Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0K006508.850ON48248224100.0
NCAS0C003108.850ON55643916410.0
KAFR0L019608.850ON51144015940.0
CAGL0I02684g8.850ON49344015800.0
ZYRO0C14872g8.850ON49643915760.0
NDAI0K003708.850ON56843615690.0
Suva_13.4758.850ON51544315620.0
SAKL0D01166g8.850ON50543715570.0
Kpol_237.18.850ON50344115320.0
YMR285C (NGL2)8.850ON51544315270.0
TBLA0B029008.850ON52044115170.0
Smik_13.5018.850ON51544315060.0
Skud_13.4588.850ON51444715030.0
KLLA0C06248g8.850ON51644014980.0
KLTH0C03608g8.850ON49548114930.0
TPHA0I003208.850ON52944014950.0
TDEL0B001908.850ON49243914860.0
Kwal_27.102048.850ON49444214210.0
ABL118W8.850ON50443113530.0
Ecym_46198.850ON48743013480.0
NCAS0B002708.850ON47644411391e-152
NDAI0E002608.850ON49845411401e-152
TBLA0D033008.850ON48044911201e-149
KAFR0A028608.850ON4784399391e-122
KNAG0G034708.850ON4664509101e-117
Smik_13.168.850ON5024529081e-117
YML118W (NGL3)8.850ON5054488961e-115
CAGL0B02387g8.850ON4714488861e-114
Suva_13.258.850ON5024428831e-113
Skud_13.238.850ON4984478421e-107
Ecym_73547.78ON7852301955e-15
SAKL0B10032g7.78ON7312761902e-14
ACR288W7.78ON7362241884e-14
KNAG0D048407.78ON7792721831e-13
KLTH0D02310g7.78ON7392861831e-13
TDEL0H037307.78ON7972581812e-13
Kwal_26.71127.78ON7422541795e-13
KAFR0K006707.78ON7952741795e-13
KLLA0F15884g7.78ON7902241777e-13
CAGL0H06149g7.78ON8732451751e-12
ZYRO0D05302g7.78ON8572271742e-12
Suva_1.457.78ON8312731723e-12
NDAI0H025207.78ON8982331705e-12
Kpol_1040.147.78ON7842841671e-11
TPHA0H026807.78ON8722431634e-11
NCAS0F016407.78ON8552201582e-10
YAL021C (CCR4)7.78ON8372771572e-10
Skud_1.407.78ON8692661563e-10
Smik_1.457.78ON8392731536e-10
TBLA0A046607.78ON8962301511e-09
ACR277C7.90ON3782671213e-06
TBLA0E022607.90ON3882341171e-05
KAFR0D012507.90ON3562551114e-05
SAKL0B09768g7.90ON3682361115e-05
KLLA0F07733g7.90ON3712361098e-05
Kwal_26.71707.90ON3722491071e-04
TDEL0H036007.90ON3662421035e-04
KLTH0D02574g7.90ON3682511035e-04
KNAG0L005507.90ON3812461026e-04
Ecym_26367.90ON3672251027e-04
NDAI0A085307.90ON365236980.002
CAGL0F01001g7.90ON359250940.005
NCAS0I005007.90ON389236890.022
Smik_15.1257.90ON363237880.030
TPHA0L005307.90ON391247880.035
Kpol_1044.67.90ON37286860.051
YOL042W (NGL1)7.90ON363237840.090
Suva_15.1277.90ON363235830.12
ZYRO0D05588g7.90ON356239790.41
Skud_15.1157.90ON363237741.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0K00650
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   932   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      636   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   618   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   613   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   611   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   608   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   606   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   604   0.0  
Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   594   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   592   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   588   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   584   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   583   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   581   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   579   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   580   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   577   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   551   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   525   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   523   0.0  
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      443   e-152
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   443   e-152
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   436   e-149
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   366   e-122
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   355   e-117
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   354   e-117
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   349   e-115
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   345   e-114
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   344   e-113
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   328   e-107
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    80   5e-15
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    78   2e-14
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    77   4e-14
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    75   1e-13
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    75   1e-13
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    74   2e-13
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    74   5e-13
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    74   5e-13
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    73   7e-13
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    72   1e-12
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    72   2e-12
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    71   3e-12
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      70   5e-12
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    69   1e-11
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    67   4e-11
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      65   2e-10
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    65   2e-10
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    65   3e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    64   6e-10
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    63   1e-09
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    51   3e-06
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    50   1e-05
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    47   4e-05
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    47   5e-05
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    47   8e-05
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    46   1e-04
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    44   5e-04
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    44   5e-04
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    44   6e-04
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    44   7e-04
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    42   0.002
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    41   0.005
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    39   0.022
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    39   0.030
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    39   0.035
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    38   0.051
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    37   0.090
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    37   0.12 
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    35   0.41 
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    33   1.5  

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  932 bits (2410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/482 (93%), Positives = 449/482 (93%)

Query: 1   MTQECSASSSNAGVRPPRGKPSXXXXXXXXXXXXXXXXXXXLQGAKSDIPAELRFIERPM 60
           MTQECSASSSNAGVRPPRGKPS                   LQGAKSDIPAELRFIERPM
Sbjct: 1   MTQECSASSSNAGVRPPRGKPSEEEIARIRAERKAKREAAALQGAKSDIPAELRFIERPM 60

Query: 61  LSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYE 120
           LSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYE
Sbjct: 61  LSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYE 120

Query: 121 PDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDF 180
           PDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDF
Sbjct: 121 PDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDF 180

Query: 181 DKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTR 240
           DKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTR
Sbjct: 181 DKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTR 240

Query: 241 QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGR 300
           QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGR
Sbjct: 241 QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGR 300

Query: 301 ARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHHPVPATFEPNAEQCALVH 360
           ARTVIECSTSYTFSKQR              NIEIFGKDQPHHPVPATFEPNAEQCALVH
Sbjct: 301 ARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQPHHPVPATFEPNAEQCALVH 360

Query: 361 QMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHW 420
           QMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHW
Sbjct: 361 QMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHW 420

Query: 421 DFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           DFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL
Sbjct: 421 DFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480

Query: 481 AL 482
           AL
Sbjct: 481 AL 482

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  636 bits (1641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/439 (66%), Positives = 349/439 (79%), Gaps = 7/439 (1%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   +   +L+FI+RP+L +H +  +        +++MTYNCLAQALIRRKLFPDSG A
Sbjct: 123 QGLDPNALPDLQFIQRPILHLHEEEPVTG----FKISIMTYNCLAQALIRRKLFPDSGDA 178

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW++RS+VL N+FKHY PDV+CLQE+D +Q+ SFW+ EFEK+GY +QFH+KQ+KNHGVA
Sbjct: 179 LKWFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVA 238

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRD-TPRSGI 221
           ++WR +LFT+ DKMLIDFDKE SG++PPRTTTNNAGL ++LKFTE+AL+   + T R GI
Sbjct: 239 IIWRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGI 298

Query: 222 LVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281
           +VGTTHLFWHPFGT+ERTRQCYVVLNKMKEFMHR+NVLQN NDG+  HW+PFFCGDFNSQ
Sbjct: 299 IVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQ 358

Query: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQP 341
           P+D PYLSMTSKP+ Y GRA+TVIECSTSY FSK+R              NIE FGKDQP
Sbjct: 359 PFDTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKR--DGEEDADEEEGGNIEKFGKDQP 416

Query: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401
             PVP  F  N EQ  LV  ME LHNSLDMRA+SLY VGYR VHPENAG DN  GEPEIS
Sbjct: 417 QTPVPDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEIS 476

Query: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461
           NWAHTWNGLLDY+ ++ HW F D   VDTLE+FE+++ + V+  LRMP   EM + GHGQ
Sbjct: 477 NWAHTWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQ 536

Query: 462 PHTGEYPSDHLAMVCDLEL 480
           PHTGEYPSDHL+M+C+LEL
Sbjct: 537 PHTGEYPSDHLSMICELEL 555

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/440 (64%), Positives = 343/440 (77%), Gaps = 6/440 (1%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D+P EL+FI RP+L++    +           +MTYNCLAQALIRRKLFPDSG A
Sbjct: 78  QGLDPDLPPELQFIRRPLLALSKAESTAG----FEFKIMTYNCLAQALIRRKLFPDSGEA 133

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           +KW+RRS+VLLN+FK+Y+ DV+CLQEVD +Q+ +FW+ EF+KLGY +QFH K +KNHG++
Sbjct: 134 VKWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGIS 193

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222
           ++W+  LFTM DKMLID+DKE SG++PPRTTTNN GLV+ALKF+ + L    +T +SGI+
Sbjct: 194 ILWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFPNTRKSGII 253

Query: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282
           VGTTHLFWHPFGT+ERTRQCY+VLNK KEFMHRVNVLQN ND    HW+ FF GDFNSQP
Sbjct: 254 VGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQP 313

Query: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPH 342
           +D PYLSMTSKPV YS RA+TVIECSTSYTFSK R              NIE FGKDQP 
Sbjct: 314 FDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSR--DGEEDAEDEEGGNIEKFGKDQPA 371

Query: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402
            PVP+ F+ ++EQ +LV  ME LHNSLDMRA+SLYSVGY  VH ENAG DN RGEPEISN
Sbjct: 372 TPVPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISN 431

Query: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462
           WAH WNGLLDYLF +  WDF D+  VD+L++FE ++ + VK  L+MP+K EM +FGHGQP
Sbjct: 432 WAHAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQP 491

Query: 463 HTGEYPSDHLAMVCDLELAL 482
           H GEYPSDHL+M+C LEL L
Sbjct: 492 HVGEYPSDHLSMICKLELKL 511

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/440 (64%), Positives = 344/440 (78%), Gaps = 10/440 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +G   D P EL+FI R ML +H +  +  EG  L + +M+YNCLAQALIRRKLFPDSG A
Sbjct: 61  RGVDPDCPPELQFIRRNMLKLHEEEPV--EG--LKIKIMSYNCLAQALIRRKLFPDSGEA 116

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKWYRRS+VLLN+FKHY+PDVLCLQE+D +Q+ SFW+ EF+KLGY++QFH+K +KNHGV 
Sbjct: 117 LKWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVC 176

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQA-LTGHR-DTPRSG 220
           ++W+ + F M+D+MLIDFD E+SGD+ PRTTTNNA L++ALKFT++  + G +    +SG
Sbjct: 177 IIWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSG 236

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           ILVGTTHLFWHPFGT+ERTRQCYVVLNKMKEFMHRVNVLQN NDG+  HW+PFFCGDFNS
Sbjct: 237 ILVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNS 296

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D+PYLSMT KP+ Y  RA+TVIECSTS+ FSK+R              NIE FGKDQ
Sbjct: 297 QPFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKR--ESGEDAEDEEGGNIEKFGKDQ 354

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P  PVP  F  N EQ  LV QME LHNSLDMRAVSLYSV Y  VHPEN+G DN RGEPEI
Sbjct: 355 PQTPVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEI 414

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHG 460
           SNWAHTW GLLDY+F + +W+F DRT +DTLE+FE  + + ++ LLRMP   EM    HG
Sbjct: 415 SNWAHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMS--THG 472

Query: 461 QPHTGEYPSDHLAMVCDLEL 480
           QPH GEYPSDHL ++ ++EL
Sbjct: 473 QPHVGEYPSDHLCLLSEVEL 492

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/439 (64%), Positives = 342/439 (77%), Gaps = 8/439 (1%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D P EL+FI+RP+L +H     G         LMTYNCLAQALIRRKLFP SG A
Sbjct: 65  QGIDPDFPPELQFIKRPILPLHK----GENVEGFKFKLMTYNCLAQALIRRKLFPTSGDA 120

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKWYRRS+VLLN+FK+Y  DV+CLQE+D +Q+ SFW+ E  KLGY +QFH++ +KNHGVA
Sbjct: 121 LKWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVA 180

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222
           +VW+ + F M DKMLIDFD+E SGD+PPRTTTNNAGL+++LKF+++    H +  ++GI+
Sbjct: 181 IVWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQEH-NLKKTGII 239

Query: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282
           VGTTHLFWHPFGTFERTRQCYVVLNK+KEF HRVNVLQN NDG++ HW+PFFCGDFNSQP
Sbjct: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQP 299

Query: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPH 342
           +D+PYLSMT KP+ YS RA+TVIECSTSYTFSK R              NIE FG DQP 
Sbjct: 300 FDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMR-DGEEDDAEEEEGGNIEKFGTDQPD 358

Query: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402
           HPVP  +E    +  LV QM++LHNSLDMRAVSLYSV YR VHPENAG DN RGEPEISN
Sbjct: 359 HPVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISN 418

Query: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462
           WAHTW GLLDYLF++ HWDF D   +D+LE FE+++ + ++ LLR+P  +EM +  HGQP
Sbjct: 419 WAHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTE--HGQP 476

Query: 463 HTGEYPSDHLAMVCDLELA 481
           HTGEYPSDHL M+C+LEL 
Sbjct: 477 HTGEYPSDHLCMLCELELV 495

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  608 bits (1569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/436 (64%), Positives = 337/436 (77%), Gaps = 10/436 (2%)

Query: 47  SDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWY 106
           S IP EL+FI+RP+L +H +  +         ++MTYNCLAQALIRRKLFPDSG ALKWY
Sbjct: 140 SVIPPELQFIKRPILYLHEEEPVQG----FKFSMMTYNCLAQALIRRKLFPDSGDALKWY 195

Query: 107 RRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWR 166
           RRS+VLLN+F +Y PD++CLQEVD +Q+ SFW+ EFEKLGY +Q+H+K  KNHGV+++WR
Sbjct: 196 RRSKVLLNEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWR 255

Query: 167 SKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHR--DTPRSGILVG 224
             LFTM DKMLI+FDKE SG+VPPRTTTNN GL+++LKFT +A    +  +T ++GI++G
Sbjct: 256 RSLFTMTDKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQFKNVETTKTGIIIG 315

