Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J003208.829ON37337319850.0
TDEL0B006808.829ON38338014190.0
CAGL0F03399g8.829ON38037613950.0
NCAS0C004708.829ON42637913870.0
NDAI0K004708.829ON38638613710.0
SAKL0D01760g8.829ON38138013460.0
YMR272C (SCS7)8.829ON38438413410.0
Smik_13.4858.829ON38438413320.0
KLLA0D01639g8.829ON38138013310.0
Skud_13.4448.829ON38438413270.0
Kpol_541.98.829ON37437313200.0
Suva_13.4608.829ON38438412981e-179
KAFR0B038508.829ON37737812721e-175
Ecym_27128.829ON38138512641e-174
ZYRO0G13948g8.829ON38438412521e-172
KLTH0C04114g8.829ON37837912491e-172
Kwal_27.103328.829ON37837912441e-171
AAL183W8.829ON37737312421e-171
TPHA0C047108.829ON37737412261e-168
TBLA0D031808.829ON40038512071e-165
Kpol_1069.48.829ON2772499011e-120
NCAS0G025702.166ON121531202e-07
Kwal_47.18167na 1ON227591244e-07
NDAI0F027302.166ON121531176e-07
ZYRO0B09812g2.166ON183981136e-06
KLTH0D09284g2.166ON123521089e-06
KLLA0F27577gna 1ON172811111e-05
AFL223W2.166ON165531082e-05
SAKL0E10626g2.166ON123521044e-05
KNAG0I020402.166ON119521034e-05
TDEL0F012102.166ON126461034e-05
Kwal_26.84612.166ON123521035e-05
TBLA0B013102.166ON123521018e-05
Kpol_505.142.166ON123461019e-05
Ecym_54202.166ON14545992e-04
KLTH0A04026gna 1ON233531004e-04
Suva_14.2282.166ON12053947e-04
TPHA0F017902.166ON18268977e-04
KLLA0F23672g2.166ON12352910.002
Skud_14.2212.166ON12053900.002
KAFR0I005204.304ON58660960.003
NCAS0A02770na 2ON60956950.003
CAGL0L03828g2.166ON12145880.005
Kpol_1014.54.304ON59658940.005
Smik_14.2162.166ON12053880.005
YNL111C (CYB5)2.166ON12053870.006
KAFR0B045502.166ON12646850.012
SAKL0F16610gsingletonON56454900.014
ADL085Cna 1ON27353890.014
NDAI0D047104.304ON61652900.016
SAKL0F08316gna 1ON17855860.016
KLTH0C11770gsingletonON61850900.016
Skud_7.2266.106ON509104860.037
TPHA0B018204.304ON57655860.042
CAGL0I00418g6.106ON49049850.057
ZYRO0B02090g2.536ON19457820.059
ZYRO0C18524gsingletonON55444840.072
YGL055W (OLE1)6.106ON510104840.075
KLLA0B14795gna 3ON55652840.082
NCAS0A027804.304ON60245830.11
ZYRO0B13728g4.304ON59850830.11
TDEL0H02180na 1ON20355800.12
Smik_7.2256.106ON510104820.12
Kpol_348.122.536ON21752800.13
Smik_13.924.304ON59150810.16
YML054C (CYB2)4.304ON59150810.16
KNAG0E038604.304ON60450810.16
NDAI0D04700na 2ON62550790.34
ADR212C5.671ON82162790.35
SAKL0G16852g4.304ON58045780.36
CAGL0K10736g4.304ON59350780.45
Kwal_23.2823na 3ON56044780.46
Kwal_14.807singletonON57852770.47
TDEL0D011404.304ON58476770.49
KLLA0E18459g2.536ON14851740.50
KLLA0D02640g4.304ON58970770.55
KLTH0D06930g2.536ON20451750.55
Suva_13.1054.304ON59150770.56
NDAI0I016206.106ON44190760.62
Skud_13.924.304ON59150760.69
SAKL0A09570g2.536ON21151740.72
TBLA0I015302.536ON22152740.73
TDEL0D00190singletonON55252760.75
KLTH0C11858gsingletonON55547760.76
TDEL0B048902.125ON156848760.82
CAGL0I05016g7.375ON50643741.1
Suva_7.2166.106ON47053731.5
CAGL0M13101g2.589ON34152731.5
ZYRO0D16654gna 1ON190131711.6
SAKL0A07326g6.106ON48040722.0
KLLA0C05566g6.106ON47753722.1
Skud_5.1757.241ON556101722.4
NCAS0D032506.106ON497104712.6
TPHA0G035502.536ON21857702.6
Kwal_26.80462.536ON19851693.1
AAR153C6.106ON47841703.9
Ecym_4346na 1ON20950684.4
CAGL0K03069g2.536ON19446667.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00320
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   769   0.0  
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   551   0.0  
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   541   0.0  
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      538   0.0  
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   532   0.0  
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   523   0.0  
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   521   0.0  
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   517   0.0  
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   517   0.0  
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   515   0.0  
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   513   0.0  
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   504   e-179
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   494   e-175
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   491   e-174
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   486   e-172
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   485   e-172
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   483   e-171
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   483   e-171
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   476   e-168
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   469   e-165
Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   351   e-120
NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON...    51   2e-07
Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa] {O...    52   4e-07
NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166      50   6e-07
ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar...    48   6e-06
KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar...    46   9e-06
KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some ...    47   1e-05
AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic homol...    46   2e-05
SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar...    45   4e-05
KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.16...    44   4e-05
TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON...    44   4e-05
Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C ...    44   5e-05
TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.16...    44   8e-05
Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON} (37085..37...    44   9e-05
Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to...    43   2e-04
KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa] {O...    43   4e-04
Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa] {O...    41   7e-04
TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.16...    42   7e-04
KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON} simil...    40   0.002
Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa] {O...    39   0.002
KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {O...    42   0.003
NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON}               41   0.003
CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} simila...    39   0.005
Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON} ...    41   0.005
Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa] {O...    39   0.005
YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}  ...    38   0.006
KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.16...    37   0.012
SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} simi...    39   0.014
ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON} NO...    39   0.014
NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON} Anc_4...    39   0.016
SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa] {O...    38   0.016
KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} simila...    39   0.016
Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W ...    38   0.037
TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {O...    38   0.042
CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly s...    37   0.057
ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {O...    36   0.059
ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} simi...    37   0.072
YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(...    37   0.075
KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} simi...    37   0.082
NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304     37   0.11 
ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} simi...    37   0.11 
TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON}                35   0.12 
Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W ...    36   0.12 
Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON} ...    35   0.13 
Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {O...    36   0.16 
YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON} ...    36   0.16 
KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.3...    36   0.16 
NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON}             35   0.34 
ADR212C Chr4 complement(1074194..1076659) [2466 bp, 821 aa] {ON}...    35   0.35 
SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} simi...    35   0.36 
CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} hig...    35   0.45 
Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C (...    35   0.46 
Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON} ...    34   0.47 
TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {O...    34   0.49 
KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} simil...    33   0.50 
KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {...    34   0.55 
KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {O...    33   0.55 
Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {...    34   0.56 
NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {O...    34   0.62 
Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {O...    34   0.69 
SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {O...    33   0.72 
TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.53...    33   0.73 
TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON}                 34   0.75 
KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} simila...    34   0.76 
TDEL0B04890 Chr2 complement(857124..861830) [4707 bp, 1568 aa] {...    34   0.82 
CAGL0I05016g Chr9 complement(460019..461539) [1521 bp, 506 aa] {...    33   1.1  
Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W ...    33   1.5  
CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON} sim...    33   1.5  
ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa] ...    32   1.6  
SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON} unipro...    32   2.0  
KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {...    32   2.1  
Skud_5.175 Chr5 (273267..274937) [1671 bp, 556 aa] {ON} YER060W ...    32   2.4  
NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106     32   2.6  
TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON...    32   2.6  
Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON...    31   3.1  
AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON} S...    32   3.9  
Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to...    31   4.4  
CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {...    30   7.5  

