISPPNRYTIPRVHKNNEKEIENKNTIPFHDLLGTVPDASTESGQMI 375

Query: 372 VNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTS 431
           VNK KHL T+LLA YYN  GP WYY +FSQ  AGEGDKETFI+AA+    P+YQVKS   
Sbjct: 376 VNKAKHLDTLLLAAYYNFYGPAWYYRLFSQGTAGEGDKETFISAAHTLNKPYYQVKSKVG 435

Query: 432 VDGYFENG-EFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYS 490
            DG++++   F G+ +LQ+D +QDY+ Y  AK+ +   Y               F   Y+
Sbjct: 436 FDGFWDSKLGFQGIMLLQHDFIQDYEHYSKAKNQVIDHY----------DDYYHFKSDYN 485

Query: 491 LE-DFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDG-NHFRSYTNLRKFGDF 548
           L+ DF +    E   + +MF H++F K++P  L+  R+ +D +   H R   ++ +  DF
Sbjct: 486 LDRDFYDNLIHEKDIS-IMFGHTSFFKYEPWVLYHERRYIDHETQQHVRGLRSIGRALDF 544

Query: 549 DIELENFKIFKNFFC---GDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEK 601
           D+EL  F       C    + K S     Y  ++ TP  W+ MCEY++ R+ +L+K
Sbjct: 545 DLELFCFDNLLQTLCKGNANDKSSIRFAFYKDIQGTPL-WDSMCEYLDNRVSYLQK 599

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  389 bits (998), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/542 (40%), Positives = 315/542 (58%), Gaps = 41/542 (7%)

Query: 93  KKFYSRVFQNIIDFSPSGATKK---QYKPECRLEGDIGSRPDDYSNFDRL--GYDNLVNC 147
           K FY ++F  +    P    K    + + +C L+ DI S     S  D L   Y++L NC
Sbjct: 78  KDFYYKLFDALAASKPVRPPKDANFRDEDKCNLK-DIASYS---SKEDHLLTSYESLSNC 133

Query: 148 LNLSGADISNLRHSHKSFVDSLDVTLP-SNSYKGS------GIVTVGGGKFSLMAFLIVQ 200
            NL+ +   +L +SH+ F + ++ +   SNS   S      GIV +GGGKFS+    +++
Sbjct: 134 YNLTQSQYDDLHNSHELFTEHVEKSFQLSNSAAKSMWPNDKGIVAIGGGKFSVYILSMIK 193

Query: 201 NIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFR--GYQ 258
            +R  GT LPVE+ +P     + EFC + LP  NAKC++   +LP E   K+  +   +Q
Sbjct: 194 TLRAKGTHLPVEILMPLASPEDKEFCDKFLPPLNAKCVYFKDVLPKEFTGKYPIKISRFQ 253

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
           +K  +++ SSF N + +D+DN  +K L+ +F+   ++  GL+LWPD WRR T P+YY +A
Sbjct: 254 YKVFSILFSSFRNVMYIDSDNLALKSLDKVFDTVAYRENGLILWPDIWRRVTAPIYYSVA 313

Query: 319 GVPVNLKNRVRNSFDDLTPPEVY--TENMND---LSGVPFHDLEGTMPDVSTESGQLMVN 373
           GVP NL+ RVRN  DDL+P   Y   EN  +      VPFHD EGT+PD++TESGQL+V+
Sbjct: 314 GVPYNLEKRVRNMVDDLSPVSRYDNVENPGNDYRTRKVPFHDFEGTLPDLTTESGQLVVD 373

Query: 374 KNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVD 433
           K +H  T+LLA YYN  GP WYY IFSQ  AGEGDKETFIAAA+ +GLP+YQVK++   D
Sbjct: 374 KVRHFKTLLLATYYNFYGPDWYYRIFSQGGAGEGDKETFIAAAHKFGLPYYQVKTNLKFD 433

Query: 434 GYFENGE-FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLE 492
           GY +  E F G+ + Q+D  QDYK YQ AK  +   Y           K   +D  YS E
Sbjct: 434 GYNDAKEGFRGIGLYQHDFDQDYKQYQAAKSYVSRNYA----------KLSQYDPEYSSE 483

Query: 493 DFKNKYFREDSHN---DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFD 549
               K   + S+    D MF+H +F KFDP  L K ++ + +DG HFR +        +D
Sbjct: 484 KSFEKELMKPSNGKDIDAMFVHVSFYKFDPFVLAKEKRYM-RDGKHFRGFGRFELLKGWD 542

Query: 550 IELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNK 609
           +EL+ F +F++ FC D  +  FSY    + +    W DMC Y++ R+ FLE+TH EAV  
Sbjct: 543 LELDTFTLFRDTFCSDNVIE-FSYYKPKMSQPE--WKDMCNYLSSRVAFLEETHEEAVKP 599

Query: 610 KD 611
           KD
Sbjct: 600 KD 601

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  381 bits (979), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/545 (40%), Positives = 316/545 (57%), Gaps = 49/545 (8%)

Query: 94  KFYSRVFQNIIDFSPSGATKKQYKPECRLEG----DIGSRPDDYSNFDRLGYDNLVNCLN 149
           + YS++F  +  + P    K   K   R  G    D+G   D  S F  L Y+NL  C N
Sbjct: 88  ELYSKLFGYLQRYKPVAPPKD--KAALRQSGCVMRDVGLADD--SRFSNLAYNNLDRCYN 143

Query: 150 LSGADISNLRHSHKSFVDSL-------------DVTLPSNSYKGSGIVTVGGGKFSLMAF 196
           LS     +L  +H  +V  L             D   P+      GIVTVGGG+FSL++ 
Sbjct: 144 LSPEQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKLFPNEK----GIVTVGGGRFSLLSL 199

Query: 197 LIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRG 256
            +++ +R  GTTLPVEV IPP +  E +FC  +LP  N  C++   +L    + +  F  
Sbjct: 200 TMIRVLRERGTTLPVEVVIPPADEGEDDFCNNVLPALNGTCVYFSDVLSKSTLNQVTFER 259

Query: 257 YQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYD 316
           YQ K +AL+ SSF+NT+ LDADNF +KPL++IF  E +   GLVLWPD WRR T P++Y+
Sbjct: 260 YQIKGVALLLSSFKNTIFLDADNFAIKPLDNIFESEAYLEHGLVLWPDLWRRVTAPVFYN 319

Query: 317 IAGVPVNLKNRVRNSFDDLTPPEVYTENMNDL----SGVPFHDLEGTMPDVSTESGQLMV 372
           ++ V ++L  R R   DD+TP   Y +   DL    + VP HDL+G +PD S+ESGQ++V
Sbjct: 320 VSDVELDLTKRARFIGDDVTPASKYHKPDADLAYNKAEVPLHDLDGAIPDPSSESGQMIV 379

Query: 373 NKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSV 432
           +K +H  T+LLALYYN  GP WYY +FSQ  +GEGDKETF+AAA+    P+YQVKS    
Sbjct: 380 DKREHFQTLLLALYYNYYGPDWYYRMFSQGTSGEGDKETFVAAAHVLSKPYYQVKSKLGF 439

Query: 433 DGYFE---NGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSY 489
            GY++   +G F G A+LQ+D VQDY  ++ A + +   Y           +   FD +Y
Sbjct: 440 AGYWDEYTDGGFKGAALLQHDFVQDYGQHKKALEVVRSNY----------DEYTRFDPNY 489

Query: 490 SLE-DFKNKYFRED--SHNDVMFIHSNFPKFDPLSLWKNRQLVDKDG-NHFRSYTNLRKF 545
           + E DF  K    D     DVMF+H++F KFDP  L++ +  +  DG + FRSY +L++ 
Sbjct: 490 NSEKDFYKKLMVPDGKEETDVMFVHASFHKFDPWDLYRRKTYLKPDGKSQFRSYRDLKRL 549

Query: 546 GDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLE 605
           G FD+EL NF++ ++  C  +++  F YL D +  T   W  MCEY++ R+ FL++TH E
Sbjct: 550 GGFDLELFNFEVLEDALCAGKQIG-FKYLQDKV--TSQEWPGMCEYVHDRVQFLKETHAE 606

Query: 606 AVNKK 610
           A+  K
Sbjct: 607 ALGPK 611

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  381 bits (979), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/536 (40%), Positives = 312/536 (58%), Gaps = 41/536 (7%)

Query: 95  FYSRVFQNIIDFSPSGATKKQ---YKPE-CRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           FY ++F  I    P    K +   Y+ E C+++ D+ S  D   NF  L Y NL  C  L
Sbjct: 99  FYYKLFNAISKARPVTPPKDKMAAYRKEGCKIK-DVASY-DKKENFSLLSYSNLDECFKL 156

Query: 151 SGADISNLRHSHKSFVDSLDVTL----PSNSYK----GSGIVTVGGGKFSLMAFLIVQNI 202
           S +   +L+ +H+ FV+ +D  +    P+   +      GIV VGGGKFS+++   ++ I
Sbjct: 157 SDSQTKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGGGKFSIISINTIKAI 216

Query: 203 RRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSL 262
           R  G+TLP+EV IP +  PE E+C   LP +NAKC+++D  LP+E  ++   + YQ+KS 
Sbjct: 217 RERGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLPNEFKERLTLKKYQYKSF 276

Query: 263 ALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPV 322
           AL+ SSF+N L +DADN P+  L++IF+ + +K  GL+ WPD WRR T P YY IA +  
Sbjct: 277 ALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRRVTAPAYYKIANINY 336

Query: 323 NLKNRVRNSFDDLTPPEVYTENMN-----DLSGVPFHDLEGTMPDVSTESGQLMVNKNKH 377
           NL NRVR   DD+TP   Y   +N      L   PFHD EGT+PD+++ESGQLMVNK  H
Sbjct: 337 NLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDLTSESGQLMVNKETH 396

Query: 378 LGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE 437
             T+LLA YYN  GP WYY IFSQ  +GEGDKETF+AAA+  G P+YQVKS+   DGYF+
Sbjct: 397 FRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPYYQVKSTIEFDGYFD 456

Query: 438 NGE-FHGVAMLQYDCVQDYKLYQIAKDDI--DVKYGLSRVGNSASQKRISFDKSYSLEDF 494
           + + F G+ + Q D  +DY+ Y  AK  +  D KYG              ++ +Y  +  
Sbjct: 457 HKDGFQGIGLYQKDFNKDYENYLAAKAKVEKDKKYG-------------EYNPNYDFDAD 503

Query: 495 KNKYFREDSHNDV--MFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIEL 552
             K       N+V  MFIH +F KFDP +L KN++ + + G  +R ++  +   ++D+EL
Sbjct: 504 FEKALMNPPGNEVEAMFIHVSFHKFDPHNLAKNKRYILQ-GKQYRVFSKFKNLRNWDLEL 562

Query: 553 ENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVN 608
           E  +    + C D  V +    Y  L+   + W DMC Y+++R+ +L  TH  A++
Sbjct: 563 EANRNMHFYLCTDNAVEFI--FYKDLQGKDS-WKDMCNYLSERVEYLASTHDAALS 615

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  370 bits (951), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/547 (38%), Positives = 313/547 (57%), Gaps = 45/547 (8%)

Query: 95  FYSRVFQNIIDFSPSGAT---KKQYKPE-CRLEGDIGSRPDDYSNFDRLGYDNLVNCLNL 150
           FY+ + Q I++  P+ ++    K +  E C    ++ +   D  +   L Y++L  C NL
Sbjct: 55  FYTTLVQAIVENKPADSSPDLSKLHGAEGCSFANNVAAH--DSGHDSDLSYESLSKCYNL 112

Query: 151 SGADISNLRHSHKSFVDSL----DVTLPSNS--YKGS-GIVTVGGGKFSLMAFLIVQNIR 203
           +     +LR  H  F D+L    + ++P     + GS GIVT+GGGK+S++A+ +++ +R
Sbjct: 113 NKTVQESLREVHSKFTDTLSGKLNFSIPQREALFSGSEGIVTIGGGKYSVLAYTMIKKLR 172

Query: 204 RMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLA 263
             GTTLP+EV IPP +  E +FC   LPK+N KCI+   I+P + +       +Q K   
Sbjct: 173 DTGTTLPIEVIIPPQDEGEDDFCKNWLPKFNGKCIYFSDIVPSKPLSDLKLTHFQLKVFG 232

Query: 264 LVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVN 323
           L+ SSF+  + LDADN+ VK L+  FN   F   GL+LWPDFWRR T P +Y+I G  +N
Sbjct: 233 LIISSFKRIIFLDADNYAVKNLDLAFNTTSFNDTGLILWPDFWRRVTPPAFYNIIGSSIN 292

Query: 324 LKNRVRNSFDDLTPPEVY---TENMND----------LSGVPFHDLEGTMPDVSTESGQL 370
           +  RVR   DD++P   Y     N ND          L  VP HDL+GTMPD+S+ESGQ+
Sbjct: 293 IGKRVRFVSDDISPVSRYDPFVSNSNDYTPKERQEHFLKHVPLHDLDGTMPDLSSESGQM 352

Query: 371 MVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSST 430
           +++K +H  T+LLALYYNV GPTWYY + SQ  AGEGDK+TF+AAA+   +P+YQV+++ 
Sbjct: 353 VIDKIRHFNTLLLALYYNVYGPTWYYKMISQGTAGEGDKDTFVAAAHALNMPYYQVRTNF 412

Query: 431 SVDGYF-ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSY 489
             DG+F +  ++ G+A+LQ+D  QDYK YQ A+  +              ++    D  Y
Sbjct: 413 EFDGFFYQKDDYKGLALLQHDFEQDYKQYQKAQQKVKANI----------EEFSKLDPDY 462

Query: 490 SLED--FKNKYFREDSHN-DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFG 546
           +L++   K     +D  + D+MFIH++F K DP +L+   + +  +G   R +    ++G
Sbjct: 463 TLDNGFLKTLMVNDDGSDLDIMFIHASFYKADPWTLYHENRFIGPNGEQVRGFRKPHRYG 522

Query: 547 DFDIELENFKIFKNFFCGDQK--VSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHL 604
             D EL  F   +  FC   K  V  F Y  D +  TP  W+ MCEY+   + +LE TH 
Sbjct: 523 -MDFELFLFNDMRGSFCTTPKSQVIKFKYFTDKVN-TPE-WDAMCEYLTNHVNYLESTHK 579

Query: 605 EAVNKKD 611
           EA+ +K+
Sbjct: 580 EAMGEKN 586

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  367 bits (942), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 201/544 (36%), Positives = 302/544 (55%), Gaps = 37/544 (6%)

Query: 94  KFYSRVFQNIIDFSPSGA----TKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           KFYS +   I+   P G+     K      C   G++ +   +  +   L Y++L  C  
Sbjct: 54  KFYSVLVDAIVQCKPMGSPPDLAKLHDAEGCTFAGNVAAHTSERDS--ELSYESLNKCYR 111

Query: 150 LSGADISNLRHSHKSFVDSLDVTLPSNSYK-------GSGIVTVGGGKFSLMAFLIVQNI 202
           L+      L   H  F D L   L  +  +         GIVT+GGGK+S++A+ +++ +
Sbjct: 112 LNTTVQEGLTAMHNKFTDILSGKLNFSFAQREALFPESEGIVTIGGGKYSVLAYTMIKKL 171

Query: 203 RRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSL 262
           R  GTTLP+EV IPP +  + +FC   LPK+N KCI+   I+P + ++  +   +Q K  
Sbjct: 172 RETGTTLPIEVIIPPQDEGDDDFCKNWLPKHNGKCIYFSDIVPAKSLRDLELTHFQLKVF 231

Query: 263 ALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPV 322
            L+ S+F+  + +DADN+ VK L+  FN   F+  GL+LWPDFWRR T P++Y+I G  +
Sbjct: 232 GLIISNFKRIIFIDADNYAVKNLDLAFNTTSFEDTGLILWPDFWRRVTPPVFYNIIGSTI 291

Query: 323 NLKNRVRNSFDDLTPPEVYTENMND-------------LSGVPFHDLEGTMPDVSTESGQ 369
           N   RVR   DD++P   Y   ++D             L  VP HD++GTMPD++TESGQ
Sbjct: 292 NTGKRVRFVSDDVSPVSRYDPFVSDSKDYNPEEIQNHFLRHVPLHDMDGTMPDLTTESGQ 351

Query: 370 LMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSS 429
           ++++K +H  T+LLALYYNV GPTWYY + SQ  AGEGDKETFIAAA+   +P+YQVK+ 
Sbjct: 352 MVIDKIRHFHTLLLALYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNVPYYQVKTK 411

Query: 430 TSVDG-YFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKS 488
              DG Y++  +F G+A+LQ+D  QDY+ YQ A+  +    G      S      + DK 
Sbjct: 412 FEFDGFYYKKDDFKGLALLQHDFEQDYRHYQTAQQKVKANIG----EFSKLNPEYTLDKG 467

Query: 489 YSLEDFKNKYFREDSHN-DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGD 547
           +     KN    +D  + D+MFIH++F K DP +L+  ++ +  DG   R +  L ++G 
Sbjct: 468 F----LKNLMLNDDGSDLDIMFIHASFYKADPWNLYHEKRFIGPDGKQLRGFKKLGRYG- 522

Query: 548 FDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAV 607
            D EL  F   K  FC   K     + Y   + T   W+ MC+Y+   + +LE+TH +A+
Sbjct: 523 MDFELFLFDDMKKSFCTTPKNQVLRFKYFEDKITTPEWDAMCKYLADHVDYLERTHKDAM 582

Query: 608 NKKD 611
             K+
Sbjct: 583 LGKE 586

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  361 bits (927), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/549 (37%), Positives = 303/549 (55%), Gaps = 45/549 (8%)

Query: 93  KKFYSRVFQNIIDFSPSGA----TKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           K FY+ + Q I+   P+G+     K      C    ++ +   D      L Y++L  C 
Sbjct: 53  KNFYTALIQAIVQAKPAGSPPDLNKLHNAEGCTFADNVAAH--DSGRDGDLSYESLSKCY 110

Query: 149 NLSGADISNLRHSHKSFVD----SLDVTLPSNSY---KGSGIVTVGGGKFSLMAFLIVQN 201
            L      NL   H  F D     L+ ++P       +  GIVT+GGGK+S++A+ +++N
Sbjct: 111 RLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKYSVLAYTMIKN 170

Query: 202 IRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKS 261
           +R+ GTTLP+EV IPP +  + EFC   LP +N +C++   I+P + +       +Q K 
Sbjct: 171 LRKTGTTLPIEVIIPPQDEGDDEFCNNWLPNFNGRCLYFSDIVPPKPLGDLKLTHFQLKV 230

Query: 262 LALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVP 321
             L+ S+F+  + +DADN+ VK L+  FN   F+  GL+LWPD+WRR T P +Y+I G  
Sbjct: 231 FGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLILWPDYWRRVTPPAFYNIIGSS 290

Query: 322 VNLKNRVRNSFDDLTPPEVY-----------TENMND--LSGVPFHDLEGTMPDVSTESG 368
           +N   RVR   DD++P   Y           +E M D  L  VP HDL+GTM D+++ESG
Sbjct: 291 INTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDHFLRHVPLHDLDGTMSDLTSESG 350

Query: 369 QLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKS 428
           Q++++K +H  T+LLALYYNV GPTWYY I SQ  AGEGDK+TFIAAA+     +YQVK+
Sbjct: 351 QMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGEGDKDTFIAAAHALNASYYQVKT 410

Query: 429 STSVDGYF-ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDK 487
               DG+F +  ++ G+A+LQ+D  QDYK YQ A+  +           +  +K    D 
Sbjct: 411 KFEFDGFFYKKNDYKGIALLQHDFEQDYKQYQKAQQKV----------KADVEKFSKLDP 460

Query: 488 SYSLED--FKNKYFREDSHN-DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRK 544
            Y+L+    K+    ED  + D+MFIH++F K DP +L++  +  D DG   R +    +
Sbjct: 461 DYTLDKGFLKSLMLNEDGTDLDIMFIHASFYKADPWTLYRENRFTDPDGKQLRGFRKPYR 520