Query: 225 TTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYD 284
           TTHLFWHPFGT+ERTRQCYVVLNKMKEFMHRVNVLQN ND +  HW+PFFCGDFNSQP+D
Sbjct: 316 TTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFD 375

Query: 285 APYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHHP 344
           +PYLSM  KPV YSGRA+TVIECSTSY FSK+R              NIE FG DQP  P
Sbjct: 376 SPYLSMVRKPVEYSGRAKTVIECSTSYKFSKKR--DGEEDVDDEEGGNIEKFGIDQPQTP 433

Query: 345 VPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWA 404
           VP  F  N EQ  LV  ME LHNSL+MRA+SLY VGY+NVHPENA  DN  GEPEISNWA
Sbjct: 434 VPEEFIANGEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWA 493

Query: 405 HTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHT 464
           HTWNGLLDYL +V  W F D T  +TL++FE+ + + ++  LRMP   EM +  HGQPH 
Sbjct: 494 HTWNGLLDYLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTK--HGQPHV 551

Query: 465 GEYPSDHLAMVCDLEL 480
           GEYPSDHL+M+C +EL
Sbjct: 552 GEYPSDHLSMLCSIEL 567

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/443 (64%), Positives = 336/443 (75%), Gaps = 11/443 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D P EL FI+RP LS+H +  +   G R    LMTYNCLAQALIRRKLFPDSG A
Sbjct: 81  QGIDPDCPPELHFIKRPFLSLHEEEPVT--GFRF--KLMTYNCLAQALIRRKLFPDSGDA 136

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKWYRRS+VLLN+F+HY  DV+CLQE+D +Q+ SFW+ EF KLGY  Q+H+  TKNHGVA
Sbjct: 137 LKWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVA 196

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALT--GHRDTPRSG 220
           ++WR  +F   DKMLIDFDKE SG++P RTTTNN GLV+ALKF+E+ L+  G   + +SG
Sbjct: 197 IIWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSG 256

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           IL+GT+HLFWHPFGT+ERTRQCY+VL KM+EFMHRVNVLQNENDG+  HWFPFFCGDFNS
Sbjct: 257 ILIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D PYLSMT KPV Y  RA+TVIECSTS+ FSK R              NIE FGKDQ
Sbjct: 317 QPFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVR--DGEEGADEEEGGNIEKFGKDQ 374

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P  PVP  F  N EQ  LV +M  LHNSLDMRAVSLYSV Y+NVHPENAG DN RGEPEI
Sbjct: 375 PESPVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEI 434

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTG-VDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGH 459
           SNWA+TW GLLDYLFY+  WD +     VD+L++FE+D+ +  +  LRMP   EM +  H
Sbjct: 435 SNWANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTK--H 492

Query: 460 GQPHTGEYPSDHLAMVCDLELAL 482
           GQPH GEY SDHL+MVCD+EL L
Sbjct: 493 GQPHVGEYASDHLSMVCDIELQL 515

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/437 (63%), Positives = 342/437 (78%), Gaps = 9/437 (2%)

Query: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPAL 103
           G   ++P +L+FI+RP+L +H +  +          +MTYN LAQALIRRKLFP SG A+
Sbjct: 76  GLDPNVPPDLQFIKRPLLCLHEEEPVKG----FKFKIMTYNALAQALIRRKLFPSSGNAV 131

Query: 104 KWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAV 163
           KW++RS+VLLN+FKHY+ DV CLQE+D +Q+ +FW+ EF+KLGYA+QFH+  TKNHGVA+
Sbjct: 132 KWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAI 191

Query: 164 VWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILV 223
           VWR  LFTM D ML+D+DKE SGD+PPRTTT NAGL++ALKFT++ L     T +SGIL+
Sbjct: 192 VWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFPGTKKSGILI 251

Query: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPY 283
           GTTHLFWHPFGTFERTRQCYVVLNKMKE +HRVNVLQN  D +  HW+PF CGDFNSQP+
Sbjct: 252 GTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQPF 311

Query: 284 DAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHH 343
           D PYLSMTSKPV+Y GRA+TVIECSTS+TFSK R              NIE FGK QP H
Sbjct: 312 DTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLR---DGEEGEDEEGGNIEKFGKGQPEH 368

Query: 344 PVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNW 403
           PVP  F    EQ ALV QME+LHNSLDMRA+SLY+VGY++VHPENAG DN  GEPEISNW
Sbjct: 369 PVPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNW 428

Query: 404 AHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPH 463
           A TW GLLDY+F+V +W+  DR+ VD ++ FE+++G+ ++ LLRMP  +EM +  HGQPH
Sbjct: 429 AETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTK--HGQPH 486

Query: 464 TGEYPSDHLAMVCDLEL 480
            GEYPSDHL+M+C++EL
Sbjct: 487 EGEYPSDHLSMMCEIEL 503

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/441 (62%), Positives = 340/441 (77%), Gaps = 9/441 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +G   D P EL+FI+RPML +H D  +         TLMTYNCLAQALIRRKLFPDSG A
Sbjct: 71  KGLDPDYPPELQFIKRPMLHLHQDEPVTG----FNFTLMTYNCLAQALIRRKLFPDSGEA 126

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           +KW+RRS+VLL +F+HY  DV+CLQE+D +Q+ +FW+ EFEKLGY +QFH+  +KNHGVA
Sbjct: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVA 186

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQAL-TGHRDTPRSGI 221
           +VW+ ++F M D+MLIDFDKE S D+PPRT TNN GL+++LKF+++ L T  ++T  +GI
Sbjct: 187 IVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNTKTTGI 246

Query: 222 LVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281
           ++GTTHLFWHPFGT+ERTRQCYV+LNKMKEFMHRVNVLQN NDG+  HW PFFCGDFNSQ
Sbjct: 247 IIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306

Query: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQP 341
           P+D+PYLSMTSKP+ Y+ RA+TVI+CSTSY FSK R              NIE FGKDQP
Sbjct: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR--NGEEDVDDEEGGNIEKFGKDQP 364

Query: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401
             PVP TF  N EQ ALV +M  +HN L MRA SLYSVGY++VH ENAG DN RGEP IS
Sbjct: 365 QTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIIS 424

Query: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461
           NWA+TW GLLDY+F+V  WDF +R  VD+LE+FE ++ + ++  LRMP   EM +  HGQ
Sbjct: 425 NWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPK--HGQ 482

Query: 462 PHTGEYPSDHLAMVCDLELAL 482
           PH GEY SDHL+M+C++EL L
Sbjct: 483 PHEGEYASDHLSMICNIELLL 503

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/443 (65%), Positives = 332/443 (74%), Gaps = 11/443 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D P EL FI RP LS+H   A    G R    LMTYNCLAQALIRRKLFPDSG A
Sbjct: 81  QGVDPDCPPELHFIRRPFLSLHE--AEPVTGFRF--KLMTYNCLAQALIRRKLFPDSGDA 136

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKWYRRS+VLLN+FK+Y  DV+CLQE+D +Q+ SFW+ EF KLGY  Q+++  TKNHGVA
Sbjct: 137 LKWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVA 196

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALT--GHRDTPRSG 220
           ++WR +LF   DKMLID+DKE S  +  RTTTNN GLV+ALKF+E+ L+  G + + + G
Sbjct: 197 IMWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCG 256

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           IL+GTTHLFWHPFGT+ERTRQCY+VL KMKEFMHRVNVLQNENDG+  HWFPFFCGDFNS
Sbjct: 257 ILIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D PYLSMTSKPV Y  RA+TVI CSTSY FSK R              NIE +GKDQ
Sbjct: 317 QPFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVR--DGEEGADDEEGGNIEKYGKDQ 374

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P  PVP  F  N EQ  LV +M  LHNSLDMRA+SLYSVGY+NVHPENAG DN RGEPEI
Sbjct: 375 PESPVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEI 434

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTG-VDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGH 459
           SNWA+TW GLLDYLFYV  WD +     V+TL +FE+++ V  +  LRMP   EM +  H
Sbjct: 435 SNWANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTK--H 492

Query: 460 GQPHTGEYPSDHLAMVCDLELAL 482
           GQPH GEY SDHL+MVCDLEL L
Sbjct: 493 GQPHVGEYASDHLSMVCDLELQL 515

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  588 bits (1517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/441 (60%), Positives = 337/441 (76%), Gaps = 10/441 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D P EL+FI+RP+L +H +  +         +LMTYNCLAQALIRRKLFP+ G A
Sbjct: 89  QGIDPDCPKELQFIKRPILQMHENEPVKG----FKFSLMTYNCLAQALIRRKLFPEGGDA 144

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW+RRS+VLLN+FKHY PD++CLQE+D VQ+ SFW+ EF KLGY  QF+KK +KNHGV+
Sbjct: 145 LKWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVS 204

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGH-RDTPRSGI 221
           VVW+ +LF M D+ML+D+DKE SGD+ PRTTTNN  L+++LKF+++      ++  ++GI
Sbjct: 205 VVWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGI 264

Query: 222 LVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281
           L+GTTHLFWHPFGT+ERTRQCY++LNKMKEF+ RVN+LQN  D +  HW+PFFCGDFNSQ
Sbjct: 265 LIGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQ 324

Query: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQP 341
           P+D+PYLSMTSKP+ YSGR++TVIECSTS+ FSK+R              NIE FGKDQP
Sbjct: 325 PFDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKR---DGEEGDDEEGGNIEKFGKDQP 381

Query: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401
            HPVP  ++ N EQ  LV +M+ LHNSLDMRA+SLYS GY  VHPEN+G DN R EPEIS
Sbjct: 382 QHPVPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEIS 441

Query: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461
           NWAH W GLLDYLFY+  WDF     +D+LE+FE+++ + ++  LRMP  +E+    HGQ
Sbjct: 442 NWAHIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELP--SHGQ 499

Query: 462 PHTGEYPSDHLAMVCDLELAL 482
           P  GEYPSDHL M+C++EL L
Sbjct: 500 PFEGEYPSDHLCMLCEVELCL 520

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  584 bits (1506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/443 (63%), Positives = 330/443 (74%), Gaps = 11/443 (2%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   D P EL FI+RP L +H    +          LMTYNCLAQALIRRKLFPDSG A
Sbjct: 81  QGVDPDCPPELHFIKRPFLVLHEKEPVTG----FRFKLMTYNCLAQALIRRKLFPDSGDA 136

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKWYRRS+VLLN+FK+Y+ DV+CLQE+D +Q+ SFW+ EF KLGY  Q+++  TKNHGVA
Sbjct: 137 LKWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVA 196

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTG--HRDTPRSG 220
           ++WR ++F   DKMLID+DKE S ++  RTTTNN GLV+ALKF+E+ L+      + + G
Sbjct: 197 IMWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCG 256

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           IL+GTTHLFWHPFGT+ERTRQCYVVL KMKEFMHRVNVLQNENDG+  HWFPFFCGDFNS
Sbjct: 257 ILIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNS 316

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D PYLSMTSKPV Y  RA+TVIECSTS+ FSK R              NIE +GKDQ
Sbjct: 317 QPFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKAR--DGDESADDEEGGNIEKYGKDQ 374

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P  PVP  +  N EQ  LV +M  LHNSLDMRA+SLYSVGYRNVHPENAG DN RGEPEI
Sbjct: 375 PESPVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEI 434

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTG-VDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGH 459
           SNWA+TW GLLDYLFYV  WD +     V+ L +FE+ + +  +  LRMP  +EM +  H
Sbjct: 435 SNWANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTK--H 492

Query: 460 GQPHTGEYPSDHLAMVCDLELAL 482
           GQPH GEY SDHL+MVCDLEL L
Sbjct: 493 GQPHVGEYASDHLSMVCDLELEL 515

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/447 (63%), Positives = 331/447 (74%), Gaps = 21/447 (4%)

Query: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVT-----LMTYNCLAQALIRRKLFPD 98
           G   D P EL FI+RP+LS+         G   PVT     LMTYNCLAQALIRRKLFPD
Sbjct: 81  GVDPDCPPELHFIQRPLLSL---------GEGEPVTGFRFKLMTYNCLAQALIRRKLFPD 131

Query: 99  SGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKN 158
           SG ALKW+RRS+VLLN+FK+Y  DV+CLQEVD +Q+ SFW+G+F K+GY  Q+H+  TKN
Sbjct: 132 SGDALKWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKN 191

Query: 159 HGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPR 218
           HGVA++WR  +F   DKMLID+DKE SG +  RTTTNN GLV+ALKF+++ L+       
Sbjct: 192 HGVAIIWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSS 251

Query: 219 S--GILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCG 276
              GIL+GTTHLFWHPFGT+ERTRQCYVVL KMKEFMHRVNVLQN+NDG+  HWFPFFCG
Sbjct: 252 KKCGILIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCG 311

Query: 277 DFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIF 336
           DFNSQP+D PYLSMTSKPV Y  RA+TVIECSTS+ FSK R              NIE F
Sbjct: 312 DFNSQPFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVR--DGEEGADDEEGGNIEKF 369

Query: 337 GKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARG 396
           GKDQP  PVP  F  N EQ  +V  M  LHNSLDMRA+SLYSVGY++VHPENAG DN RG
Sbjct: 370 GKDQPESPVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRG 429

Query: 397 EPEISNWAHTWNGLLDYLFYVGHWDFK-DRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQ 455
           EPEISNWA+TW GLLDYLFY+  WD + +R  V+ L +FE+ + +  +  LRMP   EM 
Sbjct: 430 EPEISNWANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMT 489

Query: 456 QFGHGQPHTGEYPSDHLAMVCDLELAL 482
           +  HGQPH GEYPSDHL+MVCDLEL L
Sbjct: 490 K--HGQPHVGEYPSDHLSMVCDLELQL 514

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/440 (61%), Positives = 326/440 (74%), Gaps = 5/440 (1%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG    +PA+LRFI+RPML+V  D +  +     P+++MTYNCLAQALIRR LFP SG A
Sbjct: 82  QGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTSGNA 141