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  769 bits (1985), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT
Sbjct: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60

Query: 61  DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPTEDK 120
           DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPTEDK
Sbjct: 61  DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPTEDK 120

Query: 121 LSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGNFLE 180
           LSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGNFLE
Sbjct: 121 LSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGNFLE 180

Query: 181 PISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHFD 240
           PISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHFD
Sbjct: 181 PISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHFD 240

Query: 241 DWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVACAG 300
           DWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVACAG
Sbjct: 241 DWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVACAG 300

Query: 301 FAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVFDTY 360
           FAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVFDTY
Sbjct: 301 FAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVFDTY 360

Query: 361 LGKDAPISPMKYD 373
           LGKDAPISPMKYD
Sbjct: 361 LGKDAPISPMKYD 373

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  551 bits (1419), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 308/380 (81%), Gaps = 11/380 (2%)

Query: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD-- 61
            S+TLEL S+  V+ HN  ND WV V  RK+ D++ ++ E P   + +L  AGKDIT+  
Sbjct: 5   QSKTLELFSRKQVSEHNNANDCWVTVSNRKIYDVTKFLDEHPGGPQYILDYAGKDITEVL 64

Query: 62  ---RSHE-----FPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113
                HE     +  L    +LVGY+AT+LEEKELL+N  HKVEVKL   + FDS+TFVK
Sbjct: 65  KDSTIHEHSESAYEILEDSSYLVGYMATELEEKELLTNSSHKVEVKLATLD-FDSTTFVK 123

Query: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173
           DLPTE+KLSIATD  RDY++HHFLDL+KPL+PQV+FG FTKDFYVDQIHRPRHYGKGSAP
Sbjct: 124 DLPTEEKLSIATDYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAP 183

Query: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233
           LFGNFLEP+SKT+WYV+P+VW PVVLY +G + K ++PIF +  F LG FVWTLIEY +H
Sbjct: 184 LFGNFLEPLSKTSWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLH 243

Query: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293
           RFLFHFDDWLPE+NV FT+HFLLHGVHHYLPMD YRLV+PP LFV+LCTPFYKLVF LLP
Sbjct: 244 RFLFHFDDWLPESNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLP 303

Query: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353
            YVA AGFAGG+FGY+CYDL HYFLHHSK+P FMRKLK+YHLEHHYKNYQLGFGV++WFW
Sbjct: 304 LYVAYAGFAGGLFGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFW 363

Query: 354 DKVFDTYLGKDAPISPMKYD 373
           DKVF TYL   +PIS MKYD
Sbjct: 364 DKVFGTYLSPTSPISQMKYD 383

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/376 (69%), Positives = 304/376 (80%), Gaps = 4/376 (1%)

Query: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELL-LSLAGKDIT 60
           + +S+TLEL  +  +A HN K+D WV    RK+ D+S Y+++ PE+ + +  +L GK  T
Sbjct: 5   ADSSKTLELFPQSVLAKHNSKDDCWVSTHERKIYDVSKYLKDHPEEADAVHKALDGKHGT 64