Query: 545 FGDFDIELENFKIFKNFFCGDQK--VSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKT 602
           +   D E+  F+  K  FC   K  V  F Y  D L  TP  W+ MC+Y+   L +LE T
Sbjct: 521 YA-MDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKLN-TPE-WDKMCQYLTNHLDYLEAT 577

Query: 603 HLEAVNKKD 611
           H E + KK+
Sbjct: 578 HNEFMEKKN 586

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  360 bits (923), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/532 (36%), Positives = 307/532 (57%), Gaps = 40/532 (7%)

Query: 93  KKFYSRVFQNIIDFSPSGAT---KKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           + FYS +FQ I D +P G       + K +CR +GDI +   D   F++  Y+NL  C +
Sbjct: 65  RNFYSALFQAIQDGTPEGQLIMDSVRDKEKCR-DGDISAFSTD---FEKSSYENLDACFH 120

Query: 150 LSGADISNLRHSHKSFVDSLDVTLPSNS------YKGSGIVTVGGGKFSLMAFLIVQNIR 203
           LS   +  L   H+ FV++++    S S         SGIVT+GG K+S+++  +++ +R
Sbjct: 121 LSDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGGSKYSVISLTMLETLR 180

Query: 204 RMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLA 263
             G+ LPVEV IPP +  + ++C  +LPK  AKC+++   LP ++++      YQ K + 
Sbjct: 181 DRGSKLPVEVMIPPGDEGDEDYCNVVLPKLGAKCVYMAEKLPPDVVKNVKIERYQNKIVG 240

Query: 264 LVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVN 323
           L+ SSF+N + +DAD  P+KPL+ +FN   +K  GL+LWPD W+R T P +Y +A +P++
Sbjct: 241 LLLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKHGLILWPDIWKRVTAPAFYKLANIPLD 300

Query: 324 LKNRVRNSFDDLTP-----PEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHL 378
           LK RVR   DD++P     P      +  L  VPFHDLEGTM D +TESGQ+++NK  HL
Sbjct: 301 LKKRVRFGADDVSPLSRYEPSSEASEVRMLKKVPFHDLEGTMSDPTTESGQMLINKVDHL 360

Query: 379 GTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFEN 438
            ++LL+ YYN++G  WYY + SQ  +GEGDKET IAAA+   LP+YQVK+    DG+ ++
Sbjct: 361 RSLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETLIAAAHALKLPYYQVKTDVRFDGFSDH 419

Query: 439 GEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKY 498
             FHG+++ Q D  QDY+ Y+ A           R       +  +++++Y   D K ++
Sbjct: 420 EGFHGISLYQQDFQQDYEAYKKA----------IRWVRRHKSELSAYEQNY---DVKKQF 466

Query: 499 FRE-----DSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELE 553
           + +     D   + +F H ++ KF+P+ L +    +D+ G HFR +        FD+E+ 
Sbjct: 467 YEKLLKPGDKEVESLFGHISYHKFEPIELAEKSIYIDEKGKHFRGFRRKEVIRHFDLEMF 526

Query: 554 NFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLE 605
           NF++ + + C +  V  F Y  D ++ TP  W  MC Y+   + +L+ TH E
Sbjct: 527 NFEVLEKYLCKENPVK-FVYYKDRMD-TPE-WERMCNYLKSHVSYLQDTHEE 575

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  360 bits (923), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 204/541 (37%), Positives = 315/541 (58%), Gaps = 36/541 (6%)

Query: 93  KKFYSRVFQNIIDFSPSGATKKQ---YKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           + FY  +F  +  F P    + +       C L  D+     D ++ + L Y     C  
Sbjct: 65  ESFYKDLFLALEKFKPPKGPEDKNSLKDKTCDLH-DVSFGSTDPTDGEYLSYAARRKCFR 123

Query: 150 LSGADISNLRHSHKSFVDSLDVTLPSNSY---------KGSGIVTVGGGKFSLMAFLIVQ 200
            S    + L+ SH  F+  ++  L  ++          K +GIVTVGGGK+S++A  +++
Sbjct: 124 PSEVSTAELKKSHLGFIKHINRHLTVDTKSALFNELFPKEAGIVTVGGGKYSILALTMLR 183

Query: 201 NIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFK 260
            +R  GT LPVEV IP  +  +  FC   + K+NA+CI + + LP+ + +  DF+ Y+ K
Sbjct: 184 ALREHGTKLPVEVLIPEGDIGDIHFC-RAIRKWNAECILLPKALPNTVSKLHDFKSYETK 242

Query: 261 SLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGV 320
             AL+ SSF++ +L+DADN P+KPL+ +F  EP+K  GL+LWPD WRR T P++Y+IA +
Sbjct: 243 LAALLLSSFKDVILIDADNIPIKPLDDVFESEPYKETGLILWPDIWRRQTAPVFYEIADI 302

Query: 321 PVNLKNRVRNSFDDLTPPEVY------TENMNDLSGVPFHDLEGTMPDVSTESGQLMVNK 374
            ++ +NR+RNS+DDL+PP  Y       +   +++ VP HDL G +PD+S+ESGQL+VNK
Sbjct: 303 DIDFRNRIRNSYDDLSPPSRYKNPDVPNDAKYNMAHVPLHDLAGAIPDLSSESGQLLVNK 362

Query: 375 NKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
            KHL T+LLALYYN  G  W+Y + S   +G+GDKETFI AA+    P+YQVK+    DG
Sbjct: 363 GKHLSTLLLALYYNYYGEQWFYQMSSLGTSGQGDKETFIFAAHALKKPYYQVKNPLLFDG 422

Query: 435 YF-ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLED 493
           YF ++G F GV +LQ+D  QDY  ++ AK+ +     ++ +G   S   ++       +D
Sbjct: 423 YFGDDGSFKGVGLLQHDFTQDYANWKKAKEYM--TENIAHLGTYNSDYNVN-------QD 473

Query: 494 FKNKYFREDSHN--DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIE 551
           FK++       +  D+MFIH++F K  P  L++ +  +DK G  FRS+ NL+    FD+E
Sbjct: 474 FKDEMLHHKDFDGVDIMFIHASFHKLIPWDLYREKIYLDKSGKQFRSFKNLKNINYFDVE 533

Query: 552 LENFKIFKNFFCGDQKVSYFSYLYDALEKTPT-GWNDMCEYINKRLVFLEKTHLEAVNKK 610
           L  F+  + + C D  +    + Y  L+ T T  +N MC YI+ R+  L +TH EA++  
Sbjct: 534 LFAFEGLQKYICSDDAI---KFEYHTLQVTSTESFNAMCAYIDDRVKMLRETHEEAISSN 590

Query: 611 D 611
           D
Sbjct: 591 D 591

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  356 bits (913), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 179/479 (37%), Positives = 282/479 (58%), Gaps = 29/479 (6%)

Query: 140 GYDNLVNCLNLSGADISNLRHSHKSFVDS----LDVTLPSNSYKG-----SGIVTVGGGK 190
            YD L  C  L    +  LR  H  F+ +    L ++  S  +K      +GIVTVGGG+
Sbjct: 101 SYDGLAKCFRLERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGR 160

Query: 191 FSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQ 250
           +S++A ++++ +R+ GTTLPVEVF+  ++  +  FC+  +  +NAKC+     LP  ++ 
Sbjct: 161 YSILAMVMIRALRKRGTTLPVEVFLTDDDADDEAFCS-YIEHFNAKCVLFSDRLPKSVLA 219

Query: 251 KFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTT 310
                G++ K++AL+ SS++  + +DADN P+KPL+ +F  +P    GLVLWPD W+R T
Sbjct: 220 SQKLSGFELKAVALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRVT 279

Query: 311 QPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYT------ENMNDLSGVPFHDLEGTMPDVS 364
            P +YDIAG+PV+ K RVR S DD++PP  YT      E+ N  + VP HD  GTMP++S
Sbjct: 280 APAFYDIAGIPVDFKRRVRFSADDVSPPSRYTKPGEVDESFNR-AHVPLHDFAGTMPELS 338

Query: 365 TESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFY 424
           +ESGQL+++K +H+ T+LL LYYNV+G   +Y + +Q  +GEGDKETF  AA   G P+Y
Sbjct: 339 SESGQLLIDKARHMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYY 398

Query: 425 QVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRIS 484
           QVK+     GY    ++ G A+LQ+D VQD++ +  A++++  +            +  +
Sbjct: 399 QVKTKLRFQGYHTPSQYVGAALLQHDFVQDHEQWLRAREEVARR----------PSELAA 448

Query: 485 FDKSYSL-EDFKNKYFREDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLR 543
           ++ +Y++ E F N   R +   DVMF+H+++ K  P+ L++ +  + +DG  FRS+ +L 
Sbjct: 449 YNPAYNVDEHFYNTLMRPEKPLDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLA 508

Query: 544 KFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKT 602
              +FDIEL   +I     C       F Y  D + K+P  + DMC Y+  R+  L  T
Sbjct: 509 AMDNFDIELFAIQILNEAICSATTKIEFKYNRDKI-KSPEEFEDMCTYVRDRMRMLLDT 566

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  352 bits (902), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 192/508 (37%), Positives = 298/508 (58%), Gaps = 34/508 (6%)

Query: 119 ECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTLPSNSY 178
           EC + GD+G   D     +RL YDNL  CL L  ++ ++L++ H+ FV  L     S S 
Sbjct: 98  ECDM-GDVGF--DSNGRDERLSYDNLAKCLQLPESNYNSLKNGHEKFVKYLSTVDTSASQ 154

Query: 179 ------KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPK 232
                    GIVTVGG ++SL+++L++  +RR G+ LP+EV IPP++ PETEFC  +L +
Sbjct: 155 LEQIYATKRGIVTVGGRRYSLLSYLMINMVRRSGSKLPIEVVIPPDDEPETEFCESIL-Q 213

Query: 233 YNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
           +NA+CI+    LP  ++     + YQ K +AL+ SSF+  +L+D+DN P+K ++ +F+  
Sbjct: 214 FNARCIYFKDRLPTSLLANLSVKSYQVKGIALLLSSFQEFVLIDSDNMPLKNIDEVFDYN 273

Query: 293 PFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLS--- 349
            F+  G+V+WPD WRR T P +Y +A VP++   RVRN+ D+L+P   Y +  N +S   
Sbjct: 274 VFRDHGMVIWPDIWRRMTSPQFYQLAEVPIDFTKRVRNAGDELSPVSRYDKLENTVSENK 333

Query: 350 -GVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGD 408
             VP HD  GT+PD +TESGQ++VNK  HL  +LLALYYN  GP +YY +FSQ  +G+GD
Sbjct: 334 AKVPMHDFLGTLPDPTTESGQMIVNKKTHLKMLLLALYYNQYGPEYYYQLFSQGTSGQGD 393

Query: 409 KETFIAAANFYGLPFYQVKSSTSVDGYFE----NGEFHGVAMLQYDCVQDYKLYQIAKDD 464
           KETF  AA+    PFYQVK +     Y +      EF G  +LQ+D  QDY+ + I K +
Sbjct: 394 KETFAMAAHILKEPFYQVKKTFGFAAYMDPREGKSEFQGAGLLQHDPEQDYRYWNILKTE 453

Query: 465 IDVKYGLSRVGNSASQKRISFDKSYSLED-FKNKYFRE--DSHNDVMFIHSNFPKFDPLS 521
           I+             +K  +FD+ Y ++  F +K   +  D   + +F+H+++ K+DP +
Sbjct: 454 IE----------GQQEKYGTFDEDYHIKKTFYDKMLGKVGDQPREHLFLHASYHKYDPWN 503

Query: 522 LWKNRQLVDKDGNHFRSY-TNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEK 580
           L+  + L+  DG  FR+Y  +   F  FD+EL  ++I     C +  V   +Y+ D L++
Sbjct: 504 LYNEKNLMHSDGKQFRAYPCSSTAFKGFDVELFLWEIVNKIVCSENPVK-MAYI-DKLKE 561

Query: 581 TPTGWNDMCEYINKRLVFLEKTHLEAVN 608
               +  +C++   R+  L +TH E V+
Sbjct: 562 DTDKFKAVCQFTKDRVNHLNETHDEYVS 589

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/516 (38%), Positives = 290/516 (56%), Gaps = 51/516 (9%)

Query: 120 CRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-----DVTLP 174
           C  +GD+ S   D   F      NL  CLNL    I  L  +H  ++ +L     +  + 
Sbjct: 96  CPKKGDVSSGGID--QFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAIS 153

Query: 175 SNSYKG-----SGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTEL 229
            + +K       GIVT+GGG+++++A L+++ +RR G+TLPVEV  PP +  E +FC   
Sbjct: 154 KSDFKKLYPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNNW 213

Query: 230 LPKYNAKCIFIDRILPDEMIQK---FDFRGYQFKSLALVASSFENTLLLDADNFPVKPLN 286
           LPK+N +C+ + + +P E++QK     F+ YQ KSLAL+ +SF+  + +DADN  +K ++
Sbjct: 214 LPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNID 273

Query: 287 SIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTEN-- 344
            IF+ E FK+ GL+LWPD W+R T P +YDIAGV  +L  RVRN  DD +PPE Y  N  
Sbjct: 274 HIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNHS 333

Query: 345 ---MNDL-----------SGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
               +DL             V   DL+GT+ D +TESGQ+MV+  KHL T+LLALYYN+ 
Sbjct: 334 IYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNIY 393

Query: 391 GPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFE--NGEFHGVAMLQ 448
           GP  YY + S   AGEGDKETFI+AA+   LP+YQVK++   DGY    + +F GV ++Q
Sbjct: 394 GPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLMQ 453

Query: 449 YDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLED-FKNKYFREDSHN-D 506
            D  QDY+ ++    ++  +  L  V              Y L + F++K    D  + D
Sbjct: 454 TDFEQDYQRHKQVLKELATEKPLEPV-------------KYQLPNHFQDKMKNPDGTSLD 500

Query: 507 VMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQ 566
           +MF+H++F KFDP  L K++Q   ++G   R Y  +  + +FD EL +FK   +  C   
Sbjct: 501 IMFLHASFHKFDPADLAKSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSD 560

Query: 567 KVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKT 602
            +S+ S       +    W  MC Y  +R+ FL KT
Sbjct: 561 HISFKSL---KKHEGTEFWTSMCSYFKQRVDFLTKT 593

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  343 bits (879), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/525 (37%), Positives = 294/525 (56%), Gaps = 55/525 (10%)

Query: 120 CRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVD----SLDVTLPS 175
           C    ++ +   D ++ D L Y++L  C  L+   ++NL   H  F D     L+ ++P 
Sbjct: 84  CEFADNVAAH--DTTHDDNLSYESLSRCYKLNRTLLANLAEMHNEFTDILLGKLNYSIPQ 141

Query: 176 NSY---KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPK 232
                 +  GIVT+GGGK+S++A  +++ +R  GTTLP+EV IPP +  + +FC   LP+
Sbjct: 142 REALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKNWLPR 201

Query: 233 YNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
            N KC++   I+P + ++  +   +Q K   L+ S+F+  + +DADN+PV  L+ +FN  
Sbjct: 202 QNGKCLYFSDIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDADNYPVTNLDLVFNTT 261

Query: 293 PFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVY----------- 341
            F+  GL++WPD WRR T P +Y+I G  +N   RVR   DD++P   Y           
Sbjct: 262 SFQDTGLIMWPDLWRRVTPPAFYNIIGSTINTSKRVRFVSDDVSPVSRYDPFVSKSKEYT 321

Query: 342 TENMND--LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIF 399
           +E M D  L  VP HD++G MPD+++ESGQ++++K +H  T+LLALYYNV GPTWYY + 
Sbjct: 322 SEEMQDHFLRHVPLHDMDGAMPDLTSESGQMVIDKVRHFHTLLLALYYNVYGPTWYYKML 381

Query: 400 SQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYF-ENGEFHGVAMLQYDCVQDYKLY 458
           SQ  AGEGDKETFIAAA+    P+YQVK+    DG+F + G++ G+A+LQ++  QDYK Y
Sbjct: 382 SQGTAGEGDKETFIAAAHALNAPYYQVKTKFEFDGFFYKEGDYKGLALLQHNFEQDYKQY 441

Query: 459 QIAK----------DDIDVKYGLSRVGNSASQKRISFDKSYSLEDFKNKYFREDSHNDVM 508
           Q AK            +DV Y L             F KS  L D       + S  D+M
Sbjct: 442 QKAKKKVKANIDQFSQLDVDYSLDG----------GFLKSLMLND-------DGSDLDIM 484

Query: 509 FIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFC--GDQ 566
           FIH+++ K DP +L+   + +  DG   R +   +++   D EL  F   K  FC     
Sbjct: 485 FIHASYYKADPWNLYHENRFIGPDGEQLRGFRKPQRYA-MDFELFLFDDMKESFCTPAKD 543

Query: 567 KVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHLEAVNKKD 611
           KV  F Y  D +  TP  W+ MC+Y+   + +L+ TH E + KK+
Sbjct: 544 KVIKFKYFEDKI-NTP-DWDKMCKYLADHVDYLQSTHKEIMEKKN 586

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  340 bits (871), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 193/510 (37%), Positives = 294/510 (57%), Gaps = 36/510 (7%)

Query: 108 PSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVD 167
           P   T  + +  C+L   + +   +    + + YD+L  C+++    + +L   H  FV 
Sbjct: 132 PEDFTAFKDEARCKLRDPMFASDGEREKLEAVSYDSLDGCMHVPDQYLESLTKMHTKFVG 191

Query: 168 SLDVTLPSNSYK----GSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGP-E 222
           ++     S   +     SGIV VGGG++S++   ++  +R+  T+LPVE+FIP  +   +
Sbjct: 192 TIKSISSSTVRQLYPEDSGIVAVGGGRYSVLLATMLPKLRKNCTSLPVEIFIPDEDAAGD 251

Query: 223 TEFCTELLPKYNAKCIFIDRILPDEMIQKFDFR--GYQFKSLALVASSFENTLLLDADNF 280
             FC    P+YNAKCI+   I     + K D +   +Q+K +A++ SSF+N L LDADN+
Sbjct: 252 ASFCQVFAPRYNAKCIYAKAI-----VGKIDIKLERFQYKPVAILLSSFKNVLFLDADNY 306

Query: 281 PVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEV 340
            +K ++ IF+ E +   GL++WPD W+R T P +Y IAG+  +L  RVR   D+++P   
Sbjct: 307 VMKNIDKIFSAESYHDTGLIIWPDIWKRCTSPSFYKIAGINFDLTKRVRWGGDEISPVSR 366

Query: 341 YTENMND-----LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWY 395
           YT    +      + VPFHDL+G MPD S+ESGQL++NK KH+ T+LLALYYNV G  WY
Sbjct: 367 YTSAEQNSPEYLKTKVPFHDLDGPMPDSSSESGQLLINKVKHMDTLLLALYYNVYGKQWY 426

Query: 396 YPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDY 455
           +P+ SQ+  GEGDKE++I+AA     P YQVK+     GYF + EF+GV +LQ+D  QDY
Sbjct: 427 FPLASQRGPGEGDKESYISAAYALKKPVYQVKTPLEFSGYFTD-EFNGVGLLQHDFEQDY 485

Query: 456 KLYQIAKDDIDVKYGLSRVGNSASQKRISF-DKSYSL-EDFKNKYFR--EDSHNDVMFIH 511
           +LY+ A++ +           +A+Q R  F D  Y+    F  ++F   E +H+DVMFIH
Sbjct: 486 QLYKKAEELV-----------AANQIRYGFYDPEYTYSSSFLKEFFHVGESAHSDVMFIH 534

Query: 512 SNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYF 571
           ++F KFDP  L +N +   + G   R ++   +    D ELE F++ K  FC D+ V Y 
Sbjct: 535 ASFFKFDPWELSQNERFTYR-GKQVRGFSLRDRINGEDFELEVFELMKEAFCIDKTVKY- 592

Query: 572 SYLYDALEKTPTGWNDMCEYINKRLVFLEK 601
            YL     K+   W   C YI+K +VFL++
Sbjct: 593 GYLEKKF-KSKEDWEKACSYIDKHIVFLKR 621