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           +KW++RSQVLLN+FK+Y  DVLCLQE+D VQ+ SFW+ EF KLGY  QFH   TKNHGV 
Sbjct: 142 VKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNHGVL 201

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222
           + W+  LF M DKMLID+DKE +G + PRTTT N G++++LKF ++ L  + DT  SGI+
Sbjct: 202 IAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYPDTKVSGII 261

Query: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282
           +GTTHLFWHPFGT+ERTRQCY+VL K+KEF +R+NVLQNE DG+N HW  FFCGDFNSQP
Sbjct: 262 IGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDFNSQP 321

Query: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPH 342
           +DAPYLS+TSKPV Y+GRA+TVIECSTS+TFSK R              NIE FGK QP 
Sbjct: 322 FDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLR---DGDEGEGEEGGNIEKFGKGQPE 378

Query: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402
            PVP +F  N EQ  L   M+TLHN +DMRA+SLYS+ Y  VHPEN+G DN R EPEISN
Sbjct: 379 TPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEISN 438

Query: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462
           WAH W GLLDYL+YV  WD  D T +D L  FEQ+ GV V  LLR+P  +EM +  HGQP
Sbjct: 439 WAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTE--HGQP 496

Query: 463 HTGEYPSDHLAMVCDLELAL 482
           H GEYPSDHL M+  L + +
Sbjct: 497 HEGEYPSDHLCMIVKLGIIM 516

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/481 (57%), Positives = 335/481 (69%), Gaps = 11/481 (2%)

Query: 4   ECSASSSNAGVRPPRGKPSXXXXXXXXXXXXXXXXXXXL--QGAKSDIPAELRFIERPML 61
           E    S   G +PP+  P                    +  +G   D P +L+FI RPML
Sbjct: 24  EKGHKSKKKGEKPPKVSPEHIAEVRAQREAAKKKKREDMIARGLDPDFPPDLQFIHRPML 83

Query: 62  SVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNKFKHYEP 121
           S++P        N     LMTYNCLAQALIRRKLFP SG ALKW++RS+VLLN+F HY  
Sbjct: 84  SLNP----SENANGFVFKLMTYNCLAQALIRRKLFPTSGNALKWFKRSRVLLNEFMHYNS 139

Query: 122 DVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMADKMLIDFD 181
           DVLCLQEVD +Q+ SFW+ EFEKLGY +QFH+  TKNHG+A+VW+  +FTM DKMLID+D
Sbjct: 140 DVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAIVWKRDMFTMVDKMLIDYD 199

Query: 182 KEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQ 241
           KE SG + PRTTT N GL IAL FT++ L  +  + + GI+VGTTHLFWHPFGTFERTRQ
Sbjct: 200 KEPSGALEPRTTTKNVGLAIALGFTKKVLAKYPGSSKRGIIVGTTHLFWHPFGTFERTRQ 259

Query: 242 CYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPVSYSGRA 301
           CYV+LNKMKEFMHR+NVLQ++       W+PFFCGDFNSQP+D PYLS++SKPV+Y GRA
Sbjct: 260 CYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQPFDTPYLSVSSKPVTYKGRA 319

Query: 302 RTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHHPVPATFEPNAEQCALVHQ 361
           +TVIECSTSYTFSK R              NIE FG  QP HPVP  F    EQ  LV  
Sbjct: 320 KTVIECSTSYTFSKAR---DGEECDDEEGGNIEKFGDGQPEHPVPEKFSATEEQKGLVES 376

Query: 362 METLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLDYLFYVGHWD 421
           M +LHNSLDMR +S+YSVGY++VH ENAG DN   EPEISNWA TW GLLDY+F++  WD
Sbjct: 377 MASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWAETWRGLLDYIFFIKKWD 436

Query: 422 FKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLELA 481
           F D+   + LE F+ ++G+ ++ LLRMP  +EM    HGQPH GEY SDHL+M+C+LEL 
Sbjct: 437 FSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPN--HGQPHEGEYGSDHLSMMCELELK 494

Query: 482 L 482
           +
Sbjct: 495 I 495

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/440 (60%), Positives = 336/440 (76%), Gaps = 10/440 (2%)

Query: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPAL 103
           G   D P EL+FI RP+L++H D    +       TLMTYNCLAQALIRRKLFPDSG A+
Sbjct: 95  GLDPDCPPELQFIRRPLLTLHDDEPEKS----FTFTLMTYNCLAQALIRRKLFPDSGEAV 150

Query: 104 KWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAV 163
           KWYRRS+VLLN+FK+Y PD++CLQE+D +Q+ SFW+ EF+K+GYA+QFH+  +KNHGVA+
Sbjct: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210

Query: 164 VWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRD---TPRSG 220
           VW++ LF + D+MLIDFDKE SGD+ PRT TNN GL+++LK+++  L  + +     +SG
Sbjct: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           I++GTTHLFWHPFGT+ERTRQC+V+LNK+KEF  RVNVLQN NDGN  HW  FFCGDFNS
Sbjct: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D PYLS+TSKPV Y  RA+ VIECSTSYT+SK R              NIE FGKDQ
Sbjct: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLR-NGDDDEAEDEEGGNIEKFGKDQ 389

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P  PVP ++ P  EQ  LV +ME+LHNSL+M+A SLY+VGY+ VHPEN+G DN +GEPEI
Sbjct: 390 PQTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEI 449

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHG 460
           SNWAH+W GLLDY+FYV HWDF D   V+  E+FE+ + + ++  LRMP   EM ++  G
Sbjct: 450 SNWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKY--G 507

Query: 461 QPHTGEYPSDHLAMVCDLEL 480
           QPH GEYPSDHL+M+C +EL
Sbjct: 508 QPHQGEYPSDHLSMMCKIEL 527

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/439 (61%), Positives = 329/439 (74%), Gaps = 8/439 (1%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +G   D P EL+FI+RP+L++H D  I  EG  L   L+TYNCLAQALIRRKLFPDSG +
Sbjct: 61  KGMDPDHPPELQFIKRPLLTLHEDEPI--EG--LSFKLLTYNCLAQALIRRKLFPDSGDS 116

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW+RRS+VL  +FKHY  DVLCLQE+D +Q+  FW+ E +KLGY  QF+K+  KNHGV+
Sbjct: 117 LKWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVS 176

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222
           + W+  LF + D+MLID+DKE SG +  RT T+N+GL++ALKFT+ A        +SGIL
Sbjct: 177 IAWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCPHIRKSGIL 236

Query: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQP 282
           VGT+HLFWHPFGT+ERTRQCYVVL KMKEFM RVNVLQN NDGN  HW PFFCGDFNSQP
Sbjct: 237 VGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQP 296

Query: 283 YDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPH 342
           +D PYLSMTSKPV Y+GRA+TV+ECSTSYTFSK R              NIE FGKDQP 
Sbjct: 297 FDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLR--NGEEDAEDEEGGNIEKFGKDQPQ 354

Query: 343 HPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISN 402
            PVP TF+   EQ  LV +M+ LHNS+DMRA+SLY+VGY  VHPEN+G DN RGEPE+SN
Sbjct: 355 TPVPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSN 414

Query: 403 WAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQP 462
           WA+TW GLLDY+  +  WD  DR  VD+LE FE+++ + ++ LLRMP   EM    HGQP
Sbjct: 415 WANTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSH--HGQP 472

Query: 463 HTGEYPSDHLAMVCDLELA 481
           H GEY SDHL+M+C +EL 
Sbjct: 473 HEGEYASDHLSMMCTIELT 491

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/442 (59%), Positives = 326/442 (73%), Gaps = 14/442 (3%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +G   + P +L+FI RPML +  D     EG      +MTYNCLAQALIRRKLFP SG A
Sbjct: 65  RGLDPEFPPDLQFISRPMLPL--DSNYSPEG--FVFKIMTYNCLAQALIRRKLFPTSGNA 120

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW++RS+VLLN+F HY+ DV CLQE+D +Q+ SFW+ EF KLGY +QFH+  TKNHG+A
Sbjct: 121 LKWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIA 180

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL 222
           +VW+  LFTM DKML+D+DKE SG + PRTTT N GLV+AL F+++ L  +  T + GIL
Sbjct: 181 IVWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYPGTSKRGIL 240

Query: 223 VGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNN--QHWFPFFCGDFNS 280
           VGTTHLFWHPFGTFERTRQCYV+LNKMK+F+HRVNVLQ   DG++  + W+PFFCGDFN+
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQ---DGSSPEKKWYPFFCGDFNA 297

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQ 340
           QP+D PYLSM+SKPV Y  RA+TVIECSTSYTFSK R              NIE FG  Q
Sbjct: 298 QPFDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKAR---DGEECDDEEGGNIEKFGDGQ 354

Query: 341 PHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEI 400
           P HPVP T+E   EQ  LV  M  LHNSLDMRA+S+YSV Y++VHPENAG DN   EPEI
Sbjct: 355 PEHPVPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEI 414

Query: 401 SNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHG 460
           SNWA TW GLLDY+F++  W+F D    + L+ FE+++ V +  LLRMP  +EM    HG
Sbjct: 415 SNWAETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMP--NHG 472

Query: 461 QPHTGEYPSDHLAMVCDLELAL 482
           QPH GEY SDHL+++C++EL L
Sbjct: 473 QPHEGEYGSDHLSLMCEIELNL 494

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/431 (56%), Positives = 312/431 (72%), Gaps = 10/431 (2%)

Query: 52  ELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQV 111
           ++ FI+RP+L  + D A G         +MTYNCLAQALIRRKLFP SG ALKW++RS+V
Sbjct: 84  DVGFIKRPLLVCNGDEAKG-----FVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKV 138

Query: 112 LLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFT 171
           LL++ ++Y PDV+CLQE+D  Q+ SFW    +  GY ++FH+   KNHG+A+VWR  LF 
Sbjct: 139 LLSELQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFN 198

Query: 172 MADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWH 231
             D+ LIDFD+EQSG++  RTTT N GL++AL++T++    +  + +SGI+VGT+HLFWH
Sbjct: 199 KVDETLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYPGSAQSGIVVGTSHLFWH 258

Query: 232 PFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMT 291
           PFGT+ER RQCY++L++MK F+ R+ +L+  + G    W PFFCGDFNSQP+DAPYLSM 
Sbjct: 259 PFGTYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMC 318

Query: 292 SKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHHPVPATFEP 351
           SKP+ Y GRARTVIECSTSY FS  R              NIE FG  QP  PVP +F+ 
Sbjct: 319 SKPIIYEGRARTVIECSTSYKFSSLR---DGCAADEEEGGNIEKFGAGQPETPVPDSFDG 375

Query: 352 NAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLL 411
             EQ ALV  M++LHN+LDMRA+SLYS+ YR VHPENAG DN RGEPEISNWAH W GLL
Sbjct: 376 TPEQRALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLL 435

Query: 412 DYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDH 471
           DY+ YV  WDF D T VD + EF++++ V V+ LLR+P   EM    HGQPH GEYPSDH
Sbjct: 436 DYIMYVMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMP--SHGQPHEGEYPSDH 493

Query: 472 LAMVCDLELAL 482
           L+++C+LEL +
Sbjct: 494 LSLMCELELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/430 (56%), Positives = 307/430 (71%), Gaps = 11/430 (2%)

Query: 53  LRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVL 112
           L FI RPML   P             +LMTYNCLAQ+LIRR LFP SG ALKW +RS VL
Sbjct: 69  LEFIARPML---PLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVL 125

Query: 113 LNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTM 172
           L +FKHY  DVLCLQE+D  Q++SFW      LGY ++FH+   K+HGVA+ W+  LF  
Sbjct: 126 LKEFKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIW 185

Query: 173 ADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHP 232
            D+MLI+FD E SG++ PR TTNN G+++AL F+++       T +SGI+VGT+HLFWHP
Sbjct: 186 MDQMLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFPGTVKSGIIVGTSHLFWHP 245

Query: 233 FGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTS 292
           FGT+ERTRQCYV+LNKMKEF+HRV++ QNE+  +   W+PFFCGDFNSQP+DAPYLS+TS
Sbjct: 246 FGTYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITS 305

Query: 293 KPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKDQPHHPVPATFEPN 352
           KPV YSGRA+TVIECS +Y F                  +    G+D+P  PVP +F+P 
Sbjct: 306 KPVLYSGRAKTVIECSAAYKFPD------LGAGARGANEDGGTVGEDRPVDPVPESFQPT 359

Query: 353 AEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNWAHTWNGLLD 412
           AE  +LV +ME LHNSLDMRA+SLY+V Y++VHP+NAG DN RGEPEISNWA+TW GLLD
Sbjct: 360 AEVSSLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLD 419

Query: 413 YLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPHTGEYPSDHL 472
           Y+ Y+  W   +   VD+LE FE+ S +TV+ +LRMP  +EM    HGQPH GEYPSDHL
Sbjct: 420 YIMYITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMS--SHGQPHDGEYPSDHL 477

Query: 473 AMVCDLELAL 482
           AM+C LE+ +
Sbjct: 478 AMMCKLEVEM 487

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  443 bits (1139), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 221/444 (49%), Positives = 298/444 (67%), Gaps = 17/444 (3%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           QG   DIP EL+F  RP L++H +     E  +   +++TYNCLAQ LI R +FP+SG A
Sbjct: 44  QGLDPDIPPELQFQRRPFLTLHDNEPDNGES-KHEFSILTYNCLAQGLIMRDMFPESGNA 102

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW RRS+ ++N+ K+Y PD++CLQE+D      FW  +F+ LGY+ +F KK+ K HGV 
Sbjct: 103 LKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGVV 162

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRS--- 219
           + WR  +F   D+  +DFD+  +GD+PPRT T N GL++AL+F    L  + + P     
Sbjct: 163 IAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQF----LDNNNNNPSRESH 218