Query: 61  DRSH-EFPGLN--ADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPT 117
           D S  E   L    DD+LVGYLAT  EEK+LL+NK HKVEVKL    TFDS+TFVKDLPT
Sbjct: 65  DISQMELTTLKFVTDDYLVGYLATSDEEKKLLTNKSHKVEVKLNADNTFDSTTFVKDLPT 124

Query: 118 EDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGN 177
           EDKLSI TD +RDY+KH FLDL KPL+ Q+LFG+FTKDFY+DQIHRPRHYGKGSAPLFGN
Sbjct: 125 EDKLSITTDYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFGN 184

Query: 178 FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLF 237
           FLE  +KTAW+VVP VWGPVVLYF+  +L  ++   AL LF LG FVWTLIEYC+HRFLF
Sbjct: 185 FLEAFTKTAWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLF 244

Query: 238 HFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVA 297
           HFD+WLPE+++ F IHFLLHG HHYLPMD YRLVVPPALFVVLC P YKLVF  LP+Y A
Sbjct: 245 HFDEWLPEHSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYWA 304

Query: 298 CAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVF 357
           CAGFAGGM GYICYDL HYFLHHSKMP FMRKLK+YHLEHHYKNYQLGFGV++WFWDKVF
Sbjct: 305 CAGFAGGMLGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVF 364

Query: 358 DTYLGKDAPISPMKYD 373
            TYLG DAP+S MKY+
Sbjct: 365 GTYLGPDAPLSKMKYE 380

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/379 (67%), Positives = 308/379 (81%), Gaps = 7/379 (1%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59
           MSSN S+TLEL SKD VA HN + D WV V  RK+ D+S ++ + P+ ++ +L  AGKDI
Sbjct: 47  MSSNVSKTLELFSKDQVAKHNTEEDCWVTVYDRKIYDVSKFLLDHPDGDKSILKHAGKDI 106

Query: 60  TD-----RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFDSSTFVK 113
           T+     +  +   L  D +L+GY+ATD EE++LL+NKDHKVEVKL E   TFDS+TFVK
Sbjct: 107 TELLKDEKIDQQTDLLDDQYLIGYMATDAEEEKLLTNKDHKVEVKLNESTNTFDSTTFVK 166

Query: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173
           DLPTEDKLSIATD ++D +KH+FLDL KPL+ Q+LFG+FTKDFY+DQIHRPRHYG+ SAP
Sbjct: 167 DLPTEDKLSIATDYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAP 226

Query: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233
           LFGNFLEP +KTAWY+VPI W PVV Y +  + K I+ +FA+MLF +G +VWT IEYCMH
Sbjct: 227 LFGNFLEPFTKTAWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMH 286

Query: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293
           RFLFHFD+ LPE+N A+ IHFLLHG HHYLPMD YRLVVPP LF+ LC PFYKLVF LLP
Sbjct: 287 RFLFHFDERLPEHNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLP 346

Query: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353
           +Y ACAGFAGGMFGYICYDL HYFLHHSK+P FMRKLK+YHLEHHYKNYQLG+GV++W+W
Sbjct: 347 YYWACAGFAGGMFGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYW 406

Query: 354 DKVFDTYLGKDAPISPMKY 372
           DK F TYL  D+P+S MKY
Sbjct: 407 DKKFGTYLSPDSPLSKMKY 425

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  532 bits (1371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/386 (66%), Positives = 311/386 (80%), Gaps = 13/386 (3%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPE--KEELLLSLAGK 57
           MS N S+TLEL SKD VA+HN  +D W+  Q RK+ D++ ++ + P    ++LLL  AGK
Sbjct: 1   MSINTSKTLELFSKDKVAAHNTSDDCWITFQDRKIYDVTKFLNDNPNDANKDLLLEFAGK 60

Query: 58  DITD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFD 107
           DITD         ++  FP L  D +L+GYLATD EEK LL+NKDHKVEV+L E    FD
Sbjct: 61  DITDELKDKIDSIKNPSFPILQTDQYLIGYLATDHEEKTLLTNKDHKVEVQLNEATNGFD 120

Query: 108 SSTFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHY 167
           S+TFVKDLPTEDKLSIATDTK+D +KH FLDL+KPL+ Q+LFG+FTKDFY+DQIHRPRHY
Sbjct: 121 STTFVKDLPTEDKLSIATDTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHY 180

Query: 168 GKGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTL 227
           G  SAPLFGN LEP++KT+WY+VPI W PVV Y +  +L  ++PIFA++LFA+G +VWTL
Sbjct: 181 GDKSAPLFGNILEPLTKTSWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTL 240

Query: 228 IEYCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKL 287
           IEYCMHRFLFHFD+ LPE+N+ + IHFLLHG HHYLPMD YRLVVPP LF+ LC PFYK+
Sbjct: 241 IEYCMHRFLFHFDERLPEHNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKV 300

Query: 288 VFKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFG 347
           VFKLLP Y A AGFAGG+FGY+CYDL HYFLHHSKMP  +RKLK+YHLEHHYKNYQLG+G
Sbjct: 301 VFKLLPLYWAYAGFAGGLFGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYG 360

Query: 348 VSNWFWDKVFDTYLGKDAPISPMKYD 373
           V++W+WDK+F TYL  D+P+S MKY+
Sbjct: 361 VTSWYWDKIFGTYLSPDSPMSKMKYE 386

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  523 bits (1346), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 300/380 (78%), Gaps = 9/380 (2%)