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  333 bits (854), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 215/588 (36%), Positives = 325/588 (55%), Gaps = 77/588 (13%)

Query: 88  DSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNC 147
           D+  LK FY+ + + I D+SP G   +    +C++ GDIG+   +  +F +L    L  C
Sbjct: 157 DAQNLKAFYTSILKEIKDYSPEGTLDRTKGSDCKI-GDIGAT--NIKDFGKLSESELSKC 213

Query: 148 LNLSGADISNLRHSHKSFVDSLDV-TLPS-NS----YKGSGIVTVGGGKFSLMAFLIVQN 201
           + +       L+  H  F +++    LPS NS    YKG GIV VGGGKFSL+    ++ 
Sbjct: 214 IQIPKDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEGIVIVGGGKFSLIGLPAIKA 273

Query: 202 IR-----RMGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKF 252
           IR     R+ +++PVE+ IPP++  + EFC  +LPK +     +C+F   I  +E+++  
Sbjct: 274 IRVNSGHRLQSSIPVEIMIPPSDDEDVEFCKNVLPKVDPTGLTRCVFFSDIFEEEILK-- 331

Query: 253 DFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQP 312
           D +GYQ K+LAL+ SSF   L+LDADN+ V  + + F+   F  KGLVLWPDFWRR   P
Sbjct: 332 DIKGYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHP 391

Query: 313 LYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMV 372
            +Y+I G+ VN    +R S D++TPPEVY +N +D   +PFHDL  ++PD+STESGQL+V
Sbjct: 392 KFYEIIGIDVNRNESIRYSIDNVTPPEVYRDNDDD--SIPFHDLANSIPDISTESGQLLV 449

Query: 373 NKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY----GLPFYQVKS 428
           +K KHL T+LL+ YYN NGP++YYP+  Q  AGEGDK+TFIAAA+         ++Q+++
Sbjct: 450 DKQKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVTHPSESGSYHQIQT 509

Query: 429 STSVDGYF-------------------ENGEFHGVAMLQYDCVQDYKLYQIAKDDI--DV 467
              V G++                   +N ++ GVAMLQ + ++D++  + A+  I  D+
Sbjct: 510 PVRVQGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSNYIEDHERLKEAQSAIPKDI 569

Query: 468 KYGLSRVGNSASQKRISFDKSYS--LEDFKNKYFRED-----SHNDVMFIHSNFPKFDPL 520
           K  L +       +  + D  Y    E  +  Y   D        +V FIHS+ PK+DP 
Sbjct: 570 KKRLDKFRQEHKDEFNNEDDLYKKFYESLRGHYSLNDYLEYFDSTEVSFIHSHLPKYDPW 629

Query: 521 SLWKNRQLV-----------DKD------GNHFRSYTN-LRKFGDFDIELENFKIFKNFF 562
            + ++               DKD        H+R Y +   K  ++D+EL N+ +F+ F 
Sbjct: 630 VISQDEDFKYDGKRAKKLRGDKDSPSSKLSGHYRIYNSAFPKVTNYDLELANWAVFQEFL 689

Query: 563 CGDQKVSY--FSYLYDALEKT--PT-GWNDMCEYINKRLVFLEKTHLE 605
           C   K +Y  F YL   + K   PT    +MC+YI++R+ FL KT  E
Sbjct: 690 CSGDKENYKNFKYLKTQVSKADNPTVAVENMCKYIDERVEFLRKTTWE 737

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  327 bits (837), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 202/586 (34%), Positives = 314/586 (53%), Gaps = 77/586 (13%)

Query: 88  DSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIG-SRPDDYSNFDRLGYDNLVN 146
           D+  L++    V   I + SP G   +    +C L GD+    P    N +++    L+ 
Sbjct: 81  DARTLREALGSVMNQIRELSPQGELDRSKGDDCSL-GDLNVGVP---QNDEKVSKSELLK 136

Query: 147 CLNLSGADISNLRHSHKSFVDSLDVTL----PSNSYKGSGIVTVGGGKFSLMAFLIVQNI 202
           C+ ++      L++ HKSF+  L+  +    P + Y+G GIV VGGG+F++     +Q I
Sbjct: 137 CIQITPDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFTMFVMPAIQAI 196

Query: 203 R-RMGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKFDFRGY 257
           R   G  +P+E+ IPP    E+ FC  +LP  +     +C+F++ +   + ++  + +GY
Sbjct: 197 RANAGRDIPIEIMIPPGNNHESGFCENILPLVDPSGLTRCVFMETLFDSKTMK--NVKGY 254

Query: 258 QFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDI 317
           Q K+LAL+ASSF  TLLLDADN+ V  ++S F+ E  +  G+ LWPD+W+R   P  YDI
Sbjct: 255 QLKALALLASSFRKTLLLDADNYVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHPAVYDI 314

Query: 318 AGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKH 377
            G  V+   R R   D ++P ++Y  +  D+S VPFHDL+GT+PD  TESGQL+V+K KH
Sbjct: 315 VGSHVDSSRRARFIMDTVSPSQLYQSD--DISKVPFHDLDGTIPDGGTESGQLLVDKYKH 372

Query: 378 LGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAA---NFYGLP--FYQVKSSTSV 432
           L TI+L+LYYN NGP++YYP+  Q  AGEGDK+TF  AA   + +GL   FYQ+++    
Sbjct: 373 LDTIILSLYYNYNGPSYYYPLLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLRAPVGA 432

Query: 433 DGYF-----------------ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVG 475
            GY+                 +   F GVAMLQ+D   D+K Y+ A  +I  K  L +  
Sbjct: 433 LGYWAHPKDNVPILDDEHVPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSK--LVQDL 490

Query: 476 NSASQKRISFDKSYSLEDFKNKYFREDSHND--------------VMFIHSNFPKFDPLS 521
            +  +K    D S  L +    +++E   +               V FIHS+FPK++P  
Sbjct: 491 KTFRKKATLSDASADLANVDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYNPWE 550

Query: 522 LWKNRQLV---------DKDG--------NHFRSYTN-LRKFGDFDIELENFKIFKNFFC 563
             ++++ +          KD          HFR Y +  +K  ++D+EL N+  FK   C
Sbjct: 551 FAQDQEFIFDGKKVMSDHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKEHIC 610

Query: 564 GDQKVSYFSYLYDALEKTPTG---WNDMCEYINKRLVFLEKTHLEA 606
            +   + FSYL + +EKT  G   + +MC+YI++R+  L+ T  E 
Sbjct: 611 REDGHTNFSYLAEEIEKTEHGLQRYEEMCKYIDERVKMLKSTTWEG 656

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  325 bits (833), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/493 (39%), Positives = 285/493 (57%), Gaps = 39/493 (7%)

Query: 95  FYSRVFQNII-----DFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           FY  +FQ+I      D+  +     Q   +C L+ DI            + Y+NL NC +
Sbjct: 66  FYKFLFQHIKESPLNDYKNNPLILDQLNDQCLLQNDITFDATSKEQLSTVSYNNLKNCYS 125

Query: 150 LSGADISNLRHSHKSFVDSLDVTLPSN--SY------KGSGIVTVGGGKFSLMAFLIVQN 201
           L   D   +  S   +++     L     SY      KG GIVTVGGGK+SL+A+L+++ 
Sbjct: 126 LQEHDFKKISKSQLEYINKCVTKLSKKKKSYTDILFPKGRGIVTVGGGKYSLLAYLMIKL 185

Query: 202 IRRMGTTLPVEVFIPPNEGP---ETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQ 258
           +R  GTTLPVEV IPP++     +T  C ++LP  NAKCI+    LP E++Q  D  G+Q
Sbjct: 186 LREKGTTLPVEVVIPPSDKEMYDDTWLCNDVLPTLNAKCIYFTDRLPAEILQDLDIHGFQ 245

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
           +KSLA+  SSF+ TL LD+DNFP+K L+++F+   F+  GL+ WPD WRRT  P +YDI+
Sbjct: 246 YKSLAIWISSFKKTLFLDSDNFPLKDLDNVFDTPAFEEVGLIFWPDLWRRTIPPDFYDIS 305

Query: 319 GVPVNLKNRVRNSFDDLTPPEVYTEN--MNDLS-GVPFHDLEGTMPDVSTESGQLMVNKN 375
            +  +LK RVR   DDL+   +Y ++  + D    +PFHDL+GT+ D STE+GQ++V+K 
Sbjct: 306 NIKYDLKKRVRYVQDDLSSVPLYDKDNSVKDYEYNIPFHDLDGTISDPSTETGQMLVDKE 365

Query: 376 KHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGY 435
            H  T+LL++++N  G   YY +FSQ  AG GDK+TFIAAA+  G P+YQVK+    DG+
Sbjct: 366 THFETLLLSIFFNYFGFAIYYDMFSQAGAGIGDKDTFIAAAHVLGQPYYQVKTPPEFDGF 425

Query: 436 FE-NGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLEDF 494
           +     F G+A+LQ+D  QDYK YQ+A+  I+ K      G+ A  K  ++   Y+L+  
Sbjct: 426 WHPTMGFQGLALLQHDFNQDYKNYQVAR--IEAK------GDDA--KYENYITDYNLK-- 473

Query: 495 KNKYFREDSHN----DVMFIHSNFPKFDPLSLWKNRQLVDKDGNHFRSYTNLRKFGDFDI 550
             K+F ED  +    DVMF H +  K +P+SL + +   D++G   +      K+G  ++
Sbjct: 474 --KHFEEDMMDINNIDVMFAHYSLHKAEPMSLLEGQLYFDQNGKPLKGLYKNDKYG-MNL 530

Query: 551 ELENFKIFKNFFC 563
           E   F     F C
Sbjct: 531 EYYIFNTLHEFLC 543

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score =  315 bits (808), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 198/542 (36%), Positives = 286/542 (52%), Gaps = 39/542 (7%)

Query: 93  KKFYSRVFQN-IIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLS 151
           K     +FQ  II  S SG    Q  P C ++  + S+      ++ L ++NL  CL + 
Sbjct: 104 KPILKSIFQKLIISSSSSGQNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIID 163

Query: 152 GADISNLRHSHKSFVDSLDVT--LPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTL 209
              + NL+  H++F++SL++   LP N Y G GIV +GGGK +L A ++ + IR  G  +
Sbjct: 164 DTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEI 223

Query: 210 PVEVFIPPN-----------EGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQ 258
           PVE+FIPP            +  E++FC ++  + N  CIFI  I+ +E     +     
Sbjct: 224 PVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCIFISDIIDEEDFHLPELTEST 283

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
              LAL+ SSF++TL+L   NFP+KPL++IF  +P+   G + WP FWRR   P  YDI 
Sbjct: 284 TLLLALLTSSFDDTLVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIM 343

Query: 319 GVPVNLKNRVRNSFDDLTPPEVYT----ENMNDLSGVPFHDLEGTMPDVSTESGQLMVNK 374
           G  +N   R+R   DD+TPP+VYT    +N    + +P HDLEGT+PD  T   Q ++ K
Sbjct: 344 GKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKK 403

Query: 375 NKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
           +K++ TILLALYY+VNGP+WYY ++ QK +    K+    AA+    PFYQVK++  +DG
Sbjct: 404 SKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDG 463

Query: 435 YFENGEFHGV-AMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYSLED 493
             +  E     + L +D  QD+  Y  AK +I   Y L    +      I FD SY+ E 
Sbjct: 464 IVKTKERPMFSSTLYHDFQQDFAFYTFAKMNIKSTYDLKDSND------IQFDPSYTYEK 517

Query: 494 FKNKYF-------REDSHNDVMFIHSNFPKFDPLSLWKNRQLV--DKDGNHFRSYTNLRK 544
           F N Y        R  +H  +MF HSN    DP  L KNR+L+  D          N+  
Sbjct: 518 FSNNYMDVGWEAIRNGNH--LMFAHSNLFDGDP-KLLKNRKLLIDDISKEPLLMTWNIAI 574

Query: 545 FGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKTHL 604
           F   +IELE+FK    + C  +K  YF YL D           MC +I +RL FL+ +  
Sbjct: 575 FEKQNIELESFKTMHEYLC--EKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSAD 632

Query: 605 EA 606
           +A
Sbjct: 633 DA 634

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  307 bits (786), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 207/593 (34%), Positives = 314/593 (52%), Gaps = 89/593 (15%)

Query: 88  DSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNC 147
           D  KL +      + +   S +    +     C+L GD+G+   D   F ++  + L+ C
Sbjct: 76  DQDKLTEMMKYTMERVRSHSSTAVVDRTKNKGCQL-GDVGANAVD--KFSKVTKEQLLKC 132

Query: 148 LNLSGADISNLRHSHKSFVDSLDVTL----PSNSYKGSGIVTVGGGKFSLMAFLIVQNIR 203
           ++        L+ SH +F+D+L   +    P++ Y G GIV VGGGK++L A   ++ +R
Sbjct: 133 IDFPQETFEQLKDSHTTFLDTLTNDILDEYPTDLYGGKGIVIVGGGKYTLYAMPAIKAVR 192

Query: 204 RMGT-TLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKFDFRGYQ 258
             G  T+P+E+ IPP    E  FC  +LP+ +     +CI+++++  ++ ++  D +GYQ
Sbjct: 193 TNGDPTIPIELMIPPENDGEDAFCENVLPELDPSGLTRCIYMNQVFDEQTLK--DVKGYQ 250

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
            K+LAL+ASSFE  LLLDADN+ V  +  IF  + FK  GL+LWPD+WRR   P  YDI 
Sbjct: 251 LKALALLASSFEKVLLLDADNYVVNSIRDIFELDVFKEFGLILWPDYWRRLHHPRLYDIV 310

Query: 319 GVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHL 378
           G+ VN   RVR S DD++P E+Y E   D S +PFHD EG +PD  TESGQL+V+K+KHL
Sbjct: 311 GISVNENKRVRYSMDDVSPTELYEE--KDQSKIPFHDFEGAIPDGGTESGQLLVDKSKHL 368

Query: 379 GTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY---GL--PFYQVKSSTSVD 433
           GTI+L+LYYN NGP+ YYP+  Q  AGEGDK+TF  AA      G+   ++QVK+     
Sbjct: 369 GTIILSLYYNYNGPSQYYPLLGQGFAGEGDKDTFALAATALTQRGIVSAYHQVKTPVGTS 428

Query: 434 GYFENGE---------------FHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLS------ 472
           GY+ N +               + GVAMLQ+D + D++ Y  A  D+   Y         
Sbjct: 429 GYWANSKDETPFEKGLPDAQRSYRGVAMLQHDLLGDFEAYMNAIHDLSDSYDEDFKIYYH 488

Query: 473 -RVGNSASQKRISFDKSYSLEDFKN--KYFRED---SHN---------------DVMFIH 511
            R+G    Q+ +  D S S E   N  K  RED   SH                 V+F+H
Sbjct: 489 RRLG----QRPLEEDNSESREKVANWEKKIREDFWKSHKVDYDLKSFLQHFKDVPVLFVH 544

Query: 512 SNFPKFDPLSL-------WKNRQLVDKDGN----------HFRSYTN-LRKFGDFDIELE 553
           S+ PK++P  L       +  +++++K  +          H+R Y +  ++  ++D+EL 
Sbjct: 545 SHLPKYNPWLLSQFGDLKYDGKRVLEKHADDPNFKPSRHGHYRMYGDEFKEKINYDLELA 604

Query: 554 NFKIFKNFFCG-DQKVSYFSYLYDALEKTPTG---WNDMCEYINKRLVFLEKT 602
           NF   ++  C  +     FSYL   + +   G   +  MC+YI +R+  L  T
Sbjct: 605 NFITMRDHICAVEDGYKNFSYLSKEVNQEDKGFEKYRAMCDYIAERVDMLSDT 657

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  283 bits (725), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 192/607 (31%), Positives = 294/607 (48%), Gaps = 101/607 (16%)

Query: 89  SMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           S  LK FY  +   + + +  G  + +    C+L  D G    D      L  DNL+ CL
Sbjct: 112 SSDLKDFYQEIMTTLKETALKGKLEVKKPEGCKL-SDTGVENTDSEKLSTLTKDNLLKCL 170

Query: 149 NLSGADISNLRHSHKSFVDSLDVTLPSN----------SYKGSGIVTVGGGKFSLMAFLI 198
            +S  D+  ++ +H +F   L   L  N           YKG GI  VGGGK++LMA  +
Sbjct: 171 PISDEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKYTLMALPV 230

Query: 199 VQNIR-----RMGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMI 249
           +++IR      + +++P+E+ IPP++  + + C  ++P  +     KC+++      E++
Sbjct: 231 IKSIRMNSGLTLKSSVPIEIVIPPSDNADRKVCENIIPTIDPSGLTKCVYLSEFFDSEIL 290

Query: 250 QKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRT 309
           +  D  GYQ KSL+L+ SSFE  LLLDADN+ +  L + F+ + F+  GL+LWPD+WRR 
Sbjct: 291 K--DITGYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPDYWRRV 348

Query: 310 TQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQ 369
             P  YDI  + V  K   R S D +T   ++ E+  D + +PFHDLEG +PD STESGQ
Sbjct: 349 HSPKLYDIVDIKVQDK-LARYSTDYITNSRLFPES--DPAKIPFHDLEGAIPDGSTESGQ 405

Query: 370 LMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSS 429
           L+VNK  HL  ++L+LYYN NGP++YY +  Q  +GEGDK+TFI AA      +YQV++ 
Sbjct: 406 LLVNKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRYYQVRTP 465

Query: 430 TSVDGYFENGE-------------------FHGVAMLQYDCVQDYKLYQIAKDDIDVKYG 470
               GY+   E                   + G+AM+Q+D  +D     IA+D I     
Sbjct: 466 VRPQGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNEDRTFDSIARDAI----- 520

Query: 471 LSRVGNSASQKRISFDKSYSLE-------------------------DFKNKYFRED--- 502
              V N     R+ + K++  E                           K KY  +D   
Sbjct: 521 RGSVNNKLKAHRLEYIKNHKSEFKDMNEKDALEKVSKMSEVSDKFWDSMKGKYTIKDFFT 580

Query: 503 --SHNDVMFIHSNFPKFDPLSLWKNRQL-----------------VDKDGNHFRSYT-NL 542
                  +F+HSN PK++P  L  +  L                 V     H R Y+   
Sbjct: 581 IFQFTTPVFLHSNLPKYNPWELSISGDLLYDGKKATKKMDDPSKYVPNGKGHHRMYSPTF 640

Query: 543 RKFGDFDIELENFKIFKNFFCGDQ----KVSYFSYLYDALEKTPTGWNDMCEYINKRLVF 598
           +   ++D+EL N+K+F +  C +       SY S +  A EK      +MC+YI  R+ +
Sbjct: 641 KDLTNYDLELANWKLFDDVLCKNPDDYLNFSYLSEVIGATEKPEQEVKNMCKYIKDRVEY 700

Query: 599 LEKTHLE 605
           L+ +  E
Sbjct: 701 LKLSTWE 707

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  273 bits (698), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 191/597 (31%), Positives = 301/597 (50%), Gaps = 94/597 (15%)

Query: 89  SMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           S +LKKFY  + Q +   SP+G    + +  C L G+IG    + + FD+L    L  C+
Sbjct: 87  SDELKKFYRNITQLVKQNSPTGELDAKKQKWCDL-GNIGLT--ETTKFDKLTKLELSKCI 143

Query: 149 NLSGADISNLRHSHKSFVDSL-DVTLPSNS------YKGSGIVTVGGGKFSLMAFLIVQN 201
           N+    +S+L+  H  F   + D  LP+ S      Y+G GIV +GGG+ +L+A   +  
Sbjct: 144 NVPADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILGGGQKTLLALPAINA 203

Query: 202 IRRMG-----TTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKF 252
           IR  G      T PVE+ IPP    ET FC  LLP+ +     +C+ +  +   E ++  
Sbjct: 204 IRTSGGVTIRNTTPVELVIPPRYKNETAFCQHLLPQLDPTGLTRCVLLSDLYDGEALEHL 263