Query: 220 GILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFN 279
           GI+V TTHLFWHPFGTFERTRQCY++L++M +F+  +    NE+ G   +W+PF  GDFN
Sbjct: 219 GIVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFL----NEHSGIT-NWYPFLTGDFN 273

Query: 280 SQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRX-XXXXXXXXXXXXXNIEIFGK 338
           SQP DAPY+SMT+KP+ Y    RTVIECSTSYT+SK+R                 E F K
Sbjct: 274 SQPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIK 333

Query: 339 DQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEP 398
            QP  P PA F+P  EQ ALV+ ++ LHNSL  RA+SLYSVGYRNVHPEN+  +N RGEP
Sbjct: 334 KQPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNTRGEP 393

Query: 399 EISNWAHTWNGLLDYLFYVGHWDFKDRT-GVDTLEEFEQDSGVTVKRLLRMPSKQEMQQF 457
           E S+W   W+GLLDY+FY+  W+ KD+   V+TLE FE+ + + +   L++P ++EM   
Sbjct: 394 EFSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKEMAH- 452

Query: 458 GHGQPHTGEYPSDHLAMVCDLELA 481
            H QP+ GEYPSDHLA++C L+L 
Sbjct: 453 -HSQPYEGEYPSDHLALMCKLQLT 475

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  443 bits (1140), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 297/454 (65%), Gaps = 35/454 (7%)

Query: 44  GAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPAL 103
           G + DIP+EL+FI+RP+L++H D  +  +G  L +  MTYNCLAQ+LI+R LFP SG AL
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPV--KGTMLKI--MTYNCLAQSLIQRDLFPGSGQAL 116

Query: 104 KWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVAV 163
           KW RRS+VLLN+ K+Y+ D+L LQE+D VQ+  +W+    KLGY  +F+KK  K HGV +
Sbjct: 117 KWVRRSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLI 176

Query: 164 VWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILV 223
            W+  LF     + IDFD+  SG + PRT T N GLVIAL+F  +  +  +   + G+++
Sbjct: 177 AWKRNLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIK---KKGVII 233

Query: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPY 283
           GTTHLFWH FGTFERTRQCYV++++M +FM ++        G  + W+PFF GDFNSQP 
Sbjct: 234 GTTHLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPK 285

Query: 284 DAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFGKD---- 339
           DAPY+S+TSKPVS+    + VIECS +Y +SK+R              + EI   D    
Sbjct: 286 DAPYVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQH-EIDSSDSSDA 344

Query: 340 ------------QPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPE 387
                       QP +  P  F P  EQ  LV Q+  LHNSL++RA+SLYSVGYR V PE
Sbjct: 345 ETDEEKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPE 404

Query: 388 NAGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFK-DRTGVDTLEEFEQDSGVTVKRLL 446
           NA  +N RGEPE+S WA  W+GLLDY+F++ HWD K +   VD+L+ FE+++ V ++ LL
Sbjct: 405 NAYINNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLL 464

Query: 447 RMPSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           +MP  +EM +  H  P+ GEYPSDHL M+  LEL
Sbjct: 465 KMPQSKEMCE--HAIPYKGEYPSDHLCMMIQLEL 496

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  436 bits (1120), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 206/449 (45%), Positives = 294/449 (65%), Gaps = 23/449 (5%)

Query: 42  LQGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP 101
           +QG   D P EL FI+RP+L +   G    +G +   +LMTYNCLAQA+IRR++F DSGP
Sbjct: 39  IQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKF--SLMTYNCLAQAMIRREVFSDSGP 96

Query: 102 ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFE-KLGYAAQFHKKQTKNHG 160
           ALKW+RRS+VL+N+  +Y PD+LCLQE+D  Q+ +FW+ + E  L     ++K++ K+HG
Sbjct: 97  ALKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHG 156

Query: 161 VAVVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTGH------- 213
           V + W+  +F   D M++DFD  ++ ++  RT T N  + +ALKF ++ +T +       
Sbjct: 157 VLIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHS 216

Query: 214 RDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF 273
            D    G ++ TTHLFWHPFGTFERTRQCY++L KMK+F+  +NV     D    HW+PF
Sbjct: 217 FDQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPF 272

Query: 274 FCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNI 333
            CGDFNS P DAPYLSMTSKP+ Y+GR + VIECST+Y FSK+R               I
Sbjct: 273 ICGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEEEKKLI 332

Query: 334 EIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADN 393
                +QP   VP +F P  EQ  LVHQ+++LHN L +RA SLY + Y+ V P N   +N
Sbjct: 333 -----NQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINN 387

Query: 394 ARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGV--DTLEEFEQDSGVTVKRLLRMPSK 451
            RGEPE ++WA +W+G+LDY+ YV +WD  +      ++LEEFE+++ + +K LL+MP  
Sbjct: 388 DRGEPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLN 447

Query: 452 QEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           ++M    H QP   EYPSDH++++C++E+
Sbjct: 448 KDMP--FHTQPFEREYPSDHISILCEMEI 474

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  366 bits (939), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 186/439 (42%), Positives = 274/439 (62%), Gaps = 24/439 (5%)

Query: 55  FIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLN 114
           FI+R +L + P+  +    N + + +MTYN L+Q+LIRR+++PD+  A+KW+ RS+V+LN
Sbjct: 53  FIKRAILQL-PN--VEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILN 109

Query: 115 KFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHK--KQTKNHGVAVVWRSKLFTM 172
           + K+Y  D++C QEVD +QW  FW  E  KLGY  +F+K  +  K HGVA+ WRS LF  
Sbjct: 110 EIKYYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQ 169

Query: 173 ADKMLIDFDKEQSGDVPPRTT-TNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWH 231
            D + I+FD   +G+   +TT T N GL++ALKF            RSGI++GTTHLFWH
Sbjct: 170 FDVIKINFDDIVAGNAISKTTRTWNVGLIVALKFKSSNAKF-----RSGIVIGTTHLFWH 224

Query: 232 PFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMT 291
           PFGTFERTRQ  ++L K ++ +  +N      +  +  W P   GDFNSQP D PYLS+T
Sbjct: 225 PFGTFERTRQLAILLKKFRKLIDNLNTECGHINEMSNRWLPILTGDFNSQPCDMPYLSIT 284

Query: 292 SKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIE--------IFGKDQPHH 343
           SKPVS SG A+TVIECST+Y FS++R                +           +  P  
Sbjct: 285 SKPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPID 344

Query: 344 PVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEISNW 403
           P P+ FE  +EQ  L+ ++E +HNS++++A SL+ + Y+ VH   +   N + EPE+S+ 
Sbjct: 345 PRPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVH---SIGLNCKNEPELSHT 401

Query: 404 AHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQPH 463
           +  W GLLDY+F +  W+  ++T   +LE+FE+   + VK LL+MP  +E+ +  + QPH
Sbjct: 402 SIFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPK--NVQPH 459

Query: 464 TGEYPSDHLAMVCDLELAL 482
            G+YPSDHL+M+CDL + +
Sbjct: 460 QGQYPSDHLSMICDLNVRI 478

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  355 bits (910), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 187/450 (41%), Positives = 270/450 (60%), Gaps = 25/450 (5%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +  ++D+  E+ FI+RP+L V   G +      + V +MTYN LAQ LIRR  FPD+  A
Sbjct: 32  KAERADVAREI-FIKRPLLEVPYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDA 90

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           +KW+RRSQVL+ + ++Y+ DV+CLQE D +QW  FW  EF++LGY   F     K HGVA
Sbjct: 91  IKWHRRSQVLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVA 150

Query: 163 VVWRSKLF--TMADKMLIDFDKEQSG-DVPPRTTTNNAGLVIALKFTEQALTGHRDTPRS 219
           +VW++ +F  T  DK+ +  D   +G D+   T T    L +AL+        H  T R 
Sbjct: 151 IVWKTSMFEDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALRL------KHHKTSRP 204

Query: 220 GILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFN 279
            I+  TTHLFWH FGTFERTRQ +V+L+++ +F+ +V    + +    Q  + FF GDFN
Sbjct: 205 -IIFSTTHLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFN 260

Query: 280 SQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXX-----XXNIE 334
           SQP DAPYLS+T KPV   GRA+++IECS SY +SK+R                   ++E
Sbjct: 261 SQPCDAPYLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVE 320

Query: 335 IFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAG--AD 392
               ++P  P P T++   EQ   V  ++ LHN + ++ VSLY +GY  VHPEN+   + 
Sbjct: 321 D-ETNRPQDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYST 379

Query: 393 NARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQ 452
           +   EP++S+ A  W+GLLDY+F +  W  ++ T +  L+  E+ +G+ +   LRMP K+
Sbjct: 380 SVNQEPQLSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKE 438

Query: 453 EMQQFGHGQPHTGEYPSDHLAMVCDLELAL 482
           EM    H +PH  EYPSDHLAM+CD+ L L
Sbjct: 439 EM--CDHTEPHENEYPSDHLAMMCDISLPL 466

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  354 bits (908), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 189/452 (41%), Positives = 269/452 (59%), Gaps = 36/452 (7%)

Query: 43  QGAKSDIPA-ELRFIERPMLSVHPD--------GAIGAEGNRLPVTLMTYNCLAQALIRR 93
           QG   D P  +L+FIERP+L +  +          I A  + L + +MTYN LAQ LIRR
Sbjct: 66  QGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTLIRR 125

Query: 94  KLFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHK 153
             FP SG ALKW++RS+VL+++ K Y PD++ LQEVD  +   FWR  F KLG+   F +
Sbjct: 126 DFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNEL-KFWRENFHKLGFDLSFRR 184

Query: 154 KQTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDV-PPRTTTNNAGLVIALKFTEQALTG 212
              K HG+ V W ++ F + ++ ++D+D+  +G+V   RT T N  L+++L+F +     
Sbjct: 185 NGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT---- 240

Query: 213 HRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQH-WF 271
            R+   +GI+V  THLFWHPFG FER RQ Y+VL K++E            D    H W 
Sbjct: 241 -RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKYHGWH 289

Query: 272 PFFCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXX 331
               GDFN++P + PYL++TSKP++ +G  R ++ECS +Y +SK+R              
Sbjct: 290 SLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDEDYDE 349

Query: 332 NIEIFGK---DQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPEN 388
           N    G+   +QP +P P  F    E+  LV+Q+ TLHNSL ++ +SLY +GY  VHPEN
Sbjct: 350 NSR--GERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHPEN 407

Query: 389 AGADNARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRM 448
             A+   GEPE+SNWA+TW GLLDY+FY+   D        +L  FE+++GV V   LRM
Sbjct: 408 --ANEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYLRM 465

Query: 449 PSKQEMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           P KQEM +  H QP  GEY SDH++++C + L
Sbjct: 466 PCKQEMPK--HSQPFEGEYASDHISLMCQIRL 495

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  349 bits (896), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 188/448 (41%), Positives = 263/448 (58%), Gaps = 29/448 (6%)

Query: 43  QGAKSDIPA-ELRFIERPMLSVHPDGAIG-------AEGNRLPVTLMTYNCLAQALIRRK 94
           QG   D P  +L+FIERP L ++ D + G          + L V +MTYN LAQ LIRR 
Sbjct: 66  QGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLIRRD 125

Query: 95  LFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKK 154
            FP+SGPALKW++RS+VL+++ K Y PDV+ LQEVD  +  +FW+  F KLG+   F + 
Sbjct: 126 FFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNEL-NFWQENFHKLGFDVIFKRH 184

Query: 155 QTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDV-PPRTTTNNAGLVIALKFTEQALTGH 213
           + K HG+ V W +K F + +  ++D+D   +G+V   RT T N  L+I+L F      G 
Sbjct: 185 EGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYF-----KGI 239

Query: 214 RDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF 273
            D+   GI+V  THLFWHPFG FER RQ Y+VL K++E    +      N      W   
Sbjct: 240 TDSSSRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQE----IKACSKYNG-----WHSL 290

Query: 274 FCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNI 333
             GDFN++P + PYL++T +P+   G  R ++ECS +Y +SK+R                
Sbjct: 291 LMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEECDEKS 350

Query: 334 EIFG-KDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGAD 392
              G  DQP +P P +F    E+ ALV+Q+  LHNSL ++ VSLY +GY  VHPEN  A+
Sbjct: 351 RGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPEN--AN 408

Query: 393 NARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQ 452
            + GEP +SNWA+TW GLLDY+FY+     +D    + L  FE ++ V +   LRMP  Q
Sbjct: 409 GSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRMPCAQ 468

Query: 453 EMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           EM +  H QP  GEY SDH++++C + L
Sbjct: 469 EMPK--HSQPFEGEYASDHISLMCQIRL 494

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  345 bits (886), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/448 (41%), Positives = 257/448 (57%), Gaps = 35/448 (7%)

Query: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102
           +G   D PAE +FIERP+L V P G     G  LP+++MTYNCLAQ LIRR++FP+SGPA
Sbjct: 48  RGLDPDFPAECQFIERPILLV-PHGDNYERG--LPLSIMTYNCLAQTLIRREMFPESGPA 104

Query: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162
           LKW+ RS+VLL++ KHY  D+ CLQE+D VQ+  FW  E  K GY   +  + +K+HGV 
Sbjct: 105 LKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVM 164

Query: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTE--QALTGHRDTPRSG 220
           + W+ +LF +   M I+FDKE    + PRT TNN GL++AL FT+  +A      T RSG
Sbjct: 165 IAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSG 224

Query: 221 ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           +++GT HLFWHPFGT++RTRQC V+  K+ EF   V             +   F GDFNS
Sbjct: 225 VIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTV----------KGDYCKMFTGDFNS 274

Query: 281 QPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIF---- 336
           QP   PYL +T      + + RT IE ST+Y +S++R                E      
Sbjct: 275 QPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREY 334

Query: 337 ----GKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGAD 392
               G D  + P P  F+   EQ  LV+ +    N + + A SLYS+GY  V P +    
Sbjct: 335 EYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIADH 394