Query: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD- 61
           S S+TL L+SK  ++ HN K D WV +  RKV +++A++ E P  ++ +L  AG+DIT+ 
Sbjct: 2   SESKTLPLLSKTQLSQHNTKEDCWVSLYNRKVYNVTAFLEEHPGGDQYILDHAGEDITEI 61

Query: 62  --------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113
                    S     +  D +LVGYLA + EEK+LL+N+DH VEVKL     FDS+TFVK
Sbjct: 62  MKDKLVHEHSESAYEIMNDMYLVGYLANEEEEKKLLTNEDHTVEVKLNESTQFDSTTFVK 121

Query: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173
           +LPTEDKLSIATD   DY+KH FLDL+KPL+ QV+FG+FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 122 ELPTEDKLSIATDYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAP 181

Query: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233
           LFGNFLEP+SKT WY +PI W PVV Y L  +L  ++  FAL LF+LG FVWTLIEYC+H
Sbjct: 182 LFGNFLEPLSKTPWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLH 241

Query: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293
           RFLFH D +LPE  +AF +HFLLHGVHHYLPMD YRLV+PP LFV+LCTPFYKLVF LLP
Sbjct: 242 RFLFHLDQYLPERQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLP 301

Query: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353
           +Y ACAGFAGGM GY CYDL HYFLHH+K+P +MRKLK+YHLEHHYKNY+LGFGV++WFW
Sbjct: 302 YYWACAGFAGGMLGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFW 361

Query: 354 DKVFDTYLGKDAPISPMKYD 373
           DKVF TYLG DAP+S MKY+
Sbjct: 362 DKVFGTYLGSDAPLSKMKYE 381

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/384 (65%), Positives = 300/384 (78%), Gaps = 11/384 (2%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59
           MS+N S+TLEL SK TV  HN  ND WV  Q RK+ D++ ++ E P  +E +L  AGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVQEHNTANDCWVTYQNRKIYDVTRFLSEHPGGDESILDYAGKDI 60

Query: 60  TD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEG-GETFDSS 109
           T+          S     +  D++L+GYLATD E   LL+NK+HKVEV+L   G  FDS+
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSADGTEFDST 120

Query: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169
           TFVK+LP E+KLSIATD   DY+KH FLDL +PL+ Q+L   F KDFYVDQIHRPRHYGK
Sbjct: 121 TFVKELPAEEKLSIATDYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229
           GSAPLFGNFLEP++KTAW+VVP+ W PVV+Y +G +LK ++ +FA  LF +G FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289
           Y +HRFLFHFDDWLPE+N+AF  HFLLHG HHYLPMD YRLV+PP LFV+LC PFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349
            LLP Y A AGFAGG+FGY+CYD  H+FLHHSK+P FMRKLK+YHLEHHYKNYQLGFGV+
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 350 NWFWDKVFDTYLGKDAPISPMKYD 373
           +WFWD+VF TYLG DAP+S MKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/384 (65%), Positives = 298/384 (77%), Gaps = 11/384 (2%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59
           MS+N S+TLEL SK TV  HN   D WV  Q RK+ D++ ++ E P  +E +L  AGKDI
Sbjct: 1   MSANTSKTLELFSKKTVEKHNTAKDCWVTYQNRKIYDVTKFLSEHPGGDESILDYAGKDI 60

Query: 60  TD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEG-GETFDSS 109
           T+          S     +  D++L+GYLATD E   LL+NK+HKVEV+L   G  FDS+
Sbjct: 61  TEVMKDTDVHEHSDSAYEILEDEYLIGYLATDEEAARLLTNKNHKVEVQLSSDGTEFDST 120

Query: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169
           TFVKDLP E+KLSIATD   DY+KH FLDL +PL+ Q+L   F KDFYVDQIHRPRHYGK
Sbjct: 121 TFVKDLPAEEKLSIATDYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGK 180

Query: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229
           GSAPLFGNFLEP++KTAW+VVP  W PVV+Y +G +LK ++ +FA  LF +G FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289
           Y +HRFLFHFDDWLPE+N+AF  HFLLHG HHYLPMD YRLV+PP LFV+LC PFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349
            LLP Y A AGFAGG+FGY+CYD  H+FLHHSK+P FMRKLK+YHLEHHYKNYQLGFGV+
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 350 NWFWDKVFDTYLGKDAPISPMKYD 373
           +WFWD+VF TYLG DAP+S MKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/380 (65%), Positives = 299/380 (78%), Gaps = 9/380 (2%)

Query: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD- 61
           S+SR L L SK  +  HN KND WV +  RK+ +++ ++ E P   E +L  AG DITD 
Sbjct: 2   SSSRILPLYSKTDLEKHNDKNDCWVSLYQRKIYNVTEFLDEHPGGAEYILDYAGTDITDV 61

Query: 62  --------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVK 113
                    S     +  + +LVGYLAT+ EEK+LL+NKDH VEV L+G   FDS+ FVK
Sbjct: 62  MKDVLTHEHSESAYEIMDESYLVGYLATEEEEKKLLTNKDHVVEVNLKGNNEFDSTVFVK 121

Query: 114 DLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAP 173
           +LPTEDKLSIATD + DY+KH FLDL KPL+ QVLFG FTKDFY+DQ+HRPRHYGKGSAP
Sbjct: 122 ELPTEDKLSIATDYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAP 181

Query: 174 LFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMH 233
           LFGNFLEP+SKT W++VP+VW PVV Y +  +L  ++  FA+ LFA+G FVWTLIEY +H
Sbjct: 182 LFGNFLEPLSKTPWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLH 241

