Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0K012853.187ON126361436e-12
NOTE: 23 genes in the same pillar as KNAG0K01285 were not hit in these BLAST results
LIST: Kpol_1036.51 ZYRO0A04972g Skud_4.241 CAGL0K01903g Smik_4.222 YDL012C NCAS0I01900 TBLA0B01680 TBLA0F00730 KAFR0C00880 YBR016W Suva_4.237 KLTH0E15840g Kwal_YGOB_Anc_3.187 AER212W TDEL0D04340 Smik_2.135 Suva_2.144 Ecym_5263 Klac_YGOB_Anc_3.187 Skud_2.128 CAGL0I04510g SAKL0C08008g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0K01285
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381...    60   6e-12

>KNAG0K01285 Chr11 complement(253589..253930,254081..254119) [381
          bp, 126 aa] {ON}
          Length = 126

 Score = 59.7 bits (143), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 28/36 (77%)

Query: 1  MSAKDYYNGASNQPTQQYHXXXXXXXXRSGSKKGWG 36
          MSAKDYYNGASNQPTQQYH        RSGSKKGWG
Sbjct: 1  MSAKDYYNGASNQPTQQYHSPSSPAPARSGSKKGWG 36

 Score = 30.0 bits (66), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 13/24 (54%)

Query: 103 RGNDDCMTXXXXXXXXXXXMNMIF 126
           RGNDDCMT           MNMIF
Sbjct: 103 RGNDDCMTACLAALCVCCAMNMIF 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.128    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 4,412,937
Number of extensions: 50768
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's gapped: 47
Number of HSP's successfully gapped: 2
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)