Query: 393 NARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQ 452
           +   EPE+S+W+  W GLLDY+FYV            T   FE  + + +   L+MP+  
Sbjct: 395 H---EPELSSWSTKWAGLLDYIFYVNQ-------RPSTPATFETANNIAIAGYLQMPTHA 444

Query: 453 EMQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           +M    H QP+TGEYPSDH++M+C LE+
Sbjct: 445 QMH--NHSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  344 bits (883), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 184/442 (41%), Positives = 262/442 (59%), Gaps = 25/442 (5%)

Query: 43  QGAKSDIPA-ELRFIERPMLSVHPDGAIGAEG---NRLPVTLMTYNCLAQALIRRKLFPD 98
           QG   D P  +L+FI+RP L +H + A G+     N L V +MTYN LAQ LIRR  FP 
Sbjct: 68  QGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNFFPQ 127

Query: 99  SGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKN 158
           SG ALKW++RS+VL+++ K Y+PD++ LQEVD  +   FW+  F KLG+   F +   K 
Sbjct: 128 SGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-KFWQENFRKLGFDLTFKRHDGKT 186

Query: 159 HGVAVVWRSKLFTMADKMLIDFDKEQSGD-VPPRTTTNNAGLVIALKFTEQALTGHRDTP 217
           HG+ + W S  F + ++ ++D+D   +G+ +P RT T N  L+ +L+     L    D  
Sbjct: 187 HGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLR-----LKNISDPS 241

Query: 218 RSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGD 277
             G++V  THLFWHPFG FER RQ Y+VL K++E    +      N      W     GD
Sbjct: 242 TDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQE----IKACPKYNG-----WHSVLMGD 292

Query: 278 FNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNIEIFG 337
           FN++P + PYL++T KPV+ +G AR + ECS +Y +SK+R                   G
Sbjct: 293 FNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQSRGEG 352

Query: 338 K-DQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARG 396
           + +QP +P P +F   +EQ ALV Q+  LHNSL +R VSLY +GY  V PEN+   N  G
Sbjct: 353 RFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHESN--G 410

Query: 397 EPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQ 456
           EPE+SNWA++W GLLDY+FY+ H D       + +++FE  + + V   L+MP  +EM +
Sbjct: 411 EPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAKEMPK 470

Query: 457 FGHGQPHTGEYPSDHLAMVCDL 478
             H QP  GEY SDH++++C L
Sbjct: 471 --HSQPFEGEYASDHVSLMCQL 490

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  328 bits (842), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/447 (38%), Positives = 262/447 (58%), Gaps = 28/447 (6%)

Query: 43  QGAKSDIPA-ELRFIERPMLSVHPDGAIGAE--GNRLP-----VTLMTYNCLAQALIRRK 94
           QG   D P  +L+FIERP L V+ + +  ++  G ++P     V +MTYN LAQ LIRR 
Sbjct: 68  QGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLIRRD 127

Query: 95  LFPDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKK 154
            FP SG ALKW++RS+VL+++ K Y+PD++ LQEVD  +   FW   F KLG+ + F + 
Sbjct: 128 FFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTFRRH 186

Query: 155 QTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGD-VPPRTTTNNAGLVIALKFTEQALTGH 213
           + K HG+ V W ++ F   ++ ++D+D   +G+ +  RT T N  L+++L     ++   
Sbjct: 187 EGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSL-----SVKNM 241

Query: 214 RDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF 273
            +   SG++V  THLFWHPFG FER RQ ++VL K++E          +       W   
Sbjct: 242 TNLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEI---------KTCPKYYGWHSL 292

Query: 274 FCGDFNSQPYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRXXXXXXXXXXXXXXNI 333
             GDFN++P + PY+++T +P++ +G AR + ECS +Y +SK R              + 
Sbjct: 293 LMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECDEEST 352

Query: 334 EIFGKDQPHHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADN 393
                DQP +P P  F    EQ  LV+Q+  LHNSL ++ +SLY + Y  VHP+N+  ++
Sbjct: 353 GEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDNSKENH 412

Query: 394 ARGEPEISNWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQE 453
             GEPE+SNWA+TW GLLDY+FY+   D    +  + ++ FE  + V +   LRMP  +E
Sbjct: 413 --GEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRMPRAEE 470

Query: 454 MQQFGHGQPHTGEYPSDHLAMVCDLEL 480
           M +  H QP  GEY SDH++++C L L
Sbjct: 471 MPK--HSQPFEGEYASDHISLMCQLRL 495

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 79.7 bits (195), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 70/230 (30%), Positives = 104/230 (45%), Gaps = 37/230 (16%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           TL++YN L Q     K++      AL W  R + L  +   Y+ DV+CLQEV++  +  F
Sbjct: 446 TLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVICLQEVESKTYEEF 505

Query: 138 WRGEFEKLGYAAQFHKK------QTKN----HGVAVVWRSKLFTMADKMLIDFDK----- 182
           W    EK GY+  FH K      Q K+     G  + +++  F+   K  IDF       
Sbjct: 506 WLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIFKDAIDFSSVWMKH 565

Query: 183 ---EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFER 238
              +++ D   R    +N  L++ LK     L+G        + V TTHL W P     +
Sbjct: 566 KKFQRTEDYLNRAMNKDNIALIVKLK---HELSGEH------VWVVTTHLHWDPHFNDVK 616

Query: 239 TRQCYVVLNKMKEFMHRVNVLQNENDGNNQH--WFPF-FCGDFNSQPYDA 285
           T Q  V+L+ +++ +      Q  N GN Q     P   CGDFNSQ + A
Sbjct: 617 TFQVGVLLDYIEKLLK-----QQSNIGNPQEKKKVPLIICGDFNSQSHSA 661

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/276 (28%), Positives = 115/276 (41%), Gaps = 51/276 (18%)

Query: 57  ERPMLSVHPDGAIGAEGNRL--------------PVTLMTYNCLAQALIRRKLFPDSGP- 101
           +R  + V+ DG    E N L                TL++YN L Q     K++  +   
Sbjct: 364 DRKFIDVNTDGEPTEEFNSLQESTQHLSKETLKRSFTLLSYNTLCQHYATPKMYRYTPSW 423

Query: 102 ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKK------Q 155
           AL W  R   L  +   ++ DV+CLQEV+   +  FW    +K GY   FH K      Q
Sbjct: 424 ALSWDYRRDKLKEQIISFQADVVCLQEVECKTFEDFWAPFLQKHGYTGVFHAKTRARTMQ 483

Query: 156 TKNH----GVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT-NNAGLVIA 202
           +K+     G  V +++  F +  K  +DF          +++ D   R    +N  L + 
Sbjct: 484 SKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALFVK 543

Query: 203 LKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNE 262
           L+        H  T    I V TTHL W P     +T Q  V+L+ M++ +   N +   
Sbjct: 544 LQ--------HLKT-NEQIWVTTTHLHWDPQFNDVKTFQVGVLLDYMEKLLRDQNGV--- 591

Query: 263 NDGNNQHW--FPF-FCGDFNSQPYDAPYLSMTSKPV 295
             GNNQ     P   CGDFNSQ   A Y   +S  V
Sbjct: 592 --GNNQEMKKVPLVICGDFNSQLDSAVYELFSSGTV 625

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 102/224 (45%), Gaps = 33/224 (14%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           TL++YN L Q     K++      AL W  R + L ++   Y+ D++CLQEV++  +  F
Sbjct: 399 TLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICLQEVESKTYEEF 458

Query: 138 WRGEFEKLGYAAQFHKK------QTKN----HGVAVVWRSKLFTMADKMLIDFDK----- 182
           W    EK GY+  FH K      Q+K+     G  + +++  FT   K  IDF       
Sbjct: 459 WLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKDAIDFSSVWMKH 518

Query: 183 ---EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFER 238
              +++ D   R    +N  L+I L+      TG        + V TTHL W P     +
Sbjct: 519 KKFQRTEDYLNRAMNKDNVALIIKLRHER---TGEH------VWVVTTHLHWDPHFNDVK 569

Query: 239 TRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF-FCGDFNSQ 281
           T Q  V+L+ +++ + +   + +  D       P   CGDFNSQ
Sbjct: 570 TFQVAVMLDYIEKLLKQHGGVGSPQDKKK---IPLVICGDFNSQ 610

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 108/272 (39%), Gaps = 46/272 (16%)

Query: 57  ERPMLSVHPDG--------------AIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP- 101
           +RP + +  DG               +  E  +   T+++YN L Q     K++  +   
Sbjct: 400 DRPFVELDIDGEPKHEYESLQESSQGVDHELTKKSFTVLSYNTLCQHYATPKMYRYTPSW 459

Query: 102 ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKK------- 154
           AL W  R   L ++   Y  D++CLQEV+A  +  FW    EK GY+  FH K       
Sbjct: 460 ALSWEYRRAKLRDQILSYSCDIMCLQEVEARTFEDFWLPLLEKHGYSGSFHAKTRAKLLQ 519

Query: 155 ---QTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTTNNAGLVIAL 203
                K  G  V ++   F +  K  +DF          +++ D   R    +    IAL
Sbjct: 520 HRDSKKVDGCCVFFKRTKFRLIKKEEVDFSSTWMKHEKFQRTEDFLNRAMNKDN---IAL 576

Query: 204 KFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNEN 263
            F  Q +          I V TTHL W P     +T Q  V+L+ ++  + + N  Q+  
Sbjct: 577 YFKLQHIASGEH-----IWVATTHLHWDPKFNDVKTFQVGVLLDHLQTLIRQDNPRQDVK 631

Query: 264 DGNNQHWFPFFCGDFNSQPYDAPYLSMTSKPV 295
                      CGDFNS    A Y  ++S  V
Sbjct: 632 KAP-----VIICGDFNSYIDSAVYELLSSGSV 658

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 114/286 (39%), Gaps = 58/286 (20%)

Query: 49  IPAELRFIERPMLSVHPDGAIGAEGNRL--------------PVTLMTYNCLAQALIRRK 94
           +P E +FI+     ++ DG    E + L                T+++YN L Q     K
Sbjct: 370 LPTERKFID-----INIDGEATQECSSLQESDAHQSRETLKKSFTILSYNTLCQHYATPK 424

Query: 95  LFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH- 152
           ++  +   AL W  R + L  +   Y  D++CLQEV+   +  FW     + GY+  FH 
Sbjct: 425 MYRFTPSWALSWEYRREKLKEQILSYNTDIVCLQEVECKTYEDFWAPLLREKGYSGIFHT 484

Query: 153 ---------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT- 194
                    K   K  G    ++   F +  K  +DF          +++ D   R    
Sbjct: 485 KTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKEAVDFSSVWMKHKKFQRTEDYLNRAMNK 544

Query: 195 NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254
           +N  LV+ L+  +             +   TTHL W P     +T Q  V+L+ M++   
Sbjct: 545 DNVALVVKLQHIKSG---------EHVWAATTHLHWDPQFNDVKTFQVGVLLDYMEK--- 592

Query: 255 RVNVLQNENDGNNQHWFP----FFCGDFNSQPYDAPYLSMTSKPVS 296
              V++ +N+ NN           CGDFNSQ   A Y  + +  VS
Sbjct: 593 ---VIKEQNNCNNTQELKKVPVVICGDFNSQTNSAVYELLNTGNVS 635

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/258 (25%), Positives = 110/258 (42%), Gaps = 27/258 (10%)

Query: 48  DIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP-ALKWY 106
           +I AE   +E+       D  + +E ++   T+++YN L Q     K++  +   AL W 
Sbjct: 434 EINAEGEPVEKYRSLHEADEHLSSELSKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWD 493

Query: 107 RRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH----------KKQT 156
            R + L  +   Y  DV+CLQEV+A  +  +W    +K GY+  FH          K   
Sbjct: 494 YRREKLTEQILSYMTDVICLQEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSK 553

Query: 157 KNHGVAVVWRSKLFTMADKMLIDFD-------KEQSGDVPPRTTTNNAGLVIALKFTEQA 209
           K  G  V +R   F +A K  +DF        K Q  +       N   + I LK     
Sbjct: 554 KVDGCCVFYRENEFKLAYKDAVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQ--- 610

Query: 210 LTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQH 269
              H  +  S + + TTHL W P     +T Q  V+++ ++  +   +  Q++ +   + 
Sbjct: 611 ---HIKSGES-VWIVTTHLHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEA--KK 664

Query: 270 WFPFFCGDFNSQPYDAPY 287
                CGD NS+ + A Y
Sbjct: 665 CPVILCGDLNSEIHSAVY 682

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 64/254 (25%), Positives = 103/254 (40%), Gaps = 39/254 (15%)

Query: 66  DGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVL 124
           D  +  E  +   TL++YN L Q     K++  +   AL W  R + L  +  +Y  D++
Sbjct: 398 DSHLNRETAKKSFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDII 457

Query: 125 CLQEVDAVQWHSFWRGEFEKLGYAAQFH----------KKQTKNHGVAVVWRSKLFTMAD 174
           CLQEV+   +  FW     + GY   FH          K   K  G  + +R   F +  
Sbjct: 458 CLQEVECKTYEDFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIF 517

Query: 175 KMLIDFDK--------EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGT 225
           K  +DF          +++ D   R    +N  L++ L+  +             +   T
Sbjct: 518 KDTVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSG---------EHVWAAT 568

Query: 226 THLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFP----FFCGDFNSQ 281
           THL W P     +T Q  V+L+ M++      V++  +  NN           CGDFNSQ
Sbjct: 569 THLHWDPQFNDVKTFQVGVLLDHMEK------VIKEHSGYNNSQELKKVPVIICGDFNSQ 622

Query: 282 PYDAPYLSMTSKPV 295
              A Y  +++  V
Sbjct: 623 VDSAVYELLSTGSV 636

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 73.6 bits (179), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 113/274 (41%), Gaps = 55/274 (20%)