Query: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLP 293
           RFLFH DD LPE   AFT+HFLLHGVHHYLPMD +RLV+PP LFVVLCTPFYKLVF LLP
Sbjct: 242 RFLFHLDDRLPEKQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLP 301

Query: 294 HYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFW 353
           +Y ACAGFAGGM GY+CYDL HYFLHHS++P +MRKLK+YHLEHHYKNY+LGFGV++WFW
Sbjct: 302 YYWACAGFAGGMLGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFW 361

Query: 354 DKVFDTYLGKDAPISPMKYD 373
           DKVF TYLG++AP+S MKYD
Sbjct: 362 DKVFGTYLGENAPLSNMKYD 381

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  515 bits (1327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/384 (64%), Positives = 300/384 (78%), Gaps = 11/384 (2%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59
           MS+N S+TLEL S+ TV  HN   D WV  Q RK+ D++ ++ E P  +E +L  AGKD+
Sbjct: 1   MSTNTSKTLELFSRKTVEEHNTAKDCWVTYQNRKIYDVTKFLGEHPGGDESILDYAGKDV 60

Query: 60  TD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEG-GETFDSS 109
           T+          S     +  D++L+GYLATD E   LL+NK HKVEV+L   G+ FDS+
Sbjct: 61  TEIMKDSDVHEHSDSAYEILEDEYLIGYLATDEEATRLLTNKSHKVEVQLSADGKEFDST 120

Query: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169
           TFVK+LPTE+KLSIATD   DY+KH FLDL +PL+ Q+L   F KDFYVDQIHRPRHYGK
Sbjct: 121 TFVKNLPTEEKLSIATDYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGK 180

Query: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229
           GSAPLFGNFLEP++KTAW+VVP+ W PVV+Y +G +LK ++ +FA  LF +G FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIE 240

Query: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289
           Y +HRFLFHFDDWLPE+NVAF  HFLLHG HHYLPMD YRLV+PP LFV+LC PFYKLVF
Sbjct: 241 YGLHRFLFHFDDWLPESNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVF 300

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349
            LLP Y A AGFAGG+FGY+CYD  H+FLHHSK+P FMRKLK+YHLEHHYKNYQLGFGV+
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 350 NWFWDKVFDTYLGKDAPISPMKYD 373
           +WFWD+VF TYLG DAP+S MKY+
Sbjct: 361 SWFWDEVFGTYLGPDAPLSKMKYE 384

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  513 bits (1320), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 241/373 (64%), Positives = 304/373 (81%), Gaps = 4/373 (1%)

Query: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
           + +S+TLEL +K     HN + D WV V+ R + D+S+Y+++  + +  +L  AGKDIT 
Sbjct: 3   AKDSKTLELFAKSRFEEHNTEADCWVSVKERLIYDVSSYLKDNADADSSILEHAGKDITK 62

Query: 62  --RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPTED 119
             ++ EF  + +D++LVGYLAT+ EE  LL+NKDHKVEV L+ G T+DS+ FVK+LP E+
Sbjct: 63  LTKTREFKFI-SDEYLVGYLATEEEEVRLLTNKDHKVEVNLQDG-TYDSTVFVKELPAEE 120

Query: 120 KLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGNFL 179
           K ++ATD  +D+Q HHFLDL KP++ QVLFG+FT+DFY+DQ+HRPRHYGKGSAPLFGNFL
Sbjct: 121 KFTVATDLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLFGNFL 180

Query: 180 EPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHF 239
           EPIS T W+++PI+WGPVV+Y L  +L  ++ IFA  LF LG FVWTLIEYC+HRFLFH 
Sbjct: 181 EPISLTPWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRFLFHL 240

Query: 240 DDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVACA 299
           DDW+P++N+ +T+HFLLHGVHHYLPMD YRLVVPPALF+VLCTP YKLVF LLP Y A A
Sbjct: 241 DDWVPQHNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLYWAYA 300

Query: 300 GFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVFDT 359
           GFAGG+ GYICYDL HYF+HH K+PKFMRK+K++HLEHHYKNYQLGFGVSN+FWDKVF T
Sbjct: 301 GFAGGLLGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDKVFGT 360

Query: 360 YLGKDAPISPMKY 372
           YLG D+P S M+Y
Sbjct: 361 YLGPDSPASIMRY 373

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  504 bits (1298), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 256/384 (66%), Positives = 303/384 (78%), Gaps = 11/384 (2%)

Query: 1   MSSN-SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDI 59
           MS+N S+TLEL SK TV  HN   D WV  Q RK+ D++ ++ E P  EE +L  AGKDI
Sbjct: 1   MSTNTSKTLELFSKKTVEEHNTAKDCWVTYQNRKIYDVTKFLSEHPGGEESILDYAGKDI 60

Query: 60  TD---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEG-GETFDSS 109
           T+          S     +  D++LVGYLATD E   LL+NK+HKVEV+L   G  FDS+
Sbjct: 61  TEVMKDSDVHEHSESAYEILEDEYLVGYLATDEEATRLLTNKNHKVEVQLSADGTEFDST 120

Query: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169
           TFVKDLPTE+KLSIATD   DY+KH FLDL KPL+ Q+L   FT+DFYVDQIHRPRHYGK
Sbjct: 121 TFVKDLPTEEKLSIATDYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGK 180

Query: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229
           GSAPLFGNFLEP++KTAW+VVP+ W PVV+Y +G +LK ++P+FA  LF +G FVWTLIE
Sbjct: 181 GSAPLFGNFLEPLTKTAWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIE 240