Query: 253 DFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQP 312
           + +  Q K LAL+ SSF+  LLLD D++ V  L+  F+ E F+ KGLVLWPD WRR   P
Sbjct: 264 EDQ--QLKPLALLVSSFQKALLLDCDSYVVNSLDGYFDGEIFRDKGLVLWPDAWRRLHHP 321

Query: 313 LYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMV 372
             Y++  + V+  N+ RNS D +TP EV+ +  N LS VP+HDLE T+PD ST++GQL++
Sbjct: 322 ALYEVLNIKVDENNQPRNSIDIVTPREVF-QVENKLS-VPYHDLEHTIPDGSTDTGQLLI 379

Query: 373 NKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL---PFYQVKSS 429
           +K+KHL T+++++YYN NGP++YY +  Q     GDK T+ AAA+        +Y V++ 
Sbjct: 380 DKDKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNGDKNTYTAAAHAMHPNDGSYYHVRTP 439

Query: 430 TSVDGYF--ENGEFHG-----------VAMLQYDCVQDYKLYQIAKDDI--DVKYGLSRV 474
             + G++  E+G               VA LQ+D  +DYK Y+ +++ I  + +  L++ 
Sbjct: 440 IGMQGHWVDEDGARLADPNQKSQTRRVVAGLQHDYNEDYKYYKWSREVIGNNFREKLAQF 499

Query: 475 GNSASQKRIS--------------------------FDKSYSLEDFKNKYFREDSHNDVM 508
                Q   S                          F  SY LED+ + +        V 
Sbjct: 500 RKKWYQAHKSDFSEDEKKRQKELENNKELNAKFWSQFTGSYKLEDYLSFF----DFTPVT 555

Query: 509 FIHSNFPKFDPLSL-------WKNRQLVDKDGN----------HFRSY-TNLRKFGDFDI 550
           F+HS  P +DP  L       +   ++ D+  +          H+R Y        +FD+
Sbjct: 556 FVHSRQPSYDPWQLSQIGDLKFDGARITDQHADDEEYKPSSSGHYRMYGPEFTDQTNFDL 615

Query: 551 ELENFKIFKNFFCGDQKVSY--FSYLYDALEKTP---TGWNDMCEYINKRLVFLEKT 602
           EL ++ +F+  FC   + +Y   +YL + +  TP       +MC+Y+  R  +L  T
Sbjct: 616 ELSSWLLFQRLFCSSDREAYTQLAYLQEQISNTPDPDKSVQEMCKYVGARAQYLRDT 672

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  273 bits (697), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 194/594 (32%), Positives = 295/594 (49%), Gaps = 88/594 (14%)

Query: 89  SMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           S   KK +  V   I   SP G  +     EC L  DIG    D S FDRL  ++L  CL
Sbjct: 110 SEATKKAFKEVLDAIQANSPEGQLQVSKGSECNLM-DIGVT--DTSKFDRLTKESLEKCL 166

Query: 149 NLSGADISNLRHSHKSFVDSLDVTL-------PSNSYKGSGIVTVGGGKFSLMAFLIVQN 201
            +       L  +HK F  ++   L        + ++ G GI+ VGGGK+S+ A   ++ 
Sbjct: 167 QIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKYSVFALPAIKA 226

Query: 202 IR-----RMGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKF 252
           IR     ++ +++P+E+ IPP++  +  FC  +LPK +     KC+F+D +   + +   
Sbjct: 227 IRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTKCVFLDEMFDADTLSHI 286

Query: 253 DFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQP 312
           +  GYQ K+LAL+ S FE  L+LDADN+ V  +N  F       KGL+LWPD+WRR   P
Sbjct: 287 E--GYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALNDKGLILWPDYWRRLHHP 344

Query: 313 LYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMV 372
             Y I  + V+  +  R S DD++P  +Y +++ D    PFHD    +PD  TESGQL+V
Sbjct: 345 KLYGIVDLGVSPDHISRYSVDDVSPDYMYKKSVTD---TPFHDFRDALPDGGTESGQLLV 401

Query: 373 NKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLP--FYQVKSST 430
           +K KHL +I+++LYYN NG ++YYPI  Q  AGEGDK+TF  A+     P  FYQVK+  
Sbjct: 402 DKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTFALASRVMHGPGSFYQVKTPV 461

Query: 431 SVDGY--------------FENGE--FHGVAMLQYDCVQDYKLYQIAKDDI--------- 465
              G+              +EN E  F G AMLQ+D ++D K   +A++ +         
Sbjct: 462 DTLGHWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIEDSKFSSLAREVLGNTIRNNEE 521

Query: 466 ---DVKYGLSRVGNSASQK--RISFDKSYSLEDFKNKYFRED----------SHNDVMFI 510
              D     ++   SA +K  R    KS  ++D  ++  R            S   V F+
Sbjct: 522 KFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEKMRASYKLDDYLAFFSFTGVSFV 581

Query: 511 HSNFPKFDPLSLWKNRQLV------------DKD------GNHFRSYTNLRKFGDFDIEL 552
           HS+ PK+DP   ++N  ++            D D      GN+    +   +   +D+EL
Sbjct: 582 HSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPAHSGNYRMYDSKFNQISSYDLEL 641

Query: 553 ENFKIFKNFFC----GDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLEKT 602
            N+  FK++ C    G +   Y S   D+ +       DMC+YI +R+ +L+ T
Sbjct: 642 ANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNKDMCKYIEERVEYLKST 695

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  244 bits (624), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 194/601 (32%), Positives = 295/601 (49%), Gaps = 103/601 (17%)

Query: 89  SMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCL 148
           S + +K ++   + +  +SP G        +C + GDI  R  D S F +L  ++L  CL
Sbjct: 100 SNETRKAFNDALELVKKYSPDGKLDTTKGDDCEI-GDI--RITDTSQFHKLTKESLEKCL 156

Query: 149 NLSGADISNLRHSH--------KSFVDSLDVTLPSN--SYKGSGIVTVGGGKFSLMAFLI 198
           N+    +  L   H        KS + S DV       ++KG GIV VGGG+FS+ A   
Sbjct: 157 NVPDETVKKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVIVGGGRFSVFALPA 216

Query: 199 VQNIR-----RMGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMI 249
           ++ IR     +   T+P+E+ IPP++  +  FC  +LPK +     KC+F+D IL  E +
Sbjct: 217 IKAIRENSGVKTKNTIPIEIIIPPHDKGDRGFCENVLPKVDPSGLTKCVFLDEILSPETL 276

Query: 250 QKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRT 309
              +  GYQ K++AL  S FE  L+LDADN+ V  L+  F  +  K KGL+LWPD+WRR 
Sbjct: 277 SHIE--GYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKEKGLILWPDYWRRL 334

Query: 310 TQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQ 369
             P  YDI  + V+ K++ R S D+ TP  VY +   D    PFHD    +PD STESGQ
Sbjct: 335 HHPKTYDIVNLGVSTKSQ-RYSIDNATPDFVYKK---DAKETPFHDFFDALPDGSTESGQ 390

Query: 370 LMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLP--FYQVK 427
           ++++K KHL ++L+ LYYN NG +++YP+  Q  AGEGDK+TF         P  +YQVK
Sbjct: 391 VLIDKKKHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCRVMHGPEAYYQVK 450

Query: 428 SSTSVDGYF-----------------ENGEFHGVAMLQYDCVQDYKLYQIAKDDID---- 466
           +     G++                 +  +F G AM+Q+D   D +   +A++ I     
Sbjct: 451 TPVDTLGHWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRFSSLAREVIGNAIR 510

Query: 467 ----------VKYGLSRVGNSASQKRISFDK--------------SYSLEDFKNKYFRED 502
                      +    ++     ++R   DK              SY L+D+ + +    
Sbjct: 511 DRFHSFCDEWARSHEGKLSKDQKERREQCDKSDEVKKAFNDKESPSYGLKDYLSFF---- 566

Query: 503 SHNDVMFIHSNFPKFDPLSLWKNRQLV---------DKD--------GNHFRSY-TNLRK 544
               V FIHS+ PK+DP        ++          KD          H+R Y + + +
Sbjct: 567 HFTKVSFIHSHLPKYDPWEWSHTGDMMFNGAKALKNHKDEPEYSPMHAGHYRMYDSKISQ 626

Query: 545 FGDFDIELENFKIFKNFFCGDQKVSY--FSYLYDALEKT--PTGWND-MCEYINKRLVFL 599
              +D+EL N+  FK++ C D K  Y  F YL   LE+T  P   N+ MC YI +R+ +L
Sbjct: 627 LTSYDLELANWSAFKDYLC-DIKDGYKNFGYLVQVLEETEFPHQSNENMCNYIRERVEYL 685

Query: 600 E 600
           +
Sbjct: 686 Q 686

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  243 bits (621), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 178/599 (29%), Positives = 286/599 (47%), Gaps = 97/599 (16%)

Query: 93  KKFYSRVFQNIIDFSPSGATKKQYKPEC---RLEGDIGSRPDDYSNFDRLGYDNLVNCLN 149
           K+F ++V   + + +P    K      C   R+  D G     +    +L    L  CL+
Sbjct: 73  KEFINQVVTAVQESAPVDELKLLQDDNCQHRRVSIDEGK----HEVLLQLTEAELSKCLH 128

Query: 150 LSGADISNLRHSHKSFVDSLDVTL-------PSNSYKGSGIVTVGGGKFSLMAFLIVQNI 202
           +S    S +  SH  F + +  TL        S  YKG G++ + GG+ +L A   ++ I
Sbjct: 129 VSDDIKSKMMASHLQFKEYVQGTLMKSLANLESYPYKGDGVIIMAGGEHTLSAMASIKAI 188

Query: 203 RR-----MGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKFD 253
           R+     M  ++P+++ IP  +  +  FCT++LP  +    + C+F + I   +++ K +
Sbjct: 189 RQNGGIIMRRSVPIQIVIPSKKQDDEVFCTKVLPMLDPTGLSTCLFFEDIFDSDVLNKIE 248

Query: 254 FRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPL 313
               Q+KSLAL+ SSF   LLLD+D F V  ++  F+    K  G++LWPD+WRR   P 
Sbjct: 249 --SSQYKSLALIVSSFRRVLLLDSDTFVVNSIDGYFHHSQLKENGMILWPDYWRRLHHPD 306

Query: 314 YYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVN 373
            Y I G+ V+   R+R S DD +P  +Y     D S  PFHD E  +PD ST SG L+++
Sbjct: 307 LYKIVGINVHADTRLRFSVDDSSPKVLYESPKGD-SPFPFHDSENAIPDGSTASGPLLID 365

Query: 374 KNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAAN--FYGLP-FYQVKSST 430
           K  HL TI+++LYY+ NGP+ YYP+       E +K+TF  AA+  +   P +YQVK+ +
Sbjct: 366 KQIHLDTIIMSLYYSFNGPSLYYPLLGCDQGSECEKDTFALAAHALYPDTPKYYQVKTPS 425

Query: 431 SVDGYFEN--------------------GEFHGVAMLQYDCVQDYKLYQIAKDDID---- 466
           + +G++EN                      F  VAML YD ++D +  ++A++ I     
Sbjct: 426 AHEGHWENITTGVRILDEELASTNSDEGKTFRKVAMLLYDYIEDTEFARLAREIIKENAD 485

Query: 467 -VKYGLSRVGNSASQKRISFDKSYSLEDFK-NKYFRED---SHNDV-------------- 507
            +       GN+    R +F K   + D + N   R D    HNDV              
Sbjct: 486 TLLESFKNDGNAHHANRKTF-KPRDINDLETNDELRADFWKKHNDVYHIQDFLLFFDFIP 544

Query: 508 -MFIHSNFPKFDPLSLWKN--------RQLVDKDGN---------HFRSYTN-LRKFGDF 548
             FI S  P ++P  L           R L   + +         H+R Y++ +    ++
Sbjct: 545 MKFIRSLSPSYNPWKLLTTGDMQFDAARALKGHENDPKYKPAHSGHYRMYSSGISTVTNY 604

Query: 549 DIELENFKIFKNFFCGDQKVSY--FSYLYDALEKT---PTGWNDMCEYINKRLVFLEKT 602
           D+EL N+ +F+NF C  +  +Y  + YL   +E T      +  MC+YI  R+ +L  T
Sbjct: 605 DLELANWSLFENFVCNSKAFTYRDYGYLKQQIENTKDPALEYKKMCKYIRNRVKYLRNT 663

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  230 bits (587), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 157/533 (29%), Positives = 260/533 (48%), Gaps = 46/533 (8%)

Query: 92  LKKFYSRVFQNIIDFSP-SGATKKQ---YKPECRLEGDIGSRPDDYSNFDRLGYDNLVNC 147
           +++FY  +F++I  + P +   KKQ   +K +C L   I           +L Y  L  C
Sbjct: 53  VEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLKQLSYMTLDYC 112

Query: 148 LNLSGADISNLRHSHKSFVDSLDVTLPS-NSY-------KGSGIVTVGGGKFSLMAFLIV 199
            +LS    +NL+ +H  +   ++    S + Y       +  GIVT+GG + +L     +
Sbjct: 113 FHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLGGNERTLSLLASI 172

Query: 200 QNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQF 259
             +R+MG+TLP+EV  PP    E +FC + LP+YN KCI++ + LP+ +++   F     
Sbjct: 173 PRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAHKFDEKMI 232

Query: 260 KSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAG 319
           +    + S+F++ L +++++F    ++  F+ + F   GLVLWP   RR+T P +Y I  
Sbjct: 233 RMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSPAFYQIVN 292

Query: 320 VPVNLKNRVRNSFDDLTPPEVYT----ENM--NDLSGVPFHDLEGTMPDVSTESGQLMVN 373
             ++L NR RN  DD++ P  YT    EN+  N L+  P HDL+G +PD  T  G  M++
Sbjct: 293 RKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTHVGHYMID 352

Query: 374 KNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVK-SSTSV 432
           K KH  T++LA+YY V+G  W+  +F+ +    G +E  +AAA+   L +YQV     S+
Sbjct: 353 KQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQVHLIPRSM 412

Query: 433 DGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQKRISFDKSYS-L 491
            G  ++    G   + +D   DY+ +Q   D   VK  L  V         SFD+ Y+ +
Sbjct: 413 RGGSKDTLQSGETFMHFDPDFDYRKHQALAD--KVKSKLIDVH--------SFDRKYTAI 462

Query: 492 EDFKNKYFREDSHNDVMFIHSNFPKFDPLSLW---KNRQLVDKDGNHFRSYTNLRKFGDF 548
             F+      +     +FI    P+FDPL+L+   K+ Q +D+            K  D 
Sbjct: 463 RTFEKDLLAGNQDVKSIFIEMPSPQFDPLALFFKAKSLQKLDRKD----------KVDDL 512

Query: 549 -DIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRLVFLE 600
             +E +N+       C D        + +   K      DMC Y+ K +  L+
Sbjct: 513 MALERQNYSNLMEVLCRDTDPLVLQMMVNHPSK--YKMKDMCVYLKKIVTSLK 563

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  199 bits (505), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 158/608 (25%), Positives = 265/608 (43%), Gaps = 105/608 (17%)

Query: 93  KKFYSRVFQNIIDFSPSGATKKQYKPECRLEGDIGSRPDDYSNFDRLGYDNLVNCLNLSG 152
           + F   + + +  + P  A   Q + +C LE     R  D   F  L    L  C++LSG
Sbjct: 89  RTFVEEILRTVQAYPPGAAL--QVQADCLLER---VRATDERKFGSLTASKLQGCVDLSG 143

Query: 153 ADISNLRHSHKSFVDSLDVTLPSN-------SYKGSGIVTVGGGKFSLMAFLIVQNIRR- 204
              ++ +  H   +  +  +LP +        Y   GIV +GGG  ++ A   +++IR  
Sbjct: 144 DAFAHAKEQHALMMKVIQKSLPEHLSDLDHYPYISDGIVILGGGHKTIAAIPAIRSIREN 203

Query: 205 ----MGTTLPVEVFIPPNEGPETEFCTELLPKYN----AKCIFIDRILPDEMIQKFDFRG 256
               +  ++P+EV IP     E  FC+++LP  +     +C+ +   +   ++ K   + 
Sbjct: 204 SGITVRNSMPIEVVIPGPADEEKVFCSKILPVLDPSGLTRCVHLGDTISSSLLSKV--KP 261

Query: 257 YQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYD 316
              ++LAL+ASSF   L LD+    +  ++  F+ E F  +GLVLWPD+WRR   P  Y+
Sbjct: 262 SDHRTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGLVLWPDYWRRLHHPKLYE 321

Query: 317 IAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNK 376
           +AG  V+   R R S D  +P E+Y     +    P HD + ++PD S+ SG L+++K K
Sbjct: 322 LAGSKVDTGRRERYSIDKGSPIELYGGKDGEW---PMHDCKDSIPDASSSSGVLLIDKKK 378

Query: 377 HLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY---GLPFY-QVKSSTSV 432
           H  T+ LALYYNV+G  ++YP+   KA  E +K+T + AA+     G P Y QV +    
Sbjct: 379 HFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVLSRGGGPLYHQVTTPKRS 438

Query: 433 DGYFENGEF--------------------HGVAMLQYDCVQDYKLYQIAKDDIDVKYGLS 472
           +G+ ++                       HG A   +D   D+    +A + I+  +   
Sbjct: 439 EGHRKDKASSKPILEDTVDTSTIITSTYRHGAASY-HDFFADHNFELLAGEIINSNFDSR 497

Query: 473 RVG------------------------NSASQKR---ISFDKSYSLEDFKNKYFREDSHN 505
           R+                         N AS K     SF  +Y+L ++ N +       
Sbjct: 498 RLAYVKWWRQNHSDDTTYKDKSDEDLSNDASVKADFYTSFHGNYTLAEYLNFF----EFT 553

Query: 506 DVMFIHSNFPKFDPLSLWKNRQLV--------DKDGNHFRSY-----TNLRKFGD----- 547
            V F+ ++    +P  + ++R L          +  N    Y     T+ R F D     
Sbjct: 554 PVSFVETDVLTCNPWIVAQSRDLTFDGASAVGAQPANQQTQYKAGPPTHHRLFSDHFQKL 613

Query: 548 --FDIELENFKIFKNFFCGDQKVSYFSYLYDALEKT---PTGWNDMCEYINKRLVFLEKT 602
             +D+EL  +  +  F C       + YL + L  T    T +  MC+YI+ R+  L+ T
Sbjct: 614 TTYDLELATWSAYAEFLCSKFSYKDYPYLKEHLGLTDSPTTAYKMMCKYISARVSHLQST 673

Query: 603 HLEAVNKK 610
               +  K
Sbjct: 674 SWHTMGNK 681

>NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123
          Length = 656

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 111/274 (40%), Gaps = 42/274 (15%)

Query: 180 GSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELL------PKY 233
           G GIV       S M    ++ +  +   LP+++    NE   TEF  +L        K 
Sbjct: 270 GKGIVVTMSEGDSYMFKKQLKVLDHLNNELPIQIITKGNEF-STEFINDLSNFVQKETKQ 328

Query: 234 NAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEP 293
               + I  +L      K+    Y  K LA++ ++F+  ++LDAD  P  P+N  F E+ 
Sbjct: 329 KVAILNISSMLDPAFADKYIVNFYN-KWLAVIFNTFQEIIILDADVVPFVPINDFFEEKK 387

Query: 294 FKSKGLVLWPDFWRRTTQPLYYDIAGVP-----------VNLKNRVRNSFDDLTPP--EV 340
           FK+ G++L+ D          Y I  +            +N K  V ++ +   PP  E 
Sbjct: 388 FKNSGMLLYKDRLMVNEHTFSYCIDSMKFLEPSSLELKYLNTKLLVDSNTEIAIPPSSEE 447

Query: 341 YTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFS 400
            +   N    +  H +         +SG +++NK + L  +LL+   +++G         
Sbjct: 448 LSVYYNFFKNLRLHHI---------DSGLVVINKQEKLNGLLLSFALHLDGKL------- 491

Query: 401 QKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
            +    GDKE F     F G    Q  S  S+DG
Sbjct: 492 -RRCVYGDKEFFWLGQLFIG----QDYSIYSMDG 520

>NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123
          Length = 639

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 111/256 (43%), Gaps = 25/256 (9%)

Query: 177 SYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPE-TEFCTELLPKYN 234
           S  G GIV   G +   M    ++ +  +G  LP+++    +E  PE  +  T+ L   N
Sbjct: 238 SSHGKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQLVTAGSEYSPEFLKDLTDFLKTTN 297

Query: 235 AKCIFIDR--ILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
            +   ++   IL  E + K+    +  K +A++ ++FE  +L+DAD  P  PL S F  E
Sbjct: 298 QEVYLVEASPILDPEFVSKYIVFFFH-KWIAILLNTFEELVLIDADVVPFVPLKSFFKSE 356

Query: 293 PFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDL-----TPPEVYTENMND 347
            +K+ GL+L+ D   +      Y +  +     +R    +        +  E+ +   ++
Sbjct: 357 GYKTTGLLLFKDRNMKGEHTFTYCMESLKYMEPSRQETEYIQTNLLIDSTKELPSPTSSE 416

Query: 348 LSGVP---FHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAA 404
            + V    F DL     D    SG + VNKN+ +  +L++   ++NG          +  
Sbjct: 417 EAAVYNHFFKDLRLHHVD----SGLVTVNKNEKMNGLLMSFMLHLNGKI--------QRC 464

Query: 405 GEGDKETFIAAANFYG 420
             GDKE F     F G
Sbjct: 465 VYGDKEFFWLGQLFAG 480

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 53.9 bits (128), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 110/259 (42%), Gaps = 24/259 (9%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPET--EFCTELLPKYNAK 236
           KG GI    G +   M   ++  +  +G TLP+E+    +  P T  +    +  K N  
Sbjct: 243 KGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDKIAKYVQMKSNQT 302

Query: 237 CIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKS 296
              +D     E   +    G++ K LA + ++FE  + +D D  P   L  +F  E +KS
Sbjct: 303 VRLVDCGKTLEHSYRSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEGYKS 362

Query: 297 KGLVLWPDFWRRTTQP------LYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSG 350
           +G++++ D      +P      +   +     +   +  +++D     +  T+   D   
Sbjct: 363 EGILMFRDRSYDGEKPDDCPKAMRIMMPSPKEHTMWQHGSNYDKQVAEDELTKKPRDAGA 422

Query: 351 VPFHD--LEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGD 408
             F+   +EG    ++ ESG ++++KNK L ++L++L  ++         F       GD
Sbjct: 423 ATFYIKYMEGKSFHMA-ESGLIVMHKNKKLPSLLISLMLHMT--------FETHLCSHGD 473

Query: 409 KE-----TFIAAANFYGLP 422
           KE       ++  N+Y  P
Sbjct: 474 KEYLWLGQLVSGENYYVDP 492

>Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C
           (REAL)
          Length = 553

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 91/212 (42%), Gaps = 39/212 (18%)

Query: 254 FRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPL 313
           F  Y  K LAL+ SSFE  +LLD+D  P   ++ ++  E F+  G++ + D   R     
Sbjct: 250 FEAYSNKWLALIFSSFEIPILLDSDTVPFVSIDKLYKLEEFQRTGVLFFKD---RIISDD 306

Query: 314 YYDIAGVPVNLKNRV----------RNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDV 363
            ++++ V V LK  +           ++ + +  P V     N L     H L       
Sbjct: 307 LFELSQVDV-LKEVIYGCVGLNLTDESNINHIKDPMVAQALENMLVKKYKHHL------- 358

Query: 364 STESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLP- 422
             ESG ++++K +HL ++L +L    +    Y+          GDKE F   A   G P 
Sbjct: 359 --ESGLVILDKKRHLFSVLTSLALQFSPIAEYF---------HGDKEWFWLGALLSGNPF 407

Query: 423 -FYQVKSST-----SVDGYFENGEFHGVAMLQ 448
            FY V +S      SV      GEF+ +  +Q
Sbjct: 408 TFYPVGASNIGKLGSVISKETTGEFYQICSVQ 439

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 62/256 (24%), Positives = 103/256 (40%), Gaps = 26/256 (10%)

Query: 180 GSGI-VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE--GPETEFCTELLPKYNAK 236
           G GI +TV       M  L  + ++ +G T P++V     E   P  E   +   + N  
Sbjct: 246 GKGIAITVNPDDVEFMIRLF-RVLKELGNTYPIQVIQKGGELTSPLIEQIKKTAIETNQA 304

Query: 237 CIFID-RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFK 295
              +D   + DE   +     +  K  A + ++FE  LLLDAD  P   L+  FN + +K
Sbjct: 305 VSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEVLLLDADVVPYVSLDEFFNLKGYK 364

Query: 296 SKGLVLWPDFWRRTTQPLYYDIAGVPVN--------LKNRVRNSFDDLTPPEVYTENMND 347
             GL  W D  R +    +    GV +         L   ++   + L   +V +     
Sbjct: 365 DTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLLGTELKFRINSLAKKKVRSSEER- 423

Query: 348 LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEG 407
                FH     +   + +SG +++NK + L ++++   +  NG       F + A   G
Sbjct: 424 ----AFHRFFNELKVHNIDSGIIVLNKKQKLHSLIMGEIFYTNGR------FGRCAY--G 471

Query: 408 DKETFIAAANFYGLPF 423
           DKE F+  A   G  F
Sbjct: 472 DKEMFMMGAFATGADF 487

>Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {ON}
           YIL014W (MNT3) - Product of gene unknown [contig 135]
           FULL
          Length = 619

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 76/325 (23%), Positives = 141/325 (43%), Gaps = 58/325 (17%)

Query: 179 KGSGIVTVGGGKFSLMAFL-IVQNIRRMGTTLPVEVFIPPNEGPETEF--CTELLPKYNA 235
           KG G+V    G+  L  FL +++ + +   +LP+++   P+E  +      TE L   + 
Sbjct: 221 KGKGLV-FSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQSSHQ 279

Query: 236 KCIFIDRILPDEMIQKFDFRGYQF----KSLALVASSFENTLLLDADNFPVKPLNSIFNE 291
           +  +ID     E +    ++ Y      K LA + ++F   +L+DAD  P  P+ S F E
Sbjct: 280 EVYYIDC----EALLDTTYKAYMTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQE 335

Query: 292 EPFKSKGLVLWPDFWRRTTQPLYYDIAGVP-----------VNLKNRVRNSFDDLTPPEV 340
           E +K+ G++L+ D  R   Q   +D                V + +R++ +   + P   
Sbjct: 336 EQYKATGVLLYKD--RDMPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVDPGAH 393

Query: 341 YTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFS 400
              N  D     F   E T+ +V  +SG ++++K + L  +L++   N++          
Sbjct: 394 IFANEKDKVYHRFFYNE-TLHNV--DSGLVVLHKTERLSGLLISFIMNLD---------- 440

Query: 401 QKAAG--EGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLY 458
           QKA+    GDKE F     F G       +  ++D    +G   G   L +D V  ++ Y
Sbjct: 441 QKASNCIYGDKELFWLGQLFSG-------NDYAIDPL--DGAAVGRVNLTHDKVSGHQKY 491

Query: 459 QIAKDDIDVKYGLSRVGNSASQKRI 483
           +I           +++G+ +S  R+
Sbjct: 492 EICA---------TQMGHGSSDGRL 507

>KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 66/309 (21%), Positives = 128/309 (41%), Gaps = 49/309 (15%)

Query: 175 SNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPE-TEFCTELLPK 232
           S +  G G+V   G     M   +V+ +  +   +P++V     E  P+  +   E   +
Sbjct: 229 SQAASGRGVVITMGDNDVDMFGRLVRVLENLENDIPIQVVTTGKEMKPQFIQQLREYTVQ 288

Query: 233 YNAKCIFIDRI-LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNE 291
              +   +D   + D +   F    +  K +A + ++FE  +L+D D+ P  PL++ F  
Sbjct: 289 TGQRIQLVDSSPMLDRLYVAFKITRFLNKWVATIFNTFEEAILIDVDSIPFVPLSTFFEI 348

Query: 292 EPFKSKGLVLW---------------PDFWRRTTQPLYYDIAGVPVNLK---------NR 327
           E +K+ G+ ++                DF  R  +P   +   +  +L+          R
Sbjct: 349 ESYKTTGIYMYRDRDIKHEHAPEKCIADF--RNLEPSVQETDLIGTSLRFDLSQSNDLQR 406

Query: 328 VRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYY 387
            + + + +T  EV  +N        FH+      D    SG +++NK+K L ++LLA   
Sbjct: 407 QQQNGESITIEEVIYKNF-------FHNYNLHQVD----SGLVVINKHKQLHSLLLAFQL 455

Query: 388 NVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG-YFENGEFHGVAM 446
           +++G      +F +     GDKE F       G+ +      +SV G ++E+    G+  
Sbjct: 456 HLSG------VFEKCV--HGDKEFFWLGPLLSGVDYTIDPLGSSVIGQFYEDNGKTGICA 507

Query: 447 LQYDCVQDY 455
            Q   + D+
Sbjct: 508 PQMSHLNDF 516

>CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 637

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 63/262 (24%), Positives = 108/262 (41%), Gaps = 33/262 (12%)

Query: 179 KGSGI-VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPETEFCTELLPKYNAK 236
           +G GI +TV      L+  L  + + ++G   PVEV     E  P+ E       +   +
Sbjct: 246 RGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAEETNQ 304

Query: 237 CIFIDRILP--DEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
            +++  + P  D      + + ++ K  A + ++FE  +LLD D          F  + +
Sbjct: 305 EVYVINLSPILDPDFASQNIKSFKNKWFAAMFNTFEEAILLDVDVVLYASPEYFFELDGY 364

Query: 295 KSKGLVLWPDFWRRTTQPLYYDIAGV------PVNLKNRVRNSFDD--LTPPEVYTENMN 346
           K  GL+LW D  R  T+    D          P   ++ +  +     LT P++  E  N
Sbjct: 365 KKTGLMLWKD--REYTEVETSDRCASMAPYFEPSEEEHELLGTIQKYRLTGPDL--ETHN 420

Query: 347 DLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN----GPTWYYPIFSQK 402
           +      +D          +SG +++NK + L  +LLA YY+++    G T+        
Sbjct: 421 ESEATTLNDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYHMSKYFGGCTY-------- 472

Query: 403 AAGEGDKETFIAAANFYGLPFY 424
               GDKE F  AA   G  +Y
Sbjct: 473 ----GDKELFEIAALAAGEDYY 490

>KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 69/310 (22%), Positives = 133/310 (42%), Gaps = 46/310 (14%)

Query: 175 SNSYKGSGIVTV-GGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLP-- 231
           SN  +G GIVT     KFS   F  ++ ++     LP+++ +  NE  + +F  E+    
Sbjct: 154 SNMAQGRGIVTTFSAKKFSDFFFRQLKVLQYHNNELPIQIIVQDNEFSD-DFIAEIAAAG 212

Query: 232 KYNAKCIFIDRI--LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIF 289
           +   + +++ +I  L D   QK+   G+  K LA + ++FE  +LLDAD  P    ++ F
Sbjct: 213 ERTKQSLYLVKISKLLDPANQKY-LSGWINKLLANLFNTFEEFILLDADVVPYAAPHTYF 271

Query: 290 NEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLS 349
           + + + S GL ++ D      + L  +   +  +  N +  S  ++     Y +  + + 
Sbjct: 272 STKEYTSTGLYMFQD------RALLSETETICTDTLNSLEPSKQEVELLGSYLQFTHTM- 324

Query: 350 GVPFHDLEGTMPDVST-------------ESGQLMVNKNKHLGTILLALYYNVNGPTWYY 396
                DL+G   + ST             E+G +  NK   +  ++ +L  N+N      
Sbjct: 325 -----DLQGKTQEESTYTALFKKKLPHNVETGLVTANKKSKMFGLVTSLMLNLNT----- 374

Query: 397 PIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGY----FENGEFHGVAMLQYDC- 451
                +A   GDKE +     F G+ +    +  ++ G+    +EN  +    +      
Sbjct: 375 ---KLRACFWGDKEFYWLGPLFAGVSYTIEPTPAALTGFPLRRYENDIYQNTTLCDTHIA 431

Query: 452 -VQDYKLYQI 460
            V+D++L  I
Sbjct: 432 HVRDHELSWI 441

>TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa]
           {ON} 
          Length = 554

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 70/316 (22%), Positives = 134/316 (42%), Gaps = 51/316 (16%)

Query: 133 YSNFDRLGYDNLV---NCLNLSGADISNLRHSHK-SFVDSLDVTLPSNSYKGSGIVTVGG 188
           ++ +DR  Y   +   + L+ S   + +++++ K SF ++   ++   + KG  ++++G 
Sbjct: 127 WTRWDRSAYSASMPHFSLLDNSFTHVESVKYNPKTSFWENWYTSMMQANSKGI-VISIGD 185

Query: 189 GKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELL------------PKYNAK 236
           G+ +    LI   +R +  TLP+++    ++G  +    E L            P     
Sbjct: 186 GQVADTIRLI-HVLRYLDNTLPIQLV---HKGDLSSAKVEELFKAARERRSDGSPPQELW 241

Query: 237 CIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKS 296
            + +  +L   MI  ++F+ +  K LAL+  SFE  +LLDAD  P   L   ++ + FK 
Sbjct: 242 IVDVKNLLNPAMI--YEFKRFSNKWLALLFCSFEKPILLDADTVPFTKLEEYYDTDQFKK 299

Query: 297 KGLVLWPDFWRRTTQPLYYDIAGVPVNLKNR--VRNSFDDLTPPEVYTENMNDLSGVPFH 354
            G V + D   RT       +    +N   R  ++  FD L        + +   G+   
Sbjct: 300 YGTVFFKD---RT-------LTAHMLNRGQRRTLKRIFDGLLTSSDRQSSADSYYGIQDP 349

Query: 355 DLEGTMPDV-------STESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEG 407
            ++  +  +         ESG +  +K KHL  +L +L    +    Y+          G
Sbjct: 350 IVQKALERILKKRQKHIMESGLVAYDKKKHLFGLLTSLALQFSPLNEYF---------HG 400

Query: 408 DKETFIAAANFYGLPF 423
           +KE F  +    G+PF
Sbjct: 401 EKEWFWISQLIRGVPF 416

>CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 628

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 111/269 (41%), Gaps = 32/269 (11%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPETEFCTELLPKYNAKC 237
           KG GI      K   +   + +   ++G T P+++     E  P  E   +       + 
Sbjct: 237 KGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEMSPTMESLIKDYAIETNQN 296

Query: 238 IFIDRILP--DEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFK 295
           +FI  + P  D        R +Q K  A + ++FE  +L+DAD        S FN + +K
Sbjct: 297 VFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEPESFFNLDGYK 356

Query: 296 SKGLVLWPD--------FWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMND 347
           + GL+LW D          R T    Y++ A     L   V+     LT P + T +  +
Sbjct: 357 NTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKY--RLTGPSLETHDEPE 414

Query: 348 LSGV--PFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAG 405
              +   FH    T+ D    SG ++ NK + L  ++LA Y++           S++ AG
Sbjct: 415 AETLFDFFHRRIVTIID----SGVVIYNKKQKLHGLILAEYFHN----------SKQFAG 460

Query: 406 --EGDKETFIAAANFYGLPFYQVKSSTSV 432
              GDKE F   A   G   Y V++  +V
Sbjct: 461 CVYGDKEYFEFGALVAGED-YHVEAEKAV 488

>TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 134/337 (39%), Gaps = 70/337 (20%)

Query: 116 YKPECRLEGDI--GSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSLDVTL 173
           + P  R  GD+  GS P   S  D   Y  L       GA  S    +   + + LD+ L
Sbjct: 123 WPPRIRWNGDLLRGSVPRFASTGD---YKYL-------GAAKSKYNKNLSFWGNWLDL-L 171

Query: 174 PSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELL--- 230
             +S KG  +++VG G+ S  A  +++ +R     LP+E+    + G  +E   +LL   
Sbjct: 172 SKSSSKGI-VISVGAGQIS-DATKLIKVLRYQMNALPIEII---HRGDLSEDQQQLLIQA 226

Query: 231 ------PKYNAKCIF---IDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFP 281
                   Y A+ ++   +  +L     ++F    Y  K LA++ SSFE+ +L+DAD  P
Sbjct: 227 ARSAHSASYPAQELWFVNVSNVLNPRHAEQF--ATYSNKWLAIIFSSFESPILVDADTIP 284

Query: 282 VKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLY---------------YDIAGVPVNLKN 326
              L   ++ + +K  GL+ + D  R  T  L                  +     +L N
Sbjct: 285 FISLEKYYDFQQYKEMGLLFFKD--RAITSDLLNKEQLNTLKQIALSTIKLGSAAADLNN 342

Query: 327 RVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALY 386
            +     D    E     +  + G   H           ESG ++++K+ HL  +L ++ 
Sbjct: 343 AIELGIKDNIAAETVMSML--VEGQKHH----------MESGLVLLDKSLHLVNLLTSVS 390

Query: 387 YNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPF 423
              +  + Y+          GDKE F  A      PF
Sbjct: 391 LQFSSISSYF---------HGDKEWFWIAYLLRNRPF 418

>CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
           YNR059w MNT4
          Length = 629

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 118/292 (40%), Gaps = 42/292 (14%)

Query: 179 KGSGI-VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKC 237
           KG GI +T+  G   L+  L  + ++R G   PV++      G  T     L+ KY  + 
Sbjct: 237 KGKGITLTIAPGDIKLLRSLF-KVLQRQGNEYPVQII--QKGGEMTPKMESLIKKYALET 293

Query: 238 ---IFIDRILP--DEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
              ++I  + P  D          +Q K  A + ++FE  LLLDAD          F  +
Sbjct: 294 EQDVYIIDLAPILDPAFAIQRITKFQNKWFASMFNTFEEALLLDADVVLYTEPEHFFKMK 353

Query: 293 PFKSKGLVLWPDFWRRTTQPLYYD-IAGVPVNLKNRVRNSFDDLTPPEVY--TENMNDLS 349
            ++  GL+LW D  R  T     D  A +  +L+  V   +  L   + Y  TE+   + 
Sbjct: 354 GYQDTGLLLWRD--RELTALETPDRCAALAPHLEPSVE-EYSLLGTRQKYRLTESSLKIH 410

Query: 350 GVP--------FHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQ 401
             P        FH    T+ D    SG ++ NK + L  ++ A Y+++          S+
Sbjct: 411 NEPEARTLYEYFHKKIVTIID----SGVVVYNKRQKLHALMTAEYFHI----------SR 456

Query: 402 KAAG--EGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQYDC 451
           K AG   GDKE F   A   G  ++  K   S  G     E+H      Y C
Sbjct: 457 KFAGCVYGDKEYFEFGAFAAGEDYHIEKDKASAIGSI---EYHSAKDKYYIC 505

>Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 72/322 (22%), Positives = 132/322 (40%), Gaps = 65/322 (20%)

Query: 124 GDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDS---LDVTLPSNSYKG 180
           GD+      +S FD  G  +    L  S  D S +  S   F  S    +  L S   KG
Sbjct: 139 GDVQDFWPIHSRFD--GSTHRGQVLEFSATDNSFIGTSRIEFNSSRPFWENWLDSAVQKG 196

Query: 181 SGIVTVGGGKFSLM-AFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELL--------- 230
           S  + +    + +  +  +++ +R +  +LP+E+    ++   +E+  +LL         
Sbjct: 197 SKGIVISVSTYQVGDSIRLIRVLRLLNNSLPIEIV---HKSDLSEYYQQLLIASARESAS 253

Query: 231 ---PKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNS 287
              P      + +  +L D+   KF  + +  K LA+   SF+  +LLD+D  P  PL++
Sbjct: 254 LDYPPQELWFLNVKSLLKDDYAAKF--KRFSNKWLAITFCSFQKPILLDSDAVPFVPLDT 311