Query: 49  IPAELRFIERPMLSVHPDG--------------AIGAEGNRLPVTLMTYNCLAQALIRRK 94
           +PA+ +FIE     ++ DG              A+ A   +   T+++YN L Q     K
Sbjct: 428 LPADRKFIE-----INTDGEPTREFDSLESANTAVEAGLLKKSFTILSYNTLCQHYATPK 482

Query: 95  LFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH- 152
           ++  +   AL+W  R + L  +   Y  D+LCLQEV++  +  FW    EK GY   FH 
Sbjct: 483 MYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYEDFWAPLLEKNGYTGYFHC 542

Query: 153 ---------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT- 194
                    K   K  G  V ++   F +  K  +DF          +++ D   R    
Sbjct: 543 KTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQKHKRFQRTEDYLNRAMNK 602

Query: 195 NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254
           +N  + + L+  +             + V TTHL W P     +T Q  V+L+ M+    
Sbjct: 603 DNVAIYMKLQHVQSG---------EYLWVVTTHLHWDPKFNDVKTFQVGVLLDHME---- 649

Query: 255 RVNVLQNENDGNNQHWFPFFC-GDFNSQPYDAPY 287
             ++++ EN   +   FP    GDFNS    A Y
Sbjct: 650 --SIIKEENPKQDVKKFPIIITGDFNSYLTSAVY 681

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 72.8 bits (177), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 97/224 (43%), Gaps = 33/224 (14%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           TL++YN L       K++  +   AL W  R + L  +   ++ DV+CLQEV+ + +  +
Sbjct: 455 TLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICLQEVETLTYEEY 514

Query: 138 WRGEFEKLGYAAQFH----------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK----- 182
           W    EK  Y+  FH          K   K  G A+ ++   F +  +  IDF       
Sbjct: 515 WVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQDSIDFSSAWRSH 574

Query: 183 ---EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFER 238
               ++ D   R    +N  L+  LK        H +T    + V TTHL W P     +
Sbjct: 575 KKFHRTEDYLNRAMNKDNVALIAELK--------HLNT-NENVWVVTTHLHWDPQFNDVK 625

Query: 239 TRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF-FCGDFNSQ 281
           T Q  V+L+ ++  + + + + N ND       P   CGDFNSQ
Sbjct: 626 TFQVGVMLDYLETLIKQHHHVNNNNDIKK---IPMVICGDFNSQ 666

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 108/245 (44%), Gaps = 42/245 (17%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           T+++YN L Q     K++  +   AL W  R + L  +  ++  D++CLQEV+A  +  F
Sbjct: 539 TMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFEDF 598

Query: 138 WRGEFEKLGYAAQFHKK------QTKNH----GVAVVWRSKLFTMADKMLIDFDK----- 182
           W+   EK GY   FH K      Q+K+     G    +++  F M  K  +DF       
Sbjct: 599 WQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMKH 658

Query: 183 ---EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFER 238
              +++ D   R    +N  +V+ L+  +             + + TTHL W P     +
Sbjct: 659 KKFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEI---------MWLVTTHLHWDPKFNDVK 709

Query: 239 TRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPF-FCGDFNSQPYDAPYLSMTSKPVSY 297
           T Q  V+L+ M+       +L+ +N   +   +P   CGD NS      YLS +   +  
Sbjct: 710 TFQVGVLLDHME------TLLKEQNPKQDVKKYPLVICGDLNS------YLSSSVYELFS 757

Query: 298 SGRAR 302
           +GR +
Sbjct: 758 TGRVQ 762

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 92/227 (40%), Gaps = 27/227 (11%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           T+M+YN L Q     K++  +   AL W  R Q L  +   Y  D++CLQEV+A  +   
Sbjct: 525 TIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEAKTYEEH 584

Query: 138 WRGEFEKLGYAAQFH----------KKQTKNHGVAVVWRSKLFTMADKMLIDFD------ 181
           W     K GY+  FH          K   K  G  V ++   F +  K  +DF       
Sbjct: 585 WAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDFSSTWMKH 644

Query: 182 -KEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTR 240
            K Q  +       N   +VI +K        H  +  S + + TTHL W P     +T 
Sbjct: 645 KKFQRTEDYLNRAMNKDNVVIYIKL------NHLKSGES-VWIATTHLHWDPQFNDVKTF 697

Query: 241 QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPY 287
           Q  ++++ ++E +       +  D          CGDFNSQ   A Y
Sbjct: 698 QVGILMDHLEELIKEHGSPSSRQDPKKSPV--IICGDFNSQKDSAVY 742

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 70.9 bits (172), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 70/273 (25%), Positives = 106/273 (38%), Gaps = 50/273 (18%)

Query: 49  IPAELRFIERPMLSVHPDGA--------------IGAEGNRLPVTLMTYNCLAQALIRRK 94
           +P E RFIE     ++ DG               + A+  +   T+++YN L Q     K
Sbjct: 461 LPHERRFIE-----INTDGEPQREYDSLQQSTEHLTADLAKRSFTVLSYNTLCQHYATPK 515

Query: 95  LFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH- 152
           ++  +   AL W  R   L  +   Y  DVLCLQEV++  +  +W    EK GY   FH 
Sbjct: 516 MYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFEDYWVPLLEKHGYTGVFHA 575

Query: 153 ---------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT- 194
                    K   K  G  + ++   F M ++  +DF          +++ D   R    
Sbjct: 576 KARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWMKHKKFQRTEDYLNRAMNK 635

Query: 195 NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254
           +N  L + L+      T         I V TTHL W P     +T Q  V+L+ ++  + 
Sbjct: 636 DNVALFLKLQHVSSGDT---------IWVVTTHLHWDPKFNDVKTFQVGVLLDHLETLLK 686

Query: 255 RVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPY 287
                 +  D          CGDFNS    A Y
Sbjct: 687 EDTTHNSRQDIKKSPV--LICGDFNSYINSAVY 717

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 70.1 bits (170), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 96/233 (41%), Gaps = 32/233 (13%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           T+++YN L Q     K++  +   AL W  R + L  +   Y+ D+LCLQEV++  +  F
Sbjct: 570 TILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEEF 629

Query: 138 WRGEFEKLGYAAQFH----------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK----- 182
           W    EK  Y   FH          K+  K  G  + ++   F +  K  +DF       
Sbjct: 630 WGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMKH 689

Query: 183 ---EQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERT 239
              +++ D   R    +    +AL    Q++T         + V TTHL W P     +T
Sbjct: 690 KKFQRTEDYLNRAMNKDN---VALYMKLQSITSGE-----TVWVVTTHLHWDPKFNDVKT 741

Query: 240 RQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPYLSMTS 292
            Q  ++L+ M+  +   N  Q+    N        CGD NS    A Y   T+
Sbjct: 742 FQVGILLDHMETLLKEENPKQDVKKAN-----VVICGDLNSYLDSAVYELFTT 789

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/284 (23%), Positives = 120/284 (42%), Gaps = 56/284 (19%)

Query: 42  LQGAKSDIPAELRFIERPMLSVHPDGAI--------------GAEGNRLPVTLMTYNCLA 87
           L+  + +IP E    +R  + ++ DG I                E  +   T+++YN L 
Sbjct: 405 LRDNRPEIPLE---KDRQFIEINTDGDIQDGYENVEVSNEHLNPELQKKSFTVLSYNTLC 461

Query: 88  QALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLG 146
           Q     K++  +   AL W  R + L ++   ++ DV+CLQEV++  +  FW    +K G
Sbjct: 462 QHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYEEFWLPLLQKNG 521

Query: 147 YAAQFHKK------QTKNH----GVAVVWRSKLFTMADKMLIDFDK--------EQSGDV 188
           YA  F+ K      QTK+     G  + ++   F +  K  +DF          +++ D 
Sbjct: 522 YAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWMKHKKFQRTEDY 581

Query: 189 PPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLN 247
             R    +N  L + L+  +             + V TTHL W P     +T Q  ++L+
Sbjct: 582 LNRAMNKDNVALYMKLEHIKSG---------ESVWVVTTHLHWDPQFNDVKTFQVGILLD 632

Query: 248 KMKEFMHRVNVLQNENDGNNQHWF----PFFCGDFNSQPYDAPY 287
            ++E      +L++ N+ +++          CGD NS    A Y
Sbjct: 633 HLEE------LLKDNNNASSKQEIRKCPVIICGDLNSHLDSAVY 670

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/243 (26%), Positives = 102/243 (41%), Gaps = 33/243 (13%)

Query: 66  DGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVL 124
           D  I  E  +   T+++YN L Q     K++  +    L W  R + L N+    + DV+
Sbjct: 528 DSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDTRREQLKNQILGIQSDVI 587

Query: 125 CLQEVDAVQWHSFWRGEFEKLGYAAQFHKK------QTKNH----GVAVVWRSKLFTMAD 174
           CLQEV+A  +  FW    +K GY   FH K      Q+K+     G  + ++   F +  
Sbjct: 588 CLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKKVDGCCIFYKESEFKLQH 647

Query: 175 KMLIDFDK--------EQSGDVPPRTTT-NNAGLVIALKFTEQALTGHRDTPRSGILVGT 225
           +  +DF          +++ D   R    +N  L + L+        H ++  S + V T
Sbjct: 648 QESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLE--------HINSGES-VWVVT 698

Query: 226 THLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFP-FFCGDFNSQPYD 284
           THL W P     +T Q  V+L+ ++  +   N   N +        P   CGD NS    
Sbjct: 699 THLHWDPQFNDVKTFQVGVLLDHLESLLKDYN---NASSKQEIRKCPVIICGDLNSHLQS 755

Query: 285 APY 287
           A Y
Sbjct: 756 AVY 758

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 91/220 (41%), Gaps = 30/220 (13%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           TL++YN L Q     K++  +   AL W  R + L ++   Y+ D+LCLQEV++  +  F
Sbjct: 527 TLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEEF 586

Query: 138 WRGEFEKLGYAAQFH----------KKQTKNHGVAVVWRSKLFTMADKMLIDFD------ 181
           W    EK  Y   FH          K   K  G  + ++   F +  K  +DF       
Sbjct: 587 WSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMKH 646

Query: 182 -KEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTR 240
            K Q  +       N   + + LK   Q+LT         + V TTHL W P     +T 
Sbjct: 647 KKFQRTEDYLNRAMNKDNVALYLKL--QSLTSGE-----SVWVVTTHLHWDPKFNDVKTF 699

Query: 241 QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           Q  ++L+ M+  +   N  Q+    N        CGD NS
Sbjct: 700 QVGILLDHMEALLKEENPKQDVKKAN-----VVICGDLNS 734

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 108/277 (38%), Gaps = 58/277 (20%)

Query: 49  IPAELRFIERPMLSVHPDGAIGAEGNRL--------------PVTLMTYNCLAQALIRRK 94
           +P E RFIE     ++ DG    E + L                T+++YN L Q     K
Sbjct: 467 LPHERRFIE-----INTDGEPQREYDSLQQSTEHLATDLAKRTFTVLSYNTLCQHYATPK 521

Query: 95  LFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH- 152
           ++  +   AL W  R   L  +   Y+ D+LCLQEV++  +  +W    +K GY   FH 
Sbjct: 522 MYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEEYWVPLLDKHGYTGIFHA 581

Query: 153 ---------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT- 194
                    K   K  G  + ++   F +  K  +DF          +++ D   R    
Sbjct: 582 KARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNK 641

Query: 195 NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254
           +N  L + L+      T         I   TTHL W P     +T Q  V+L+      H
Sbjct: 642 DNVALFLKLQHIPSGDT---------IWAVTTHLHWDPKFNDVKTFQVGVLLD------H 686

Query: 255 RVNVLQNENDGN---NQHWFP-FFCGDFNSQPYDAPY 287
              +L+ E   N   +   FP   CGDFNS    A Y
Sbjct: 687 LETLLKEETSHNFRQDIKKFPVLICGDFNSYINSAVY 723

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 66/266 (24%), Positives = 106/266 (39%), Gaps = 47/266 (17%)

Query: 57  ERPMLSVHPDGA--------------IGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGP- 101
           ER  + ++ DG               + A+  +   ++++YN L Q     K++  +   
Sbjct: 502 ERKFIEINTDGEPQKEYDSLQQSTEHLSADLAKKTFSVLSYNTLCQHYATPKMYRYTPSW 561

Query: 102 ALKW-YRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH-------- 152
           AL W YRRS+ L  +   Y+ DVLCLQEV++  +  +W    +K GY   F+        
Sbjct: 562 ALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTFEDYWVPLLDKHGYTGIFYAKARAKTM 620

Query: 153 --KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT-NNAGLVI 201
             K   K  G  + ++   F +  K  +DF          +++ D   R    +N  L +
Sbjct: 621 HSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWMKHKKFQRTEDYLNRAMNKDNVALFL 680

Query: 202 ALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQN 261
            L+      T         I V TTHL W P     +T Q  V+L+ ++  +       +
Sbjct: 681 KLQHVSSGDT---------IWVVTTHLHWDPKFNDVKTFQVGVLLDHLESLLKEDTTHNS 731

Query: 262 ENDGNNQHWFPFFCGDFNSQPYDAPY 287
             D          CGDFNS    A Y
Sbjct: 732 RQDIKKSPV--LICGDFNSYINSAVY 755

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 68/273 (24%), Positives = 103/273 (37%), Gaps = 50/273 (18%)

Query: 49  IPAELRFIERPMLSVHPDGAIGAEGNRL--------------PVTLMTYNCLAQALIRRK 94
           +P E RFIE     ++ DG    E + L                T+++YN L Q     K
Sbjct: 469 LPHERRFIE-----INTDGEPQREYDSLQQSTEHLSVDLAKRTFTVLSYNTLCQHYATPK 523

Query: 95  LFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFH- 152
           ++  +   AL W  R   L  +   Y+ D+LCLQEV++  +  +W    +K GY   FH 
Sbjct: 524 MYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEDYWVPLLDKHGYTGIFHA 583