Query: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289
           Y +HRFLFHFDDWLPE+N+AF  HFLLHG HHYLPMDGYRLV+PP+LFV+LC PFYKLVF
Sbjct: 241 YSLHRFLFHFDDWLPESNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVF 300

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349
            LLP Y A AGFAGG+FGY+CYD  HYF+HHSK+P FMRKLK+YHLEHHYKNYQLGFGV+
Sbjct: 301 ALLPLYWAYAGFAGGLFGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 350 NWFWDKVFDTYLGKDAPISPMKYD 373
           +WFWD VF TYLG DAP+S MKY+
Sbjct: 361 SWFWDDVFGTYLGPDAPLSKMKYE 384

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  494 bits (1272), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 234/378 (61%), Positives = 297/378 (78%), Gaps = 9/378 (2%)

Query: 3   SNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           + ++TLEL SK  VA+H ++ D WV +  RK+ D++ ++ E  + + LLL  AG DITD 
Sbjct: 2   TTAKTLELFSKKEVANHTKREDCWVTIFSRKIYDVTKFLDENRDFDSLLLDYAGTDITDE 61

Query: 63  ------SHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLP 116
                   ++  L+ D++LVGY+AT  EE++LL+NKDHKVEV LE  + FD +T V +LP
Sbjct: 62  LVNGKLDEKYKALDNDNYLVGYVATADEEQKLLTNKDHKVEVTLE--QDFDLATLVVELP 119

Query: 117 TEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFG 176
            E+KL+IAT+  RD++KH FLDL KPL+PQ+L G FT++FYVDQI+RPRHYG+ SAPLFG
Sbjct: 120 PEEKLTIATNYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFG 179

Query: 177 N-FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRF 235
           N FLEP SKTAW+VVP  W PVV +F   +LK ++   AL LF +G FVWTL+EYC+HRF
Sbjct: 180 NAFLEPFSKTAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRF 239

Query: 236 LFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHY 295
           LFHFD++LPENN+AF +HFLLHG HHYLPMD YRLVVPPALF++LC P YK VF LLP+Y
Sbjct: 240 LFHFDNYLPENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYY 299

Query: 296 VACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDK 355
            ACAGFAGG+FGY+ YD+ HY LHHSK+P FMR+LKQYHLEHHYKNY+LG+G+++WFWDK
Sbjct: 300 WACAGFAGGLFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDK 359

Query: 356 VFDTYLGKDAPISPMKYD 373
           VF TYL KDAP S MK+D
Sbjct: 360 VFGTYLSKDAPASVMKFD 377

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  491 bits (1264), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 235/385 (61%), Positives = 295/385 (76%), Gaps = 16/385 (4%)

Query: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           MSS+ +TL L SK     H + N  WV +  RK+ ++S ++ E PE  + +L  AG+D+T
Sbjct: 1   MSSSCKTLPLYSKSEFEKHVKPNQCWVSIDQRKIYNVSKFLDENPEGYQYVLDHAGQDVT 60

Query: 61  ------------DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDS 108
                       D +H+   L +D +L+GYLAT  EE++LL+N +H VEVK   G   DS
Sbjct: 61  QLLKDMQTDEPTDLAHQ---LLSDAYLIGYLATSEEERKLLTNANHVVEVKPANGNRVDS 117

Query: 109 STFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYG 168
             FVK LPTE+KL+IATD K DY+KHHFLDL+KPL  QVLFG+FTK+FY+DQ+HRPRHYG
Sbjct: 118 G-FVKKLPTEEKLAIATDFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYG 176

Query: 169 KGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLI 228
           K SAPLFGNFLEP+SKT+W+V+PIVW P V+Y++  +L  I    AL LF +G FVWTLI
Sbjct: 177 KESAPLFGNFLEPLSKTSWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLI 236

Query: 229 EYCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLV 288
           EY +HRFLFHFDD +PE+N+ FT+HFLLHG+HHYLPMD YRLV+PPALF+ LC PFYKLV
Sbjct: 237 EYGLHRFLFHFDDRMPESNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLV 296

Query: 289 FKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGV 348
           F +LP+Y ACAGFAGG+FGY+ YD+ HYFLHH K+P FMRKLK+YHLEHHYKNY+LGFGV
Sbjct: 297 FSILPYYCACAGFAGGLFGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGV 356

Query: 349 SNWFWDKVFDTYLGKDAPISPMKYD 373
           ++W+WDKVF+TYL   AP+S  KYD
Sbjct: 357 TSWYWDKVFNTYLSPTAPLSRAKYD 381

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  486 bits (1252), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 230/384 (59%), Positives = 290/384 (75%), Gaps = 11/384 (2%)

Query: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           MS+ S TL+L S++ ++ HN + D WV V  RK+ +++ ++ E P   E +L  AG+DIT
Sbjct: 1   MSTKSPTLQLFSQEQLSKHNNEKDCWVSVYQRKIYNVTEFLDEHPGGAEYILKYAGRDIT 60

Query: 61  D---------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL--EGGETFDSS 109
           +          S     +  D++LVGYLAT  E  +LL+NK H+VEV L  +    FDS+
Sbjct: 61  EVLKDRDVHEHSESAYEILDDNYLVGYLATKEEATKLLTNKKHQVEVHLTDQNNSDFDST 120

Query: 110 TFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGK 169
           TFV +LP E+KL+IATD  RDY+KH FLDL + L+PQV+FG+F+KDFY+DQ+HRPRHYGK
Sbjct: 121 TFVPELPAEEKLNIATDYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGK 180

Query: 170 GSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIE 229
           GSAPLFGNFLEPISKT W+ +PI+W PVV +        ++ +F+  LF LG FVWTLIE
Sbjct: 181 GSAPLFGNFLEPISKTPWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIE 240