Query: 288 IFNEEPFKSKGLVLWPDFWRRTT----------QPLYYDIAGVPVN-------LKNRVRN 330
            +  + FK  G + + D    T+          + +  D  G+P++       LKNR+  
Sbjct: 312 FYEADEFKKTGTLFFKDRSFPTSKLSLRKINVLKKVIGDCLGIPLDSKKGLELLKNRLN- 370

Query: 331 SFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
             DD+         M+ +  +     +  M     ESG L+++K KH   +L+++    +
Sbjct: 371 --DDMA--------MDAVESLFIKHQKHYM-----ESGLLVLDKQKHFFGLLVSIMLQFS 415

Query: 391 GPTWYYPIFSQKAAGEGDKETF 412
               Y+          GDKE F
Sbjct: 416 PIREYF---------YGDKEWF 428

>CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2
          Length = 627

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/263 (20%), Positives = 107/263 (40%), Gaps = 15/263 (5%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPET-EFCTELLPKYNAK 236
           +G GIV     + + M   ++  +  +   LP+++ I  N+ G  T E   E   +   +
Sbjct: 221 RGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVIQGNKFGSRTIEMLKEKAIEKKQQ 280

Query: 237 CIFIDRI-LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFK 295
              +D   L  E   +   +GY  K +A + ++FE  +LLD D  P       F ++ ++
Sbjct: 281 IYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFEKKGYR 340

Query: 296 SKGLVLWPD---FWRRTTQPLYYDIAGVPVN-LKNRVRNSFDDLTPPEVYTENMNDLSGV 351
           + G  ++ D      +  +     I+G  ++  + RV N+    +P     ++    S  
Sbjct: 341 TTGFYMYQDRNLVNEKLGRKCVDIISGAQLSGYEARVLNTGFLYSPYFAREDDYTTASAR 400

Query: 352 PFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKET 411
            ++ L         ES  +++NK + LG +L++   N           + K    GDKE 
Sbjct: 401 AYYKLFNNWTLHQAESVLVVINKKQKLGGLLMSFMLNTQ--------IALKQCFLGDKEF 452

Query: 412 FIAAANFYGLPFYQVKSSTSVDG 434
           F         P+Y  +   ++ G
Sbjct: 453 FWIGQLMNNSPYYIDERPATIVG 475

>KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 60/290 (20%), Positives = 112/290 (38%), Gaps = 37/290 (12%)

Query: 159 RHSHKSFVDSLDVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPN 218
           RH+   F   ++++       G GIVT     FS   F  ++ ++     LP+++ +   
Sbjct: 256 RHNENPFKSWMELS------DGKGIVTTFSEPFSDFFFRQLKVLQYQENKLPIQIVVKNG 309

Query: 219 EGPETEFCTELLPKYNAK---------CIFIDRILPDEMIQKFDFRGYQFKSLALVASSF 269
           E     F  E L K + +          +    IL ++ +     R Y  K +A + ++F
Sbjct: 310 E-----FTKEFLSKLSERGRQTGQRLFLVEYSEILEEKNVNLI--RKYFNKLIANIFNTF 362

Query: 270 ENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVR 329
           E  +LLDAD  P  P+ S      +K+ G+ ++ D   R       D   V +       
Sbjct: 363 EEFVLLDADAVPYSPIESFMELPEYKNTGIYMFRD---RVVDNELDDTCLVTLEHLEPTI 419

Query: 330 NSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPD----VSTESGQLMVNKNKHLGTILLAL 385
              + L    ++T  M   +G     +   M +     + E+G ++VNK +    +++ L
Sbjct: 420 EEVELLGSTLLFTSEMQKTTGSVEESIYRKMMEDRMKENVETGLVVVNKKEKFAGLVMTL 479

Query: 386 YYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGY 435
             + N           +A   GDKE +     F G  +       ++ G+
Sbjct: 480 MLSFNHKL--------QACFHGDKEFYWLGPLFAGQSYSIEPKGAALTGF 521

>KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {ON}
           Anc_7.123 YIL014W
          Length = 694

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 104/259 (40%), Gaps = 45/259 (17%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPE--TEFCTELLPKYNAK 236
           +G GIV       S M +  +   + +G  LP++V     E      E   +L  K   K
Sbjct: 285 EGKGIVLTMRESDSGMFYKQLNTFKELGNKLPIQVVTTGKEATNKFVETLGKLAKKTEQK 344

Query: 237 CIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
              +D  ++L  + +Q      +  K +A + ++FE  + +D D     P+   F  E +
Sbjct: 345 IYLVDVSKLLKPDFVQD-KIINFLNKWIATIFNTFEEEVFIDVDAISYVPMQDYFQTENY 403

Query: 295 KSKGLVLWPD-------FWRRTTQPLYYDIAGVPVNLKNRV---RNSFDDLTPPEVYTEN 344
           K  G++++ D        ++R T  L   I   P   + R+   R  FD L     + + 
Sbjct: 404 KDTGILMFRDRTLLQENTFKRCTDLL---IEAEPTKEEVRLIGSRQMFDSL-----WLKK 455

Query: 345 MNDLSGVPFHDLEGTMPDV-----------STESGQLMVNKNKHLGTILLALYYNVNGPT 393
            +D   VP  +L  T  +V             +SG + ++K   L  +L++ ++N++   
Sbjct: 456 NDD---VPDKELMSTEAEVYRNFYERLKLHHVDSGLIAIHKKYKLTGVLMSFFFNLDARL 512

Query: 394 WYYPIFSQKAAGEGDKETF 412
                    +   GDKE F
Sbjct: 513 --------SSCVYGDKELF 523

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/265 (21%), Positives = 100/265 (37%), Gaps = 40/265 (15%)

Query: 175 SNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTEL---LP 231
           S +  G GIV   G +   M F +++ +       P+++    NE    EF  E+   L 
Sbjct: 234 SKAASGKGIVITMGERDKPMLFKLLRVLEFQDNKYPIQIVTSGNELSR-EFINEIHDELQ 292

Query: 232 KYNAKCIFID-RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFN 290
           +       +D   L D    K     +  K LA++ ++FE  + LD D  P   ++  F+
Sbjct: 293 RIKQDVYLVDCGSLLDPHYSKDLIINFLNKWLAVIFNTFEEVIFLDVDVIPFVDMDYFFD 352

Query: 291 EEPFKSKGLVLWPD--FWRRTTQPLYYD-------------IAGVPVNLKNRVRNSFDDL 335
            E +KS  L+L+ D      +T P   D             + G  +   +R +  FD  
Sbjct: 353 NEEYKSSNLLLYKDRVMLHESTYPHCIDMFHEVEPSREESAVLGTKILFDSRTK-EFDH- 410

Query: 336 TPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWY 395
                     N    + F +    +     +SG ++VNK + L  +L +   +++     
Sbjct: 411 ----------NSQVAMTFRNFFRKLQLHHVDSGLIVVNKMEKLNGLLFSFMLHLDAKV-- 458

Query: 396 YPIFSQKAAGEGDKETFIAAANFYG 420
                 +    GDKE F     F G
Sbjct: 459 ------RRCVYGDKELFWIGQLFAG 477

>CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 623

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/224 (22%), Positives = 101/224 (45%), Gaps = 17/224 (7%)

Query: 179 KGSGI-VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPETEFCTELLPKYNAK 236
           +G GI +TV      L+  L  + + ++G   PVEV     E  P+ E       +   +
Sbjct: 233 RGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAEETNQ 291

Query: 237 CIFIDRILP--DEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
            +++  + P  D    + + + +  K LA + ++FE  +LLDAD       +  F  + +
Sbjct: 292 EVYVINLSPILDPDFAEENIKRFSNKWLAAMFNTFEEVMLLDADVVLYNHPDHFFELKGY 351

Query: 295 KSKGLVLWPDFWRRTTQPLYYDIAGV------PVNLKNRVRNSFDD--LTPPEVYTENMN 346
           +  GL+LW D  R  T    YD          P   ++++  +     LT P +   N +
Sbjct: 352 QDTGLMLWKD--REITDTDVYDKCTAMAPFFEPSLEEHKLLGTTQKYRLTGPSLEAHNES 409

Query: 347 DLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
           + + +  +  +  +  +  +SG ++ NK + L  ++L+ YY++N
Sbjct: 410 EATTLIDYFRKKRLNVI--DSGVVIFNKKQKLHALVLSNYYHIN 451

>CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 625

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/266 (21%), Positives = 103/266 (38%), Gaps = 37/266 (13%)

Query: 176 NSYKGSGIV---TVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPE------TEFC 226
           N  KG GIV   +V   +F    F +    + +G T P++V     E P        E+ 
Sbjct: 231 NEAKGRGIVVTASVNDCRFLRSQFFV---WKELGNTYPIQVVTKGKEMPPELIAKIKEYA 287

Query: 227 TELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLN 286
           TE         + +  +L     +K+    +  K  A + ++FE  +L+DAD       +
Sbjct: 288 TE--ADQEVYIVDLQNVLDPNYAEKY-IENFHNKWYAAMFNTFEEAILVDADVVSYVHPD 344

Query: 287 SIFNEEPFKSKGLVLWPD---------FWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTP 337
             F    FK  GL LW D          +     P +         L   ++   ++ + 
Sbjct: 345 EYFESADFKKTGLKLWRDRDIPDIHVHIYCLNMAPYFLPSKEEHRTLGTTLKYRLEEESL 404

Query: 338 PEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYP 397
            +  T   + L    F +  G++ D    SG ++ NK K L +++++ +++ +       
Sbjct: 405 KDAGTSEADGLHKF-FFEKSGSIVD----SGLVVFNKKKKLHSLIISEFFHTDAKF---- 455

Query: 398 IFSQKAAGEGDKETFIAAANFYGLPF 423
               K    GDKE F+  A   G+ +
Sbjct: 456 ----KPCTYGDKEIFMLGAYSAGVDY 477

>AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homolog
           of Saccharomyces cerevisiae YIL014W (MNT3) and YER001W
           (MNN1)
          Length = 381

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 51/211 (24%), Positives = 87/211 (41%), Gaps = 43/211 (20%)

Query: 206 GTTLPVEVFIPPNEGPETEFCTELL------PKYNAKCIFIDRIL-PDEMIQKFDFRGYQ 258
           G TLP+E+ +   E P  E   ++        K + + +   +IL P      FDFR   
Sbjct: 9   GNTLPIELVL--TESPSHERIQKIAHYLRDKTKQSLRIVDCKKILEPSYRPLIFDFR--- 63

Query: 259 FKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPD-------------- 304
           +K LA + +S E  + +D D  P   ++  F  E +KS G++++ D              
Sbjct: 64  YKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRVFNSIKNSKCRTA 123

Query: 305 ----FWRRTTQPLYYDIAG-VPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGT 359
                     Q L+   A       K+R++N  DD     VY      L G   H     
Sbjct: 124 IHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRY---LEGDRMH----- 175

Query: 360 MPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
                 ESG ++V+K K + +++++L  ++N
Sbjct: 176 ----MVESGLVVVDKRKKISSLIISLMLHMN 202

>ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the
           fourth and fifth alpha-1 3-linked mannose residues to
           O-linked glycans during protein O-glycosylation
          Length = 641

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 111/283 (39%), Gaps = 27/283 (9%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKY----N 234
           KG GI          +    ++ + ++  TLP++V     E    +   + L +Y    +
Sbjct: 238 KGKGIAATFNPTELTLFHRQLRVLSKLNNTLPIQVVTSGFEFTRAQ--VDQLSQYARDTD 295

Query: 235 AKCIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
            +   ID   IL  E  Q  +   +  K LA + ++FE  LLLD D  P   +   F E 
Sbjct: 296 QEVTLIDCSTILIKEFTQN-NVEKFVNKWLAALFNTFEEVLLLDVDTVPFVDVEEFFKEP 354

Query: 293 PFKSKGLVLWPDFWRRTTQPLYY---DIAGV-PVNLKNRVRNS--FDDLTPPEVYTENMN 346
            +++ G+ L+ D          Y    +AG+ P + +N++  +    + T  E+      
Sbjct: 355 QYRATGMALFKDRAMMDEHTYGYCLETLAGLEPSHEENKLMGTKLLFESTQKELPQTEAA 414

Query: 347 DLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGE 406
            +    FHD  G +  V  +SG + VNK K+ G +L +   N++           +    
Sbjct: 415 SVYRRFFHD--GVLHHV--DSGLVPVNKVKNFGGLLFSFMINLDTKI--------QGCVH 462

Query: 407 GDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAMLQY 449
           GDKE F     + G  +        V G  E+     +    Y
Sbjct: 463 GDKEFFWLGQLYAGKNYAIYPQDAGVIGLIEDKPMEALTQTSY 505

>KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P39106 Saccharomyces
           cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
           integral membrane glycoprotein of the Golgi complex
           required for addition of alpha1 3-mannose linkages to N-
           linked and O-linked oligosaccharides one of five S.
           cerevisiae proteins of the MNN1 family
          Length = 569

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 119/280 (42%), Gaps = 30/280 (10%)

Query: 149 NLSGADISNLRHS-HKSFVDSLDVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGT 207
           ++S   IS  R++  +S++ + + T    S    GIV       + +   +++ +   G 
Sbjct: 151 SMSNGAISKYRYNPQQSWLANWNRTSQETSGPTRGIVLSFPDAHASLVVRLLKVLEHQGN 210

Query: 208 TLPVEVFIPPNEGPETEFCTELLPKY---NAKCIFID--RILPDEMIQKFDFRGYQFKSL 262
            LP+++    ++G  +++   L+ +    N +  F++   +L    I   DF  Y+ K L
Sbjct: 211 RLPIQII---HKGDLSDYSRSLISRSLPPNQRLWFVNVKPMLDPHFID--DFSLYRNKWL 265

Query: 263 ALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPV 322
           A++ ++F   + +DAD   V+P+      E +   G + + D  R       Y+   VP+
Sbjct: 266 AMIFNTFSTPIFIDADAVSVQPVEDYLQSEAYVESGTIFFRD--RAFAHKFDYEYC-VPL 322

Query: 323 NLK----NRVRNSF---DDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKN 375
            LK    +R+   +     L   ++   +   L                 +SG L V+K+
Sbjct: 323 -LKALQPSRLETLYFGQRRLIDEQLMMSDSTSLEQRIVQSFFVGGQRHQMDSGLLAVDKS 381

Query: 376 KHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAA 415
           KHL  ++  ++ N+       P  S+     GDKETF  A
Sbjct: 382 KHLMPLMAGVFLNLA------PKLSK--CTHGDKETFWLA 413

>NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa]
           {ON} 
          Length = 664

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/271 (20%), Positives = 104/271 (38%), Gaps = 34/271 (12%)

Query: 180 GSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKY-----N 234
           G GIV         M   +V     MG  LP+++          +F  E +        N
Sbjct: 262 GKGIVVTMKDLDKNMFEGLVTVFEEMGNKLPIQLV-----STGKDFTKETMDHLQNFAKN 316

Query: 235 AK--CIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFN 290
           AK    ++D   +L  + ++K + + Y  K + ++ ++FE  +  DAD+ P         
Sbjct: 317 AKQDVYYVDCSPMLDQDFVEK-NIKSYVNKWIGVLFNTFEELVFFDADSVPFIAPEKFLE 375

Query: 291 EEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKN-------RVRNSFDDLTPPEVYTE 343
              +K  G   + D      +   Y I  + V   +       + +  F+ L PPE  + 
Sbjct: 376 NSEYKKTGAYFFRDRSLGNDRTFQYCIDMIQVMEPSKEEKKLIKSKTKFETLNPPETKSS 435

Query: 344 NMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKA 403
           +   +    F + +      + +SG +M+NK + +G +L+  + +++           K 
Sbjct: 436 SEAAIFNSFFQNFQHN----NVDSGVVMLNKKQKMGGLLMGFFLHLDA--------KMKK 483

Query: 404 AGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
              GDKE F       G  +   KS  S+ G
Sbjct: 484 CVSGDKEMFWLGNLLAGQDYSIAKSYGSIAG 514

>CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {ON}
           some similarities with uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 642

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/192 (22%), Positives = 79/192 (41%), Gaps = 39/192 (20%)

Query: 240 IDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGL 299
           +D+   DE I KF       K + ++ ++FE  +++DAD  P       F  E FK  G+
Sbjct: 311 LDKNFADEHITKF-----HNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENFKKSGM 365

Query: 300 VLW--------------PDFWRRTTQPLY-YDIAGVPVNLKNRVRNSFDDLTPPEVYTEN 344
            +W              PD   +    L  + I G  +  K         L  P++  E 
Sbjct: 366 RMWRDRTLTNRHIREHCPDLALKLEPSLEEHRILGTTLRFK---------LLDPDLKQEK 416

Query: 345 MNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAA 404
            ++     F+ +   +     +SG +++NK + L ++LL+ ++        + +F  +  
Sbjct: 417 TSEERA--FNQMRTNLALHHVDSGLVVINKKEKLHSLLLSEFFQ------NHALF--RRC 466

Query: 405 GEGDKETFIAAA 416
             GDKE F  AA
Sbjct: 467 SYGDKELFWYAA 478

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 91/201 (45%), Gaps = 40/201 (19%)

Query: 227 TELLPKYNAKCIF---IDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVK 283
           +E  P+Y A+ I+   +  +L  +   KF    Y  K LAL+ S FE  +LLD+D  P  
Sbjct: 234 SEDTPEYPAQEIWFSNVRNLLSPKYSNKF--ATYSNKWLALIFSFFEVPILLDSDTVPFV 291

Query: 284 PLNSIFNEEPFKSKGLVLWPDFWRRTTQPLY------------YDIAGVPVNLKNRVRNS 331
           P++  +  E F+  G + + D  R  +  L+            +   G+ +  ++ +   
Sbjct: 292 PIDEFYKLEEFQRTGALFFKD--RIISNDLFESSQLDVLKEIIHGCIGLNLTDESDIHEK 349

Query: 332 FDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNG 391
            +D T  +V  ENM  L     H L         ESG ++++K+KHL ++L+++    + 
Sbjct: 350 IEDPTVVQV-LENM--LIKKHKHHL---------ESGLVVLHKDKHLFSVLISVALQFSP 397

Query: 392 PTWYYPIFSQKAAGEGDKETF 412
            + Y+          GDK+ F
Sbjct: 398 ISEYF---------HGDKDWF 409

>Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}
           YGL257C (MNT2) - Mannosyltransferase [contig 247] FULL
          Length = 568

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 68/303 (22%), Positives = 112/303 (36%), Gaps = 51/303 (16%)

Query: 172 TLPSNSYKGS--------GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPN--EGP 221
           T  SN Y+ S        GIV         +   +++ +      LP++V    +  E  
Sbjct: 164 TWTSNWYRLSSQGREPTRGIVLSFPDSHVSLVIRLLKVLHHQKNELPIQVIHKGDLSEAS 223

Query: 222 ETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFP 281
           +      L P  N   + +  +L    ++  DF GY+ K LA++ ++F   + +DAD   
Sbjct: 224 KNLISEALSPSQNLWFVDVSSMLNKRFVR--DFSGYKNKWLAMILNTFSEAVFIDADAVS 281

Query: 282 VKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVY 341
           +      F    +   G + + D  R       YD   VP+            L P +  
Sbjct: 282 MMSFEDYFEMGLYNQTGALFFKD--RAFDHKFDYDFC-VPM---------IKSLQPGKHE 329

Query: 342 TENMNDLSGVPFHDLEGTMPDVSTE-----------------SGQLMVNKNKHLGTILLA 384
           T        +    L  T  D STE                 SG +++ K KHL  +L A
Sbjct: 330 TRYFQHRKRLIDLQLRNTQ-DPSTEQTIIKDFFEGYQRHQMDSGLVLIEKGKHLTPLLAA 388

Query: 385 LYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPF-YQVKSSTSVDGYFENGEFHG 443
           ++ N+       P  S+     GDKETF  A       F +  + ++++    ENGE   
Sbjct: 389 VFLNLA------PKLSK--CTHGDKETFWLAFLLMNHEFSFHPEEASAIGKADENGEICS 440

Query: 444 VAM 446
           V +
Sbjct: 441 VQL 443

>Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W
           (REAL)
          Length = 630

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 101/238 (42%), Gaps = 30/238 (12%)