Query: 153 ---------KKQTKNHGVAVVWRSKLFTMADKMLIDFDK--------EQSGDVPPRTTT- 194
                    K   K  G  + ++   F +  K  +DF          +++ D   R    
Sbjct: 584 KARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMKHKKFQRTEDYLNRAMNK 643

Query: 195 NNAGLVIALKFTEQALTGHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMH 254
           +N  L + L+      T         I   TTHL W P     +T Q  V+L+ ++  + 
Sbjct: 644 DNVALFLKLQHIPSGDT---------IWAVTTHLHWDPKFNDVKTFQVGVLLDHLETLLR 694

Query: 255 RVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPY 287
                    D          CGDFNS    A Y
Sbjct: 695 EETTHNFRQDIKKSPV--LICGDFNSYINSAVY 725

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 59/230 (25%), Positives = 100/230 (43%), Gaps = 33/230 (14%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGP-ALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSF 137
           T+++YN L Q     K++  +   AL W  R   L ++   ++ D+LCLQEV++  +  F
Sbjct: 565 TVLSYNTLCQHYATPKMYRYTPSWALSWEYRRDKLKDQILSFKSDILCLQEVESRTYDDF 624

Query: 138 WRGEFEKLGYAAQFHKK------QTKNH----GVAVVWRSKLFTMADKMLIDF------- 180
           W    +K GY   FH K      QTK+     G  + ++   F +  K  +DF       
Sbjct: 625 WEPLLQKHGYKGIFHAKTRAKTMQTKDSKKVDGCCIFYKESEFKVLFKEAVDFSGIWMKH 684

Query: 181 -DKEQSGDVPPRTTTNNAGLVIALKFTEQALTGHRDTPRSGIL--VGTTHLFWHPFGTFE 237
            + +++ D   R   N   + I +K             +SG +  + TTHL W P     
Sbjct: 685 KNFQRTEDYLNR-AMNKDNVAIYMKLQH---------IKSGEVTWIVTTHLHWDPQFNDV 734

Query: 238 RTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQPYDAPY 287
           +T Q  V+L+ ++  +   + + ++ D   +      CGD NS    A Y
Sbjct: 735 KTFQVGVLLDHLESLLKEHSNIHSKQDV--KKCPIIICGDLNSYLDSAVY 782

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 108/267 (40%), Gaps = 46/267 (17%)

Query: 49  IPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLF---PDSGPALKW 105
           +PA  R I R +L V+   A     +     L+TYN L+   +  +++   P+  P  KW
Sbjct: 15  LPA--RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPE--PFKKW 70

Query: 106 -YRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFE-KLGYAAQFHKK--------- 154
            YR   +    F  Y  D+LCLQE+    +  FWR + + ++ + +Q+ +K         
Sbjct: 71  EYRHKLLEYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRS 130

Query: 155 QTKNHGVAVVWRSKLFTMADKMLIDFDKEQSGDVPPR----------TTTNNAGLVIALK 204
           Q +  GV   + +  F      L ++  +  G + P             T+  G V+  +
Sbjct: 131 QEEMDGVGTFYNADKFEHVATDL-EYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQ 189

Query: 205 FTEQALTG-----------HRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFM 253
             +  LT            H+ T  S  +V  T L+W       +  QC++++ ++K  +
Sbjct: 190 SLKTVLTQRNQVCLFVTLLHKPTG-SLFVVVNTQLYWKYDEV--KLAQCFIIMRRLKAIV 246

Query: 254 HRVNVLQNENDGNNQHWFPFFCGDFNS 280
            R   L    D +  +      GD NS
Sbjct: 247 KR---LLTRKDTSYSNIKVLLSGDLNS 270

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/234 (20%), Positives = 93/234 (39%), Gaps = 37/234 (15%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNK--FKHYEPDVLCLQEVDAVQWHS 136
           T ++YN L+   +  +++       K ++    LL K     Y  D++C+QE+  + ++S
Sbjct: 45  TFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKYRSDIMCVQELTTIDYYS 104

Query: 137 FWRGEFEK-LGYAAQFHKKQTKNH---------GVAVVWRSKLFTMADKMLID------- 179
           FWR    K   Y ++F  K   N+         GV + +   +F       I+       
Sbjct: 105 FWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDMFDYIGSRSINLNDLAST 164

Query: 180 FDKEQSGDVPPRTTT---NNAGLVIALKFTEQALTGHR---------DTPRSGILVGTTH 227
           FD+++   +  +  T    N  +       E AL+ ++            +   ++  TH
Sbjct: 165 FDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFVMVEHKISKDVFVIINTH 224

Query: 228 LFWHPFGTFERTR--QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFN 279
           L+W     +E  +  QC +++ K+ + ++ +       D N       F GD N
Sbjct: 225 LYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMNYNKVKILFSGDLN 274

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 107/255 (41%), Gaps = 40/255 (15%)

Query: 57  ERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALK-W-YRRSQVLLN 114
           +R +++V  +  I    N    TL+TYN L+Q+ +  +++       K W YR   +   
Sbjct: 3   QRKLINV--NNTISNSTNLSSFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYE 60

Query: 115 KFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNH---------GVAVVW 165
             K Y  D++CLQE+ +  +  +WR +  K    + F  K    +         GV + +
Sbjct: 61  ILKLYNADIICLQELTSRDYEYYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFY 120

Query: 166 RSKLFTMADK--------MLIDFDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTGHRD 215
              +F + D         ++ DF++ +   +  R    T+  G  I +      L     
Sbjct: 121 NLDMFELIDSNGIRLSDFLISDFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQ 180

Query: 216 T--------PRSG--ILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDG 265
                     R+G  ++V TTHL+W  +   + T QC +++ ++ + M      Q + DG
Sbjct: 181 VCLFMTLKHKRTGATVVVVTTHLYW-KYDEIKLT-QCMIIMRQLSKIMKD----QLKKDG 234

Query: 266 NNQHWFPFFCGDFNS 280
           ++      F GD NS
Sbjct: 235 SS-FVKVLFAGDLNS 248

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 92/236 (38%), Gaps = 39/236 (16%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVLLNK-FKHYEPDVLCLQEVDAVQWHS 136
           TL+TYN L+   +  +++       K W  R ++L ++ FK Y+ D++CLQE+    +H+
Sbjct: 31  TLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQELTTKDYHN 90

Query: 137 FWRGEF-EKLGYAAQFHKKQTKNH---------GVAVVWRSKLFTMADKMLIDFDKEQSG 186
           FW  +  E L Y + F  K    +         GV + +    F       I +  +  G
Sbjct: 91  FWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFEYISSSSI-YLNDVLG 149

Query: 187 DVPPR----------TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILVGT 225
               R          T TN AG  I        L G           H+DT  +  +V  
Sbjct: 150 IFNVRELKYMKETMITLTNGAGEAIGKDNLMNILQGRNQVCLFVSLRHKDT-NTVFVVIN 208

Query: 226 THLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281
           THL+W       +  QC  ++ K++  +   ++L              F GD NS 
Sbjct: 209 THLYWKYDEV--KLSQCLTIMRKLERIIK--SLLMGVEGVTYSKVKILFSGDLNSN 260

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 54/236 (22%), Positives = 105/236 (44%), Gaps = 41/236 (17%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVLLNK-FKHYEPDVLCLQEVDAVQWHS 136
           T++TYN L+   +  +++       K W  R ++L ++ F  Y+ D++CLQE+    ++ 
Sbjct: 35  TMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYNE 94

Query: 137 FWRGE-FEKLGYAAQFHKKQTKNH---------GVAVVWRSKLF-------TMADKMLID 179
           FW+ +   ++ Y + F  K    +         GV + +    F          + ++  
Sbjct: 95  FWKKQMMNRMNYGSNFTAKTPPKYWTKPLECMDGVGIFYNLDKFEYLFSSSLYLNDLVGT 154

Query: 180 FDKEQSGDVPPR--TTTNNAGLVI---ALKFTEQA--------LTGHRDTPRSGILVGTT 226
           FD+++   +     T TN AG VI   +L    +A        +  HR++ +S I+V  T
Sbjct: 155 FDQQELHYLTHHNITLTNGAGDVIGEDSLYNVAKARNQVCLFVMLRHRES-KSIIVVINT 213

Query: 227 HLFWHPFGTFERTR--QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
           HL+W     ++  +  QC +++ K++  +    +L         +    F GDFNS
Sbjct: 214 HLYW----KYDEVKLVQCLIIMRKLQRIIK--GLLMGIEGVTYSNVKILFSGDFNS 263

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 100/249 (40%), Gaps = 46/249 (18%)

Query: 74  NRLPVTLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVLLNKFKH-YEPDVLCLQEVDA 131
           +R   T MTYN L+   +  +++       K W  R ++L  +  + Y  D++C+QE+  
Sbjct: 30  SRSTFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTC 89

Query: 132 VQWHSFWRGEFE-KLGYAAQFHKKQTKNH---------GVAVVWRSKLFT--------MA 173
             +  FW+G F+ K+ Y + F  K    +         GV + +    F         + 
Sbjct: 90  KDYDGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLN 149

Query: 174 DKM-LIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTG-----------HRDTPRSGI 221
           D + L +  +         T TN AG  +        L G           H++T R+  
Sbjct: 150 DLIGLFNISELNYLKSTIITLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKET-RTLF 208

Query: 222 LVGTTHLFWHPFGTFERTR--QCYVVLNKMKEFMHRV--NVLQNENDGNNQHWFPFFCGD 277
           +V  THL+W     ++  +  QC  ++ K    +HRV  ++L              F GD
Sbjct: 209 VVINTHLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGREGVTYSKVKILFAGD 260

Query: 278 FNSQPYDAP 286
            NS P D+P
Sbjct: 261 LNSAP-DSP 268

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 91/242 (37%), Gaps = 53/242 (21%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNK--FKHYEPDVLCLQEVDAVQWHS 136
           T MTYN L+   +  +++       K +     LL K     Y  D++CLQE+ A  +H 
Sbjct: 30  TFMTYNMLSPHYMWPQVYTYVPDEYKDWNYRHKLLEKEILNSYRADIMCLQELTASDYHQ 89

Query: 137 FWRGEFEK-LGYAAQF---------HKKQTKNHGVAVVWRSKLFTMADKMLI-------- 178
           +W    ++   Y ++F          K      GV + +    F       I        
Sbjct: 90  YWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDLIGS 149

Query: 179 -DFD----------KEQSGDVPPR---------TTTNNAGLVIALKFTEQALTGHRDTPR 218
            D D          K   G   P+          + N  GL +ALK        H+DT  
Sbjct: 150 FDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALK--------HKDT-N 200

Query: 219 SGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDF 278
           +  +V  THL+W  +   + T QC +++ K+ + +   ++L  E+          F GD 
Sbjct: 201 TIFVVINTHLYW-KYDEVKLT-QCLIIMRKLAKIIR--DLLVGEHGTTYNKMKVVFAGDL 256

Query: 279 NS 280
           NS
Sbjct: 257 NS 258

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 44.3 bits (103), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 59/251 (23%), Positives = 102/251 (40%), Gaps = 46/251 (18%)

Query: 74  NRLPVTLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVLLNKFKH-YEPDVLCLQEVDA 131
           +R   TLMTYN L+   +  +++       K W  R ++L  +  + Y  D++C+QE+  
Sbjct: 26  SRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELTC 85

Query: 132 VQWHSFWRGEFE-KLGYAAQFHKK---------QTKNHGVAVVWRSKLFT--------MA 173
             +  FW+  F+ K+ Y + +  K         + +  GV + +    F         + 
Sbjct: 86  KDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYLN 145

Query: 174 DKM-LIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQALTG-----------HRDTPRSGI 221
           D + L +  +         T TN AG  I        L G           H++T R+  
Sbjct: 146 DLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKET-RTLF 204

Query: 222 LVGTTHLFWHPFGTFERTR--QCYVVLNKMKEFMHRV--NVLQNENDGNNQHWFPFFCGD 277
           +V  THL+W     ++  +  QC  ++ K    +HRV  ++L              F GD
Sbjct: 205 VVVNTHLYW----KYDEVKLCQCLTIMRK----LHRVIKSLLMGMEGVTYSKVKILFAGD 256

Query: 278 FNSQPYDAPYL 288
            NS P D+P +
Sbjct: 257 LNSAP-DSPVI 266

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 55/246 (22%), Positives = 103/246 (41%), Gaps = 39/246 (15%)

Query: 67  GAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNK--FKHYEPDVL 124
           GA+    NR   TL+TYN L+ A +  +++       K +     LL +     Y+ D++
Sbjct: 30  GALPKHDNRF--TLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIM 87

Query: 125 CLQEVDAVQWHSFWR----------GEFEKLGYAAQFHKKQTKNHGVAVVWRSKLFTMA- 173
           C+QE+    +  FW            EF        + ++  +  GVA+ +  K+F    
Sbjct: 88  CIQEMTKRDYQQFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVS 147

Query: 174 ------DKMLIDFDKEQSGDVPPRT--TTNNAG-------LVIALKFTEQ----ALTGHR 214
                 ++ML  F+  +   +  +    T+ AG       L+  LK   Q        H+
Sbjct: 148 SKGIYLNQMLDAFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHK 207

Query: 215 DTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFF 274
            T    +++  THL+W  +   + T QC V++ ++ + +   ++L++  D   +     F
Sbjct: 208 STGMYFVVIN-THLYWK-YDEVKLT-QCMVIMRELSQIID--DLLKDVPDVTKEKVKIIF 262

Query: 275 CGDFNS 280
            GD NS
Sbjct: 263 TGDLNS 268

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 96/225 (42%), Gaps = 40/225 (17%)

Query: 66  DGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPALK-W-YRRSQVLLNKFKHYEPDV 123
           +G      N+  ++++TYN L+   +  +++       K W YR   +    F  ++ D+
Sbjct: 19  NGTNNVSSNK-TLSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADI 77