Query: 230 YCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVF 289
           YC+HRFLFH D+WLP+NN A T+HFLLHGVHHYLPMD YRLV+PP L +VL  P YK VF
Sbjct: 241 YCLHRFLFHLDEWLPDNNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVF 300

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVS 349
            LLP Y A +GFAGG+FGY+CYDL HYFLHH+K+P +MRKLK+YHLEHHYKNYQLGFGV+
Sbjct: 301 GLLPTYWAYSGFAGGLFGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVT 360

Query: 350 NWFWDKVFDTYLGKDAPISPMKYD 373
           +WFWD VF TYLG DAP++ MKYD
Sbjct: 361 SWFWDNVFGTYLGPDAPLAHMKYD 384

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  485 bits (1249), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 295/379 (77%), Gaps = 11/379 (2%)

Query: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRS 63
            ++TL L S+  +  HN ++D WV +  RK+ ++++++ E P   EL+   AGKD+T+  
Sbjct: 2   ETKTLPLYSQSQLEQHNTRDDCWVSLHHRKIYNVTSFLDEHPGGAELIEEYAGKDVTEIM 61

Query: 64  HEFPG---------LNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKD 114
            + P          +  +++ VGYLAT  EEK+LL N +H VEVKLE  E +DS+ FV +
Sbjct: 62  KDGPTHEHSYVAYEVLDEEYHVGYLATPEEEKKLLGNPEHPVEVKLE--EDYDSTVFVPE 119

Query: 115 LPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPL 174
           +P E+KLSI TD  +DY +H FLDL +PL+ Q+L   F+K+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPPEEKLSIVTDYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPL 179

Query: 175 FGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHR 234
           FGNFLEP+SKTAWYV+P+VW PVV+Y +  +L+ ++ + A+ LF LG FVWTLIEY +HR
Sbjct: 180 FGNFLEPLSKTAWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHR 239

Query: 235 FLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPH 294
           FLFH D +LP N VA+T+HFLLHGVHHYLPMD YRLV+PP LFVVLCTPFYKLVF LLP 
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPK 299

Query: 295 YVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWD 354
           Y ACAGFAGGMFGY+CYDL HYFLHH+K+P +MRKLK+YH+EHHYKNY+LGFGV++WFWD
Sbjct: 300 YWACAGFAGGMFGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWD 359

Query: 355 KVFDTYLGKDAPISPMKYD 373
           KVF TYLG +AP+S MK+D
Sbjct: 360 KVFGTYLGDNAPLSQMKFD 378

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  483 bits (1244), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 226/379 (59%), Positives = 292/379 (77%), Gaps = 11/379 (2%)

Query: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD-- 61
            ++TL L S   V  HN  +D WV +Q RK+ D++ ++ + P   +L++  AGKDIT+  
Sbjct: 2   ETKTLPLYSASQVQEHNSADDCWVTLQNRKIYDVTKFLEDHPGGGDLIVEYAGKDITEVM 61

Query: 62  -----RSHEFPGLNA--DDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKD 114
                 SH F       +++ VGYLAT  EE++LL N  HKVEVKLE  + +DS+ FV +
Sbjct: 62  KDGPLHSHSFVAYEVLDEEYHVGYLATAEEEQKLLGNSKHKVEVKLE--DEYDSTVFVPE 119

Query: 115 LPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPL 174
           +P E+KLSI TD  RDY +H FLDL +PL+ Q+L   FTK+FY+DQ+HRPRHYG+GSAPL
Sbjct: 120 VPAEEKLSIVTDYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPL 179

Query: 175 FGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHR 234
           FGNFLEP+SKT+WYV+PIVW PVV Y +  +++ ++ +FA+ LF +G FVWTLIEY MHR
Sbjct: 180 FGNFLEPLSKTSWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHR 239

Query: 235 FLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPH 294
           FLFH D +LP N VA+T+HFLLHGVHHYLPMD YRLV+PP LF++LCTPFYKLVF LLP+
Sbjct: 240 FLFHLDFYLPRNQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPY 299

Query: 295 YVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWD 354
           Y ACAGFAGGM GY+CYDL HYFLHH+K+P  ++KLK+YH+EHHYKNY+LGFGV++W WD
Sbjct: 300 YWACAGFAGGMLGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWD 359

Query: 355 KVFDTYLGKDAPISPMKYD 373
           KVF TYL ++AP+S MK+D
Sbjct: 360 KVFGTYLAENAPLSQMKFD 378

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  483 bits (1242), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 229/373 (61%), Positives = 285/373 (76%), Gaps = 12/373 (3%)

Query: 5   SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT---- 60
           S+TL L SK T+  H  +   WV V  RK+ D+S ++ E P  ++ +L  AGKDIT    
Sbjct: 3   SKTLPLYSKATLQKHTDRTSCWVSVGNRKIYDVSQFLDEHPGGDQYILDYAGKDITAVLK 62

Query: 61  -----DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDL 115
                + +     +  + +LVGYLAT+ EE +LL+N+ H +EV     E  D++TFVK+L
Sbjct: 63  DKLIHEHTEAAYEILDESYLVGYLATEEEEIKLLTNEKHVMEVT---PENLDTTTFVKEL 119

Query: 116 PTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLF 175
           P E+ LS+ATD   DY KHHFLDL KPL+ QVL G+FT+DFY+DQIHRPRHYGKGSAPLF
Sbjct: 120 PAEEVLSVATDFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLF 179