Query: 209 LPVEVFIPPNEGPETEFCTEL---LPKYNAKCIFID--RILPDEMIQKFDFRGYQFKSLA 263
           LP ++ I   EG  TE   E+     +   K   +D   +L  E  +K+    +Q K +A
Sbjct: 263 LPFQI-ITTGEGLSTESIAEISKIAKEAKQKVYLVDCSTVLDTEFSKKY-ISFFQNKWVA 320

Query: 264 LVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGV-PV 322
            + ++F+  +LLDAD  P    +  F+   ++  G++L+ D   ++ Q   Y I  +  V
Sbjct: 321 TLFNTFKEYILLDADVVPFVESDYFFDSPSYRQSGILLFKDRVMKSEQTFSYCIEMLREV 380

Query: 323 NLKNRVRNS------FDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNK 376
               + R S      FD   P      ++N      +++    +     +SG ++VNK +
Sbjct: 381 EPSGQERKSIGSKLIFDSSLP----FSSINSEEASVYYNFFKKLQLHHVDSGLVVVNKLE 436

Query: 377 HLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDG 434
            L  +L++  +N+NG          +    GDKE F     + G    Q  S   VDG
Sbjct: 437 KLNGLLMSFMFNLNGKL--------QRCVYGDKEIFWLGQLYAG----QDYSINPVDG 482

>Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 46/230 (20%), Positives = 93/230 (40%), Gaps = 31/230 (13%)

Query: 198 IVQNIRRMGTTLPVEV--------------FIPPNEGPETEFCTELLPKYNAKCIFIDRI 243
           +++ +R +  +LP+E+               I   E    ++     P      + +  +
Sbjct: 215 LIRTLRLLNNSLPIEIVHKSDLDERYQQLLIISARESASLDY-----PPQELWFLDVQSM 269

Query: 244 LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWP 303
           L D+ + KF  + +  K LA+  SSF+  + LD+D  P  P+++++  + F   G + + 
Sbjct: 270 LSDDYLGKF--KRFSNKWLAITFSSFQVPIFLDSDTVPFAPVDTLYQTDEFIRTGTLFFR 327

Query: 304 DFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMND-LSGVPFHDLEGTMPD 362
           D     ++     I  +   + N +  S D     E+   ++ND ++      L      
Sbjct: 328 DRSFPNSKLSLLQIKVLKQIINNSLGISLDSGQDFELLKNSLNDKIATNAIESLIFKQQK 387

Query: 363 VSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETF 412
              +SG L+ +K KH   + +A+    +    Y+          GDKE F
Sbjct: 388 HHMDSGLLIFDKQKHFFCLPIAIMLQFSPIQEYF---------HGDKEWF 428

>TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {ON}
           Anc_7.123 YIL014W
          Length = 641

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 180 GSGIV-TVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNA--K 236
           GSGIV T+  G  +L+ +  ++       TLP+++    N+  +  F  EL  K  A  +
Sbjct: 251 GSGIVITLNEGSKNLL-YKQLKVFDHSDNTLPIQIITTGNDFSDG-FIEELKAKVAASKQ 308

Query: 237 CIFIDRILP--DEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
            +++    P  D    K        K +A++ ++FE ++LLD D  P  P++    E+ +
Sbjct: 309 NVYLVDCSPILDSEFAKEHIGDIINKWIAVIFTTFEESILLDVDAVPFVPMDDFLTEKSY 368

Query: 295 KSKGLVLWPD 304
           K+ G++++ D
Sbjct: 369 KASGILMYKD 378

>YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putative
           alpha-1,3-mannosyltransferase, not required for protein
           O-glycosylation
          Length = 580

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 16/173 (9%)

Query: 243 ILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLW 302
           +L DE + +F  + +  K LA+   SF+  + LD+D  P  PL++++  + FK  G + +
Sbjct: 269 MLNDEYLARF--KRFSNKWLAITFCSFQIPIFLDSDTVPFVPLDTLYEIDGFKRTGTLFF 326

Query: 303 PD--FWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGV-PFHDLEGT 359
            D  F      PL   +    +N  N +  S D     E+   N+ND   +     L   
Sbjct: 327 KDRSFPTSKLSPLQVKVLKQIIN--NSLDVSSDSEQGFEILKHNLNDEMAIDAIEALIFK 384

Query: 360 MPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETF 412
                 +SG ++ +K KH   + +A+         + PI   +    GDKE F
Sbjct: 385 KQKHYMDSGLVIFDKQKHFFCLPIAIMLQ------FSPI---QEFFHGDKEWF 428

>TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON} 
          Length = 736

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 85/382 (22%), Positives = 136/382 (35%), Gaps = 93/382 (24%)

Query: 163 KSFVDSLDVTLPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEV--------- 213
           K+F  + ++ L S   K   I++   G+ +  A  ++  +R MG  LP+++         
Sbjct: 289 KTFWSNWNI-LSSKVGKRGIILSFSDGQ-TETALRLISTLRFMGNRLPIQIIFKNDISDK 346

Query: 214 -------------FIPPNEGPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFK 260
                        + P N+    E   ++  K N   + I+ +L  +   KF    ++ K
Sbjct: 347 SIEQVFYVATNKNYKPFNDQVNWEHKNDV--KQNVYFVDIENLLDPKYKDKF--SRFKNK 402

Query: 261 SLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGV 320
            LA   + FE  L +D D       N  F  + +K  G V + D   RT    + D A  
Sbjct: 403 WLASNFNMFEEFLFIDTDAITYIDPNDYFELQEYKESGTVFFRD---RTWPKQWGDEAKC 459

Query: 321 PVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVST--------------- 365
                    +S   L PP +        +  P  D++      ST               
Sbjct: 460 ---------SSLMSLLPPRILESKY--FNNYPLFDVDYIKETPSTRLSIEEKIYKRYFEN 508

Query: 366 ------ESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY 419
                 ESG   +NKNKH+ +IL     N++  T        ++ G GDKE F       
Sbjct: 509 GRIHQMESGVFAINKNKHIISILTGTILNIDHVT--------ESCGYGDKEFFWFGFMIS 560

Query: 420 GLPFYQVKSSTSVDGYF---------ENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYG 470
           G  +    ++  V G +         E GE   V +  +    D KL  I     + K+G
Sbjct: 561 GHKYRFYNTTVGVIGNYDPIHKSDVQEVGEICSVQISHF--THDNKLMWINGGSNNCKFG 618

Query: 471 -----------LSRVGNSASQK 481
                      L R+G S S K
Sbjct: 619 GFSDKDWDKKELKRLGKSFSSK 640

>ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 641

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 62/132 (46%), Gaps = 11/132 (8%)

Query: 180 GSGI-VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPE------TEFCTELLPK 232
           G GI ++VG G   ++  ++   +  +G  LP+E+     E  +      TEF      K
Sbjct: 244 GKGITMSVGDGHLEMLLRMLTV-LDYLGNELPIEIVEKGGELSQQFRDKLTEFVRNK-SK 301

Query: 233 YNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
              + I   R L DE   +  F G+  K +AL+ ++FE  + LD D  P       F+ E
Sbjct: 302 QKVRIISCARTL-DETHARLIF-GFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDME 359

Query: 293 PFKSKGLVLWPD 304
            +KS G++L+ D
Sbjct: 360 GYKSTGIMLFRD 371

>CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 620

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 57/143 (39%), Gaps = 31/143 (21%)

Query: 179 KGSGIV-TVGGGKFSLMAFLIVQNIR---RMGTTLPVEVFIPPNEGPETEFCTELLPKYN 234
           +G GIV TV      L+     Q  R    +G  LP++V    ++G  TE   EL  K  
Sbjct: 231 RGKGIVLTVSQSDVPLLR----QQFRVWKELGNKLPIQVV---HKG--TEINAELEQKIK 281

Query: 235 AKCI-------------FIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFP 281
              I              ID    +  IQ F  + Y     A + ++FE  +L+DAD  P
Sbjct: 282 EYAIEMEQDVYVVDLSPVIDPDFAENSIQNFHNKWY-----AAIFNTFEELILIDADAIP 336

Query: 282 VKPLNSIFNEEPFKSKGLVLWPD 304
             P       + +K  GL LW D
Sbjct: 337 YVPAEDFLKSKSYKKTGLRLWRD 359

>Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL257C
           (REAL)
          Length = 562

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 68/145 (46%), Gaps = 24/145 (16%)

Query: 254 FRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPL 313
           F  Y  K LAL+ SSFE  +LLD+D  P   ++  +  E F+  G++ + D  R  +  L
Sbjct: 254 FATYSNKWLALIFSSFEIPILLDSDTVPFVSIDKFYKLEEFQKTGVLFFKD--RVISDDL 311

Query: 314 Y------------YDIAGVPVNLKNRVRNSF-DDLTPPEVYTENMNDLSGVPFHDLEGTM 360
           +            +   G+ +  ++++R++  + +  P V     N L     H L    
Sbjct: 312 FDPPQLEVLKDIIHGCTGINLLDESKIRDNIAEHIREPTVARVLENMLIKKYKHHL---- 367

Query: 361 PDVSTESGQLMVNKNKHLGTILLAL 385
                ESG ++++K KHL ++L ++
Sbjct: 368 -----ESGLVVLHKGKHLFSMLTSI 387

>SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]
           {ON} similar to uniprot|P53059 Saccharomyces cerevisiae
           YGL257C MNT2 Mannosyltransferase involved in adding the
           4th and 5th mannose residues of O-linked glycans
          Length = 577

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 81/208 (38%), Gaps = 30/208 (14%)

Query: 125 DIGSRPDDYSNFDRLGYD--NLVNCLNLSGADI---SNLRHSHK--SFVDSLDVTLPSN- 176
           DI +R   Y NFD L  D  N          D+   S  R S    +++DSL +    N 
Sbjct: 110 DIETRLFPYLNFDGLSSDEENFWPVRTRWNGDVYKASTPRFSSNDDTYLDSLGIAYNKNI 169

Query: 177 ----------SYKGSGIVTVGGGKFSLM-AFLIVQNIRRMGTTLPVEVF----IPPNE-- 219
                        GS  + +  G+F       +++ +R +   LP+EV     + P+   
Sbjct: 170 SFWENWLQKVMQSGSRGIVLSIGQFQTADTIRLIRILRFLKNNLPIEVVHKGDLSPHHQS 229

Query: 220 ---GPETEFCTELLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLD 276
              G   E  ++  P      + +  +L  +   KF    Y  K LAL+  SFE  +LLD
Sbjct: 230 VLIGAAREDLSDEYPGQELWFLDVTNMLNPQYSAKFT--RYSNKWLALLFCSFEQPILLD 287

Query: 277 ADNFPVKPLNSIFNEEPFKSKGLVLWPD 304
           AD  P       +  E FK+ G   + D
Sbjct: 288 ADTVPFTTFERYYQSEQFKNSGTFFFKD 315

>TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON} 
          Length = 747

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 63/146 (43%), Gaps = 31/146 (21%)

Query: 184 VTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-----------------------G 220
           + +G G+  L A  ++  +R  G TLP+++ +   E                        
Sbjct: 324 MCIGDGQLKL-ALKLITTLRYSGNTLPIQIIMKKGELSKGSIEKLIFAAQGNNFKFRIDK 382

Query: 221 PETEFCTELLPKYNAKCIFIDRILPDEMIQKF--DFRGYQFKSLALVASSFENTLLLDAD 278
            E +  +  +P+   + +F D  + D +  +F  DF+ ++ K LA + + FE  + LDAD
Sbjct: 383 DEYKPASSYMPQ---EILFTD--ITDLLDPEFLNDFQWFKNKWLASIFNVFEENIFLDAD 437

Query: 279 NFPVKPLNSIFNEEPFKSKGLVLWPD 304
             P   LN  FN + +   G + + D
Sbjct: 438 VVPYVDLNFFFNTKEYNETGTIFFKD 463

>CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 636

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 39/156 (25%), Positives = 58/156 (37%), Gaps = 19/156 (12%)

Query: 176 NSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFC-TELLPKYN 234
           N  KG GI      K   M   +   + + G  LP+++    ++G        EL+  Y 
Sbjct: 245 NMAKGKGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQII---DKGETLTLADKELIKSYA 301

Query: 235 AKC----------IFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKP 284
            K             ID    DE I      G   K  A + ++FE  LLLD D  P   
Sbjct: 302 VKTNQDVSVVDLSPIIDAEYADENII-----GMHNKWFAAMFNTFEEVLLLDVDVIPFVG 356

Query: 285 LNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGV 320
               F  EP+ S+ ++ W +   +   P Y   A +
Sbjct: 357 TEKFFQLEPYTSRHILFWRNRDIKKKNPKYCPEAAI 392

>YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}
           MNT2Mannosyltransferase involved in adding the 4th and
           5th mannose residues of O-linked glycans
          Length = 558

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 64/144 (44%), Gaps = 26/144 (18%)

Query: 254 FRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPL 313
           F  Y  K LAL  SSFE  +L+D+D  P   +   +  E F+  G++ + D  R  +  L
Sbjct: 255 FTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKD--RVISDDL 312

Query: 314 Y------------YDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361
           +            Y   G+ +  ++++    +D    +V  ENM  +     H       
Sbjct: 313 FESSELKILREIVYGCIGLDLEDESKIHEQVEDPVVAQV-LENMF-IKKYKHH------- 363

Query: 362 DVSTESGQLMVNKNKHLGTILLAL 385
               ESG ++++K KHL ++L ++
Sbjct: 364 ---LESGLVILHKGKHLFSMLTSI 384

>Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W
           (REAL)
          Length = 625

 Score = 38.5 bits (88), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 110/267 (41%), Gaps = 29/267 (10%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPETEFCTELLPKYNAKC 237
           K  G V   G K   +    ++ +  +   LP ++    NE  PE+      + K   + 
Sbjct: 232 KERGFVLTMGEKDVPLFLKQLKVMELLENVLPFQIITTGNELSPESIAKISKVAKEGGQK 291

Query: 238 IFI---DRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
           +++     +L  E  + F    +Q K +A + ++FE  +LLDAD  P    +  F+   +
Sbjct: 292 VYLMDCSTVLDAEFSKTF-ISFFQNKWVATLFNTFEEFILLDADVVPFVKSDYFFDSPSY 350

Query: 295 KSKGLVLWPDFWRRTTQPLYYDI---AGV-PVNLKNRVRNS---FDDLTPPEVYTENMND 347
           K  G++L+ D   +      Y +   +GV P   ++R+ +S   FD        +E    
Sbjct: 351 KRSGILLFKDRVMQNEHTFEYCVEMLSGVEPSGQEHRLISSKLLFDSSLSFPSSSEE--- 407

Query: 348 LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEG 407
                +++    +     +SG ++VNK + +  +L++   N++G          +    G
Sbjct: 408 --AAVYYNFFEKLQLHHVDSGLVVVNKREKINGLLMSFMLNLDG--------KMQRCVYG 457

Query: 408 DKETFIAAANFYGLPFYQVKSSTSVDG 434
           DKE F     + G    Q  S   VDG
Sbjct: 458 DKEIFWLGQLYAG----QDYSINPVDG 480

>TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 34/142 (23%), Positives = 57/142 (40%), Gaps = 19/142 (13%)

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEF--------CTELLPKY 233
           G++   G K    A  ++  +R    TLP+++ I  N+  +             E+  K 
Sbjct: 323 GVILSFGDKHLKWALKLIMALRYRQNTLPIQIIITKNDLSKNSMEKILFAAQSDEVQIKD 382

Query: 234 NAKCIFIDRILPDEMI----------QKFD-FRGYQFKSLALVASSFENTLLLDADNFPV 282
               +  D     E+I          + FD F G++ K LA + + FE  + LDAD    
Sbjct: 383 KKGNVMKDVFTKQEIIFVDVTNIIDPEFFDNFTGWKSKWLASIFNLFEEYIFLDADAISY 442

Query: 283 KPLNSIFNEEPFKSKGLVLWPD 304
             LN  FN + +   G + + D
Sbjct: 443 VDLNHYFNTKEYNETGTIFFRD 464

>KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014W MNT3 Alpha-1 3-mannosyltransferase
           adds the fourth and fifth alpha-1 3-linked mannose
           residues to O-linked glycans during protein
           O-glycosylation
          Length = 623

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 51/103 (49%), Gaps = 4/103 (3%)

Query: 205 MGTTLPVEVFIPPNEGPETEFCTEL---LPKYNAKCIFIDRILPDEMIQKFDFRGYQFKS 261
           +G  LP+++    NE  E +F   L   L + + +  +I+     E +   +   +  K 
Sbjct: 247 LGNKLPIQIVQRENELSE-QFLNALSSFLQRSHQRVYYINCGAILEPLYGLEMTYFVNKW 305

Query: 262 LALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPD 304
           +A + ++F   +L+DAD  P  PL   F+++ +   G++L+ D
Sbjct: 306 IASIFNTFSEVILMDADVIPFIPLEEFFDDDQYNRSGVLLYKD 348

>Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/247 (19%), Positives = 94/247 (38%), Gaps = 33/247 (13%)

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPET---------EFCTELLPK 232
           G+V             +++ +R +  +LP+E+    +    +         E  +   P 
Sbjct: 199 GLVMSASDALVSDTIRLMRILRLLNNSLPIEIVHKSDLSKSSQQLLIASARESASSNYPP 258

Query: 233 YNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
                + +  ++ DE + +F  + +  K LA+  SSF+  + LD+D  P  PL+  +   
Sbjct: 259 QELWFLDVKSLIKDEYLNRF--KRFSNKWLAITFSSFQMPIFLDSDTVPFVPLDGFYRTG 316

Query: 293 PFKSKGLVLWPD-------FWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENM 345
            F+  G + + D          + T+ L   I    + + +     F+ L         +
Sbjct: 317 EFERTGTLFFKDRSFPLSKLSSQQTKAL-RQIINNSLGISSNSEQGFESLKNSSKDDTAI 375

Query: 346 NDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAG 405
             +  V F   +  M     +SG L+++K KH   + +A+    +    Y+         
Sbjct: 376 GAIDSVIFKQQKHYM-----DSGLLVIDKQKHFFCLPIAIMLQFSPIQEYF--------- 421

Query: 406 EGDKETF 412
            GDKE F
Sbjct: 422 HGDKEWF 428

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 47/231 (20%), Positives = 95/231 (41%), Gaps = 25/231 (10%)

Query: 176 NSYKGSGIV-TVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPN------EGPETEFCTE 228
           N  KG G+V T+      ++  L  + ++  G TLP+++    N      +     +  E
Sbjct: 251 NEAKGKGLVITIESNNLHILRKLF-KFLKENGNTLPIQLVFKRNVTLARFKDAIISYAEE 309

Query: 229 LLPKYNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSI 288
                +   I I+ ++ D+   K  F GY  K LA + ++FE+ +++D +  P      +
Sbjct: 310 --SDQHVTIIEIEALI-DDSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEEL 366

Query: 289 FNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLT------PPEVYT 342
              E +K+ GL +W D +       Y     +  ++   +  S D+        P  +  
Sbjct: 367 LENEEYKNSGLYMWRDKYLGALLHAY-----ICTDVMKSLEPSMDEYKTIGSKFPLRMND 421

Query: 343 ENMNDLS---GVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVN 390
             + D S   G   H           + G +++NK + LG +++ +  N++
Sbjct: 422 PRLTDTSDPMGAILHGYYNLYLMHQVDGGVILLNKKQKLGGLIMGMVMNMH 472

>KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} similar
           to uniprot|P39106 Saccharomyces cerevisiae YER001W MNN1
           Alpha-1 3-mannosyltransferase integral membrane
           glycoprotein of the Golgi complex required for addition
           of alpha1 3-mannose linkages to N-linked and O- linked
           oligosaccharides one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 746

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 58/261 (22%), Positives = 104/261 (39%), Gaps = 39/261 (14%)

Query: 173 LPSNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVF-----------IPPNEGP 221
           + S S K   I+  G G+      LI   +R  G  LP+++            +      
Sbjct: 328 MSSASGKRGIILAAGDGQVDQCIRLIA-TLRAQGNALPIQIIHNNQLNEKSVKLLSEAAK 386