Query: 124 LCLQEVDAVQWHSFWRGEFE-KLGYAAQFHKKQTKNHGVA-------------------- 162
           LCLQE+    ++ FWR + + +L Y + F  K    +  A                    
Sbjct: 78  LCLQELTTEDYNQFWRKQMKRRLSYGSNFISKPPPKYWTAGLQEMDGVGTFYNTEKLEFI 137

Query: 163 ---VVWRSKLFTMADKMLIDF-----DKEQSGDVPPRTTTNNAGLVIALKFTEQAL---T 211
              V++ +   +M  K  +D+       + +G   P TT   + L I L   +  L    
Sbjct: 138 SSTVIYLNDFLSMFSKRELDWMSRRQITQTNGANDPVTT--RSLLSILLDRNQVCLFVCL 195

Query: 212 GHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRV 256
             +DT +S I+V  THL+W       +  QC  ++ K+K+ ++++
Sbjct: 196 REKDT-KSLIVVVNTHLYWKYDEV--KLSQCLTIMRKLKQVINKL 237

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 104/236 (44%), Gaps = 44/236 (18%)

Query: 79  TLMTYNCLAQALIRRKLF---PDSGPALKW-YRRSQVLLNKFKHYEPDVLCLQEVDAVQW 134
           T+++YN L+ + +  +++   PD      W YR + + L     Y+ D++C+QE+    +
Sbjct: 31  TVLSYNMLSPSYMWPQVYTYVPDQYK--DWNYRHTLLELELLDKYKADIMCVQEMTKRDY 88

Query: 135 HSFWRGEF-EKLGYAAQFHKKQTKNH---------GVAVVWRSKLFTMA-------DKML 177
             +W+ +    +GY ++F  K    +         GVA+ +  + F          ++ L
Sbjct: 89  IDYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFL 148

Query: 178 IDFDKEQSGDVPPRT--TTNNAGLVIALKFTEQALT-----------GHRDTPRSGILVG 224
             F+ E+   +  +T   T+ AG+ I  K   + L+            H++T +  I++ 
Sbjct: 149 DVFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIIN 208

Query: 225 TTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
            THL+W       +  QC +++ ++ + +    +LQ   D  +      F GD NS
Sbjct: 209 -THLYWKYDEV--KLSQCIIIMRELSKIIDE--LLQ---DVRHSKVKIIFAGDLNS 256

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 53/250 (21%), Positives = 106/250 (42%), Gaps = 40/250 (16%)

Query: 65  PDGAIGAEGNRLPV-TLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVLLNKF-KHYEP 121
           P GA   + +  P+ TL++YN L+ + +  +++       K W  R ++L  +    Y  
Sbjct: 8   PIGANVLKNSAKPLFTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRA 67

Query: 122 DVLCLQEVDAVQWHSFWRGEFE-KLGYAAQFHKKQTKNH---------GVAVVW------ 165
           D++CLQE+ +  + +FW+   +  + Y + +  K    +         GV + +      
Sbjct: 68  DIMCLQELTSEDYSNFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFE 127

Query: 166 ---RSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAG-------LVIALKFTEQAL----T 211
              RS ++      +   ++ +  +  P T T+ AG       L+  LK   Q       
Sbjct: 128 FISRSGIYLNQLLGVFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSL 187

Query: 212 GHRDTPRSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNV-LQNENDGNNQHW 270
            H++T    +++  THL+W       +  QC +++ ++   + +  V L+N  D   +  
Sbjct: 188 KHKETGNVFVVIN-THLYWKYDDV--KLTQCMIIMRELARIIEKHLVGLENVTDDKIK-- 242

Query: 271 FPFFCGDFNS 280
              F GD NS
Sbjct: 243 -ILFTGDLNS 251

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 38.9 bits (89), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 104/236 (44%), Gaps = 43/236 (18%)

Query: 79  TLMTYNCLAQALIRRKLF---PDSGPALKWYRRSQVLLNKF-KHYEPDVLCLQEVDAVQW 134
           TL+TYN L+ + +  +++   PD  P   W  R ++L ++    Y+ D++CLQE+ +  +
Sbjct: 31  TLLTYNMLSPSYMWPQVYTYVPD--PYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDY 88

Query: 135 HSFWRGEF-EKLGYAAQFHKKQ---------TKNHGVAVVWRSKLFTMA-------DKML 177
           +  W+      +GY ++F  K           +  GV + +  K F          ++ L
Sbjct: 89  NENWKRLLGSGIGYGSKFIAKSPPLYWEREVDEIDGVGIFYNLKKFDFISSSGIYLNQFL 148

Query: 178 IDFDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILVG 224
             F   +   +  +    T+ AG+ I  K     ++G           H++T    +++ 
Sbjct: 149 NVFSSTELEYLHSKRLVLTDGAGVPIGEKNLLDVISGKNQVCLFVSLKHKETGEMFVVIN 208

Query: 225 TTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
            THL+W  +   + T QC +++ ++ + +  + V   ++ G  +     F GD NS
Sbjct: 209 -THLYWK-YDEVKLT-QCMIIMRELSKIIDEL-VKGVDDPGKVK---ILFTGDLNS 257

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.5 bits (88), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 53/237 (22%), Positives = 101/237 (42%), Gaps = 44/237 (18%)

Query: 79  TLMTYNCLAQALIRRKLFPDSG-PALKWYRRSQVL----LNKFKHYEPDVLCLQEVDAVQ 133
           TL+TYN L+ + +  +++     P   W  R ++L    LN FK    D++CLQE+ A  
Sbjct: 28  TLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFK---ADIMCLQEMTARD 84

Query: 134 WHSFWRGEF-EKLGYAAQFHKKQTKNH---------GVAVVWRSKLF-------TMADKM 176
           +  +WR      + Y ++F  K    +         GV++ +  + F          +++
Sbjct: 85  YEDYWRDYIGVDINYGSKFIPKTPPKYWKNPVKDMDGVSIFYNLEKFDYISSTGIYLNQL 144

Query: 177 LIDFDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILV 223
           L  F++ +   +  +  T T+ A  ++        L G           H++T  +  +V
Sbjct: 145 LNVFNERELKYLFNKKVTLTDGASNIVGEDSLLDVLKGKNQVCLFVSLKHKETG-TVFVV 203

Query: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
             THL+W  +   + T QC ++   M+E    +  L + +  + +     F GD NS
Sbjct: 204 LNTHLYWK-YDEVKLT-QCMII---MRELSKIIKQLLSGDVKSQRKVKILFTGDLNS 255

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 38.5 bits (88), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 103/247 (41%), Gaps = 57/247 (23%)

Query: 79  TLMTYNCLAQALIRRKLF---PDSGPALKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWH 135
           T++TYN L+   +  +++   PD     K YR   +     + Y+ D++CLQE+    + 
Sbjct: 49  TMLTYNMLSPHYMWPQVYTYVPDQYKDWK-YRHKLLEFELMQKYKADIMCLQELTWEDYI 107

Query: 136 SFWRGEF-EKLGYAAQF-----------HKKQTKNHGV-------AVVWRSKLFT----- 171
           S+W+ +  EK+ Y ++F            K++    G+         +  +KLF      
Sbjct: 108 SYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVG 167

Query: 172 ---------MADKM--LIDFDKEQSGD---VPPRTTTNNAGLVIALKFTEQALTGHRDTP 217
                    M  K+  L D   + +G        TT N   L ++L+        H+ T 
Sbjct: 168 TFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLR--------HKAT- 218

Query: 218 RSGILVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQN----ENDGNNQHWFPF 273
            +  +V  THL+W  +   + T QC +++ K+   ++ + +  N    +N   ++     
Sbjct: 219 NTVFVVINTHLYW-KYDEVKLT-QCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKII 276

Query: 274 FCGDFNS 280
           F GD NS
Sbjct: 277 FSGDLNS 283

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 6/86 (6%)

Query: 75  RLP---VTLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNK--FKHYEPDVLCLQEV 129
           R+P    TL+TYN L+   +  +++       K ++   +LL     + Y+ DV+CLQE+
Sbjct: 31  RIPGHKFTLLTYNMLSPYYMWPQVYNYVPDEFKDWKYRHMLLEDELLRTYKADVMCLQEL 90

Query: 130 DAVQWHSFWRGEFEK-LGYAAQFHKK 154
               + S+W+  F K L Y ++F  K
Sbjct: 91  TWEDYLSYWKPVFGKQLNYGSKFVAK 116

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 37.0 bits (84), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 103/237 (43%), Gaps = 44/237 (18%)

Query: 79  TLMTYNCLAQALIRRKLFPDSG-PALKWYRRSQVL----LNKFKHYEPDVLCLQEVDAVQ 133
           TL+TYN L+ + +  +++     P   W  R ++L    LN FK    D++CLQE+ A  
Sbjct: 28  TLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFK---ADIMCLQEMTARD 84

Query: 134 WHSFWRGEF-EKLGYAAQFH--------KKQTKN-HGVAVVWRSKLFTMA-------DKM 176
           +  +W       + Y ++F         KK  K+  GV++ +    F          +++
Sbjct: 85  YEDYWHDSIGVDVNYGSKFISKTPPKYWKKPVKDMDGVSIFYNLAKFDFISSSGIYLNQL 144

Query: 177 LIDFDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILV 223
           L  F++ +   +  +  T T+ A  VI        L G           H++T  +  +V
Sbjct: 145 LNVFNQRELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLRHKETG-TIFVV 203

Query: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
             THL+W  +   + T QC +++ ++ + + +  +L  +  G  +     F GD NS
Sbjct: 204 LNTHLYW-KYDEVKLT-QCMIIMRELSKIIKQ--LLPGDVKGQERVKI-LFTGDLNS 255

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 98/235 (41%), Gaps = 40/235 (17%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALKWYRRSQVLLNK--FKHYEPDVLCLQEVDAVQWHS 136
           TL+TYN L+ + +  +++       K +     LL K     ++ D++CLQE+    + +
Sbjct: 28  TLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYEN 87

Query: 137 FWRGEF-EKLGYAAQFHKKQTKNH---------GVAVVWRSKLF-------TMADKMLID 179
           +W       + Y ++F  K    +         GV++ +  + F          +++L  
Sbjct: 88  YWHNSIGVDINYGSKFISKTPPKYWEKPVKDMDGVSIFYNLEKFDYISSSGIYLNQLLNV 147

Query: 180 FDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILVGTT 226
           F++ +   +  +  T T+ A  VI        L G           H++T  +  +V  T
Sbjct: 148 FNERELKYLYNKKVTLTDGASNVIGEDSLLDVLKGKNQVCLFVSLKHKET-NTIFVVLNT 206

Query: 227 HLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFP-FFCGDFNS 280
           HL+W  +   + T QC +++ ++ + + ++       D N Q      F GD NS
Sbjct: 207 HLYW-KYDEVKLT-QCMIIMRELSKIIKQL----LPGDANAQEKVKILFTGDLNS 255

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 46/239 (19%), Positives = 98/239 (41%), Gaps = 45/239 (18%)

Query: 78  VTLMTYNCLAQALIRRKLF---PDSGPALKWYRRSQVLLNK-FKHYEPDVLCLQEVDAVQ 133
           ++++TYN L+   +  +++   PD     KW  R ++L  +    Y  D++CLQE+ ++ 
Sbjct: 22  LSVLTYNMLSPYYMWPQVYTYVPDEYK--KWNYRHKLLQKEILGLYRADIMCLQELTSLD 79

Query: 134 WHSFW-RGEFEKLGYAAQF---------HKKQTKNHGVAVVWRSKLF-------TMADKM 176
           +  +W +   EK  Y +++          +  ++  GV V +    F          + +
Sbjct: 80  YQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKFDYISSTGIYLNDL 139

Query: 177 LIDFDKEQSGDVPPRT--TTNNAGLVIALKFTEQALTG-----------HRDTPRSGILV 223
              FD ++   +  +    T+  G  +        L G           H+ T  + ++V
Sbjct: 140 FGTFDLKEQNYLEHKMLQLTDGQGNPMEKMTLSDVLKGRNQVCMFVSLRHKAT-NTFLIV 198

Query: 224 GTTHLFWHPFGTFERTR--QCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
             THL+W     ++  +  QC +++ ++ + +   ++L    D         F GD NS
Sbjct: 199 INTHLYW----KYDEVKLAQCMIIMRRLSKIIK--DLLIGVQDTTYNKVKIIFAGDMNS 251

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 50/237 (21%), Positives = 99/237 (41%), Gaps = 44/237 (18%)

Query: 79  TLMTYNCLAQALIRRKLFPDSGPALK-WYRRSQVL----LNKFKHYEPDVLCLQEVDAVQ 133
           TL+TYN L+ + +  +++       K W  R ++L    LN FK    D++CLQE+    
Sbjct: 28  TLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFK---ADIMCLQEMTRRD 84

Query: 134 WHSFWRGEF-EKLGYAAQFHKKQTKNH---------GVAVVWRSKLFTMA-------DKM 176
           +  +W       + Y ++F  K    +         GV++ +    F          +++
Sbjct: 85  YEDYWHDSIGVNINYGSKFISKTPPKYWKKPLEDMDGVSIFYNLDKFDFISSSGIYLNQL 144

Query: 177 LIDFDKEQSGDVPPR--TTTNNAGLVIALKFTEQALTG-----------HRDTPRSGILV 223
           L  F++ +   +  +    T+ A  V+        L G           H++T  +  +V
Sbjct: 145 LNVFNERELKYLYNKRVILTDGASNVVGEDSLLDVLKGKNQVCLFVSLKHKETD-TIFVV 203

Query: 224 GTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNS 280
             THL+W  +   + T QC +++ ++ + + +  +L  +  G  +     F GD NS
Sbjct: 204 LNTHLYW-KYDEVKLT-QCMIIMRELSKIIEQ--LLPGDAKGRGKVKI-LFTGDLNS 255

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,195,568
Number of extensions: 2140559
Number of successful extensions: 4143
Number of sequences better than 10.0: 71
Number of HSP's gapped: 4037
Number of HSP's successfully gapped: 71
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)