Query: 222 ETEFCTELLPKYNAKCIFIDRILPD-EMIQKFDFRGYQFKSLALVASSFENTLLLDADNF 280
            TEF +       A+ +++  + P  E   K +F  ++ K L+++ ++FE  + +D D  
Sbjct: 387 STEFSSG-----RAQSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAI 441

Query: 281 PVKPLNSIFNEEPFKSKGLVLWPDF-----WRRTTQPLYYDIAGVPVNLKNRVRNSFDDL 335
               +   FN + +KS G + + D        +   PL+  +   P  L+    N+   +
Sbjct: 442 SYINMADYFNFKEYKSTGTLFFKDRSLAIGTEQKCGPLFETLE--PRILEMYYFNTLPMI 499

Query: 336 TPPEVYTENMNDLSGVPFHDLEGTMPDV----STESGQLMVNKNKHLGTILLALYYNVNG 391
               V  + M  L+  P   +     +V    + ESG L +NKN+H+  ++ A   N+  
Sbjct: 500 NGDYVEQQCMGMLT--PEEKVYKRFFEVGHQHNLESGLLAINKNEHIMGLVTATVLNIAP 557

Query: 392 PTWYYPIFSQKAAGEGDKETF 412
                        G GDKE F
Sbjct: 558 KV--------GGCGWGDKEFF 570

>TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/144 (22%), Positives = 57/144 (39%), Gaps = 24/144 (16%)

Query: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNA------ 235
           GI+     K    A  ++ ++R  G TLP+++     +  +      +    N       
Sbjct: 258 GIIMSFTDKEVDWAIRLLVSLRYQGNTLPIQIIYTDGDLTDENIQRLIFAAQNGNVRVPY 317

Query: 236 -------------KCIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNF 280
                        + +F+D  ++L    ++ F F+G   K LA   + FE  + LDAD  
Sbjct: 318 KNGAPRPGQLTVQEIMFLDVTKMLDSNFVEDFKFKG---KWLASFFNLFEEHIFLDADTV 374

Query: 281 PVKPLNSIFNEEPFKSKGLVLWPD 304
           P   LN  FN + +   G + + D
Sbjct: 375 PYVDLNYFFNTQEYNQTGTLFFRD 398

>YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}
           MNT3Alpha-1,3-mannosyltransferase, adds the fourth and
           fifth alpha-1,3-linked mannose residues to O-linked
           glycans during protein O-glycosylation
          Length = 630

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 65/272 (23%), Positives = 112/272 (41%), Gaps = 54/272 (19%)

Query: 257 YQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYD 316
           +Q K +A + ++FE  +LLDAD  P    +  F+   ++  G++L+ D      Q   Y 
Sbjct: 314 FQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFKDRVMENEQTFQYC 373

Query: 317 IAGV----PVNLKNRV---RNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQ 369
           I  +    P   + R    R  FD   P   ++   ++ + V +++    +     +SG 
Sbjct: 374 IEMLNEVEPSAQERRFIGSRLVFDSSLP---FSSETSEEASV-YYNFFKKLRLHHVDSGL 429

Query: 370 LMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSS 429
           ++VNK + L  +L++   N++G          +    GDKE F     + G    Q  S 
Sbjct: 430 VVVNKLEKLNGLLMSFMLNLDGKL--------QRCVYGDKEIFWLGQLYAG----QDYSI 477

Query: 430 TSVDGYF--------ENGEFHGVAMLQYDC-------------------VQDYKLYQIAK 462
             VDG          EN + H   M  Y C                   ++  K+   A+
Sbjct: 478 NPVDGSIIGPVNEEPENDDGHKSGMY-YICSTQIAHSDSKNRLLWVNGGLKTCKISNSAE 536

Query: 463 DDI--DVKYGLSRVGNSASQKRISFDKSYSLE 492
           DD   + +Y  SR G+ +  KRI +D S ++E
Sbjct: 537 DDFGREPEYFKSRYGDISKLKRI-YDASLNVE 567

>Suva_5.87 Chr5 (129322..131622) [2301 bp, 766 aa] {ON} YER001W
           (REAL)
          Length = 766

 Score = 36.6 bits (83), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/186 (20%), Positives = 79/186 (42%), Gaps = 39/186 (20%)

Query: 183 IVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELL-----PKYN--- 234
           ++++G  +FSL A   + ++R  G TLP+++    +E P+ E   +L+     P++    
Sbjct: 326 VLSLGSNQFSL-AVKFIASLRFQGNTLPIQIIYRGDELPQ-EMVEKLMYAARSPEFKPIE 383

Query: 235 ----------AKCIFID---RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFP 281
                      +  F+D    + PD    K DF  Y+ K L ++ + F+  + LD D   
Sbjct: 384 NSYDNSTNVPQELWFLDVSNTVHPD---WKGDFGSYKSKWLVVLFNLFQEFVFLDIDAIS 440

Query: 282 VKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVY 341
            + ++  F    ++  G V             +Y    +  N+  R    ++ L P ++ 
Sbjct: 441 YQEIDKYFESPEYQKTGTV-------------FYRERSLNENVHERCIARYETLLPRKLE 487

Query: 342 TENMND 347
           +EN  +
Sbjct: 488 SENFQN 493

>TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {ON}
           
          Length = 730

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 69/316 (21%), Positives = 130/316 (41%), Gaps = 55/316 (17%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIP-PNEGPETEFCTEL---LPKYN 234
           K  GI      +  +M   ++  +     TLP+++     NE  +  F  EL   L   N
Sbjct: 306 KDKGISMTMRSEDLMMFKKMINVLDFQNNTLPIQIITKGNNELTKENFINELQSFLQNNN 365

Query: 235 A-KCIFI---DRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFN 290
           + + +FI   + +L    ++      +  K ++++ S+F+ T+ LD D+ P   L+  + 
Sbjct: 366 STQTVFIVNVETLLNKHYVENM-LNFFYNKWVSIIFSTFKETIFLDVDSIPFVNLDEFYF 424

Query: 291 EE--------PFKSKGLVLWPDFW-------------RRTTQPLYYDIAGVPVN-LKNRV 328
           +E         +K  G++++ D                +  +P   +   +  N L N  
Sbjct: 425 QENNINNDYKNYKDTGMLMYKDRMLINEFTFGYCMDALKFVEPSLQESQLINSNILFNST 484

Query: 329 RNSFDDLTPPEVYTENMNDLSGVP-FHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYY 387
               DD+T      EN ND      +++    +  + + SG +++NK+K L +++ +L  
Sbjct: 485 SPKIDDITS----IENTNDREIYNIYNNFLTKIFAIISISGLVVINKDKKLFSLIFSLMM 540

Query: 388 NVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQVKSSTSVDGYFENGEFHGVAML 447
           N+NG          +    GDKE F     F G  F       +V+ +  +G   G  M+
Sbjct: 541 NLNGKL--------QRCVYGDKEFFWLGQLFAGERF-------TVNTH--DGSIIGPLMV 583

Query: 448 QY--DCVQDYKLYQIA 461
               D  + Y+LYQI 
Sbjct: 584 SIIDDPERKYELYQIC 599

>KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 58/272 (21%), Positives = 110/272 (40%), Gaps = 32/272 (11%)

Query: 180 GSGIVTV----GGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLP---K 232
           G GI+T       G + L    I+Q  +    TLP+++ +   +  ++ F  +L     +
Sbjct: 273 GKGIITTFNPKAHGDYFLRQLKILQYQK---NTLPIQILVRDGDFSDS-FVRKLADAARR 328

Query: 233 YNAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEE 292
            N K   ++     +     +F+ Y  K  A + ++FE  +LLDAD  P  PL S     
Sbjct: 329 TNQKIYLVNYTAILDKSNMGEFKSYINKLAANLFNTFEEFILLDADAVPYFPLESYLELP 388

Query: 293 PFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDD---LTPPEVYTENMNDLS 349
            ++  G+ ++ D      + L + I          +  S ++   L    +YT + N + 
Sbjct: 389 DYQKTGMYMFRD------RILDHRIDDACTTTLEHLEPSMEEAVLLGTSIMYTVSSNVVP 442

Query: 350 GVPFHDLEGTMP----DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAG 405
             P   +   M       + E+G ++V+K   L  +L+AL  N++            A  
Sbjct: 443 TTPEEKVYVGMVREHIRENVETGLVVVDKKNKLPGLLMALALNLSKKL--------NACM 494

Query: 406 EGDKETFIAAANFYGLPFYQVKSSTSVDGYFE 437
            G+KE +     F G+ +       ++ G+ E
Sbjct: 495 YGEKEFYWLGPYFSGMSYSIEAKGAALTGFPE 526

>AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 648

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 38/151 (25%), Positives = 65/151 (43%), Gaps = 17/151 (11%)

Query: 176 NSYKGSGIV-TVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKY- 233
            S  G GIV TV       +  L+   +  +G  LP+E+    N+   +    + L +Y 
Sbjct: 253 RSSSGRGIVATVADIHLDQLKRLL-HVLDELGNKLPIELVYKGNDF--SRLPIKRLKRYV 309

Query: 234 ------NAKCIFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNS 287
                   + +   R+L    I K   + +  K LA + +SFE  +LLD D  P+ P++S
Sbjct: 310 RQHTKQRVRLVDCSRVLRSTHIPKI--KRFMNKWLATIFNSFEEIILLDVDVVPLVPIDS 367

Query: 288 IFNEEPFKSKGLVLWPDFWRRTTQPLYYDIA 318
            F    +   G +    F++  T P Y  ++
Sbjct: 368 YFKLPGYTKTGAL----FFKDRTLPEYLPVS 394

>Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W
           (REAL)
          Length = 629

 Score = 35.0 bits (79), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 59/264 (22%), Positives = 110/264 (41%), Gaps = 22/264 (8%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNE-GPET-EFCTELLPKYNAK 236
           KG G V     K   +    ++ +      LP ++    NE  PE+    +++  +   K
Sbjct: 232 KGRGFVLTIAEKDVPLFIRQLKVMEFSKNELPFQIITTGNELSPESIAKISKVAAEGKQK 291

Query: 237 CIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
              +D   +L  E    + F  +Q K +A + ++FE  +LLDAD  P    +  F+   +
Sbjct: 292 VYLVDCSTVLESEFSSTYIF-SFQNKWVASLFNTFEEYILLDADVVPFVKSDYFFDSPSY 350

Query: 295 KSKGLVLWPDFWRRTTQPLYYDIAGV----PVNLKNRVRNSFDDLTPPEVYTENMNDLSG 350
           K  G++L+ D   R      Y I  +    P   ++R+  S        + + + ++ + 
Sbjct: 351 KGSGILLFKDRVMRNELTFKYCIELLGLVEPSREEHRLIGSKLVFDSSSLLSSSSSEEAS 410

Query: 351 VPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKE 410
           V +++    +     +SG ++VNK + L  +L++   N++G          +    GDKE
Sbjct: 411 V-YYNFFKNLRLHHVDSGLVVVNKLEKLNGLLMSFMLNLDG--------KMQRCVYGDKE 461

Query: 411 TFIAAANFYGLPFYQVKSSTSVDG 434
            F     + G    Q  S   VDG
Sbjct: 462 IFWIGQLYAG----QDYSINPVDG 481

>KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} similar
           to uniprot|P40549 Saccharomyces cerevisiae YIL014W MNT3
           Alpha-1 3-mannosyltransferase adds the fourth and fifth
           alpha-1 3-linked mannose residues to O-linked glycans
           during protein O-glycosylation
          Length = 663

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 42/199 (21%), Positives = 79/199 (39%), Gaps = 40/199 (20%)

Query: 260 KSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAG 319
           K +AL+ ++F   +LLDAD+     L S F+ + ++  G++L+ D           +I G
Sbjct: 351 KWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRD----------RNIIG 400

Query: 320 VPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMPDVST-------------- 365
               +     ++   L P    T  M+  S  P   +E    ++ T              
Sbjct: 401 EKTFI--YCTDTLKKLFPSVEETHFMSHRSTFPLELVENDNINIDTLSMEEQIYYKFFHN 458

Query: 366 ------ESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFY 419
                 +SG ++V++ K L ++L++   N++G          +    GDKE F       
Sbjct: 459 LQLHHIDSGLVVVDRVKKLSSLLISTMMNIDGKL--------QRCVYGDKEIFWLGQLLA 510

Query: 420 GLPFYQVKSSTSVDGYFEN 438
           G  +    +  S+ G  +N
Sbjct: 511 GEKYSIYPTEGSIMGTVKN 529

>KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 57/267 (21%), Positives = 111/267 (41%), Gaps = 38/267 (14%)

Query: 180 GSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTEL--LPKYNAKC 237
           G G++T       ++    ++ ++     LP++V    +E  + EF  +L  + + + + 
Sbjct: 208 GRGLITTMKSDDIVLYEKQMRILKEFDNKLPLQVITTGSEMRD-EFVKQLQIIAEIHNQE 266

Query: 238 IF-------IDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFN 290
           I+       IDR   ++ I +F     + K L+++ ++FE  + +D D  P       F 
Sbjct: 267 IYLVDLSDIIDRRFVNDKIDRF-----KHKFLSVLFNTFEEAIFMDVDAVPFVETTEFFE 321

Query: 291 EEPFKSKGLVLWPDF-----WRRTTQPLYYDIAGVPVNLKNRVRNS---FDDLTPPE--- 339
            + +K  G+ L+ D           +PL   +   P   ++R+ N+   FD L   E   
Sbjct: 322 IQAYKDTGMYLYRDRSLDEGGEGNCRPLMRQLE--PSFAESRLLNNRLKFDLLWAIEHNG 379

Query: 340 VYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIF 399
           + T+ M     V F ++         ESG +++N+ K +  ++ A+ + ++         
Sbjct: 380 MSTKYMTSEEAV-FKNMYVYGRRHHIESGLMVINRRKQMAGLIGAMLFGLSN-------- 430

Query: 400 SQKAAGEGDKETFIAAANFYGLPFYQV 426
           S      GDKE F    N Y    Y V
Sbjct: 431 SGSKCSWGDKE-FFWLGNLYAGKDYAV 456

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 49/245 (20%), Positives = 98/245 (40%), Gaps = 24/245 (9%)

Query: 179 KGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPN--EGPETEFCTELLPKYNAK 236
           KG GIV         +   ++  ++ +  TLP+++       E    E     L   + +
Sbjct: 248 KGKGIVINMKETEKDLFMSLIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTTDQQ 307

Query: 237 CIFID--RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPF 294
              ID   IL  + +++     +  K    + ++FE  ++LDAD+ P     + F  + +
Sbjct: 308 VSLIDCSSILDADFVKEH-IASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEY 366

Query: 295 KSKGLVLWPDFWRRTTQPLYYDIAGV----PVNLKNRVRNS---FDDLTPPEVYTENMND 347
           K  G   + D      +   Y I  +    P   ++ + N+   F    PPE   +N + 
Sbjct: 367 KDAGSFFFRDKTLGNERTYQYCIEMIEAMEPSKAESGLINTKLKFTSNNPPE---DNSSP 423

Query: 348 LSGVPFHDLEGTMPDVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEG 407
            + V ++   G     + +SG +++ K + L ++L+    N++           K    G
Sbjct: 424 AASV-YNTFFGKYKHKNLDSGVVVLKKKEKLTSLLMGFMMNLDA--------KMKQCVSG 474

Query: 408 DKETF 412
           +KE F
Sbjct: 475 EKELF 479

>Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 58/300 (19%), Positives = 111/300 (37%), Gaps = 64/300 (21%)

Query: 183 IVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKC----- 237
           I+++G  +F+L   LI   +R  G  LP+++    NE  + E   +L+  Y A+      
Sbjct: 323 ILSLGPNQFALAVKLIAA-LRFQGNKLPIQIVYRGNELSQ-ELVDKLI--YAARSPDFKP 378

Query: 238 ---------------IFIDRILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPV 282
                           F+D         + DF  Y+ K L ++ + F+  + LD D    
Sbjct: 379 VKNNYDNSTNVPQNIWFLDVSNTIHPKWRDDFGSYKSKWLVVLFNLFQEFVFLDIDAISY 438

Query: 283 KPLNSIFNEEPFKSKGLVLWPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYT 342
           + ++  F+   ++  G V             +Y    +   L  R    ++ L P ++ +
Sbjct: 439 QEIDKYFDTPEYQKTGTV-------------FYRERALTETLDGRCVARYETLLPRKLES 485

Query: 343 ENMNDLSGVPFHDLEGTMPDVST------------------ESGQLMVNKNKHLGTILLA 384
           +N  +L  +    +     ++ T                  E+G   ++K+KH+  ++LA
Sbjct: 486 KNFQNLLTIDPDTVLNKCDELLTTEEYIFKSMFRHKGQHQLEAGLFAIDKSKHVLPLVLA 545

Query: 385 LYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLPF-YQVKSSTSVDGYFENGEFHG 443
              ++   T             GDKE F       G P+  Q   S ++  Y +  E  G
Sbjct: 546 SMIHLARDT--------GGCTHGDKENFWLGFLASGHPYALQEVYSGAIGDYVKKTELDG 597

>KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {ON}
           Anc_7.123 YIL014W
          Length = 666

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 31/134 (23%), Positives = 59/134 (44%), Gaps = 13/134 (9%)

Query: 179 KGSGIVT---VGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKY-- 233
           KG GIVT   +G  K   + +  ++ +  +  TLP+++      G   E   E L  Y  
Sbjct: 263 KGRGIVTTLPIGDIK---LFYKQLKVLDYLNNTLPIQIVT--TGGASVELFIEELKSYSK 317

Query: 234 --NAKCIFIDRI-LPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFN 290
             + K + ID   + +        R +  K ++++ ++FE  + +D D  P    N  F 
Sbjct: 318 STHQKILLIDTSPMLNTSFASLYIRFFSNKWISILFNTFEEMIFMDVDVVPFVNPNEFFE 377

Query: 291 EEPFKSKGLVLWPD 304
            + +K  G+ ++ D
Sbjct: 378 IDGYKETGIFMYKD 391

>Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {ON}
           complement(31451..33682) [2232 nt, 744 aa]
          Length = 743

 Score = 32.0 bits (71), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 49/248 (19%), Positives = 88/248 (35%), Gaps = 51/248 (20%)

Query: 175 SNSYKGSGIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYN 234
           S+ +   GI          MA  ++  +R  G  LP+++    NE  +      L   ++
Sbjct: 309 SSLFAKRGIALSFADSHLEMALKLIATLRFQGNKLPIQIIYKDNELSKDTMSKILQVAHS 368

Query: 235 AKCIF--------------------IDRILPDEMIQKF-DFRGYQFKSLALVASSFENTL 273
           ++  F                    +   +   +I+++ DF+    K LA + + FE  +
Sbjct: 369 SELKFPGTPIDESIKPVKQDVWFLDVTNTVDPSLIERYTDFKN---KWLACIFNLFEEFI 425

Query: 274 LLDADNFPVKPLNSIFNEEPFKSKGLVLWPDFWRR------------TTQPLYYD---IA 318
            +D D     P+   F  + +K  G V + D   R            T  P Y +     
Sbjct: 426 FMDIDAVNYVPMEYFFEMDEYKRTGTVFFRDRMLRASVKRECVPIFETLTPNYMESKYFG 485

Query: 319 GVPVNLKNRVRNSFDD-LTPPEVYTENMNDLSGVPFHDLEGTMPDVSTESGQLMVNKNKH 377
             P   K+ V    D  LTP E+  +          H +         ESG   +NK KH
Sbjct: 486 NFPFINKDYVEEQCDKYLTPEELIYKRY--FINHKLHQM---------ESGLFAINKTKH 534

Query: 378 LGTILLAL 385
           +  ++ ++
Sbjct: 535 VIPLIFSM 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.139    0.422 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,142,066
Number of extensions: 3328808
Number of successful extensions: 8526
Number of sequences better than 10.0: 129
Number of HSP's gapped: 8413
Number of HSP's successfully gapped: 137
Length of query: 611
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 495
Effective length of database: 40,180,143
Effective search space: 19889170785
Effective search space used: 19889170785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)