Query: 176 GNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRF 235
           GNFLEP+SKT W+VVP+VW PVVLY+L R+L+ +    AL  FA G FVWTLIEY +HRF
Sbjct: 180 GNFLEPLSKTVWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRF 239

Query: 236 LFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHY 295
           LFHFDD +PE+N+AFT+HFLLHGVHHYLPMD YRLV+PPALFVVLC PFY+LVF + P Y
Sbjct: 240 LFHFDDNMPESNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEY 299

Query: 296 VACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDK 355
            AC  FAGG+FGY+CYD+ HYFLHH K+P FMRKLK+YHLEHHYKNY+LGFGV++W+WDK
Sbjct: 300 CACGCFAGGLFGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDK 359

Query: 356 VFDTYLGKDAPIS 368
           VF TYL  ++P+S
Sbjct: 360 VFGTYLASNSPVS 372

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  476 bits (1226), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/374 (61%), Positives = 292/374 (78%), Gaps = 6/374 (1%)

Query: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEK--EELLLSLAGKDI 59
           S+ S+TLEL S +   SHN ++D WV V+ R + D+S +++E  +   E+ +L  AGKDI
Sbjct: 4   SNPSKTLELFSSEKFQSHNTEDDCWVSVKDRLIYDVSKFVQENKDVPVEDAVLKRAGKDI 63

Query: 60  TD--RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPT 117
           +D   +  F  ++ D +LVGYLA   EE  LL+NKDHKVEV L+ G T+DS+ FVK+LP+
Sbjct: 64  SDLLETKSFKFVD-DKYLVGYLANSTEEARLLTNKDHKVEVNLKDG-TYDSTVFVKELPS 121

Query: 118 EDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGN 177
           E+  +I+TD K+D+  HHFLDLEKPL+ Q+L G+FT++FY+DQIHRPRHYGKGSA LFGN
Sbjct: 122 EEHFTISTDYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFGN 181

Query: 178 FLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLF 237
           +LEPIS T W+++PI+WGPVV+Y      + +HP+ A+  + LG FVWT IEYC+HRFLF
Sbjct: 182 WLEPISLTPWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFLF 241

Query: 238 HFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVA 297
           H DDW+P++N  +TIHFLLHGVHHYLPMD YRLVVPPALFVVLCTPFYK VF LLP YVA
Sbjct: 242 HLDDWVPQHNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYVA 301

Query: 298 CAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVF 357
             GFAGG+ GYI YDL HYF+HH K+P+  RK+K++HLEHHYKNYQLGFGVSN+FWD VF
Sbjct: 302 YVGFAGGLTGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLVF 361

Query: 358 DTYLGKDAPISPMK 371
            TYLG D+P S M+
Sbjct: 362 GTYLGPDSPASIMR 375

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  469 bits (1207), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/385 (58%), Positives = 287/385 (74%), Gaps = 14/385 (3%)

Query: 2   SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
           SS+  T EL S ++V  HN K D WV+ Q RK+ D+S Y+ + P+    ++  AGKDIT 
Sbjct: 17  SSSPLTKELFSLESVQKHNTKKDCWVIYQNRKIYDVSQYLADYPKGNSKIIDFAGKDITS 76

Query: 62  ------------RSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKL-EGGETFDS 108
                        +++F   N D +LVGYLA + E  +LLSN  HKVEVKL E   T+DS
Sbjct: 77  SFKNQERYNHDPETYDFMSHN-DKYLVGYLANEEEAYKLLSNPSHKVEVKLTEQPSTYDS 135

Query: 109 STFVKDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYG 168
           +TFVK+LP+ED   IATD K+D+ +HHFLDLEKPLIPQ+    F + FY+DQIHRPRH+G
Sbjct: 136 TTFVKELPSEDHFVIATDYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFG 195

Query: 169 KGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLI 228
             SAPLFGNFLEP++KTAW+V+P+VW PVV Y L  +   ++ IFA  LF +G FVWTLI
Sbjct: 196 NKSAPLFGNFLEPLTKTAWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLI 255

Query: 229 EYCMHRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLV 288
           EY +HRFLFH D+ +P++ + + +HF +HG HHYLPMD YRLV+PP LF++LCTPFYKLV
Sbjct: 256 EYSLHRFLFHMDNRIPDHPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLV 315

Query: 289 FKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGV 348
           F +LP Y A AGFAGG+FGY+CYD +HY+LHHS++PKFMR LK+ HLEHHYKNYQL FGV
Sbjct: 316 FSVLPLYWAYAGFAGGLFGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGV 375

Query: 349 SNWFWDKVFDTYLGKDAPISPMKYD 373
           SN+FWDKVF TYL  D+P+SPMKY+
Sbjct: 376 SNYFWDKVFGTYLYPDSPLSPMKYE 400

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  351 bits (901), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 159/249 (63%), Positives = 200/249 (80%)

Query: 113 KDLPTEDKLSIATDTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSA 172
           K   TE+KL + TD  +D+ ++ FL L++PL  Q+L  +FT+DFY+DQ+H+PRHYG  SA
Sbjct: 15  KTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESA 74

Query: 173 PLFGNFLEPISKTAWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCM 232
           P+FGNFLEP +KT W++VP++WGPVVLY    SL+ I  I A+ LF++G FVWTLIEYCM
Sbjct: 75  PIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCM 134

Query: 233 HRFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLL 292
           HR+LFH DD +PE  + F +HFLLHG+HHYLPMD YRLV+PPALF +LC PFY L F + 
Sbjct: 135 HRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIF 194

Query: 293 PHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWF 352
           P Y A AGFAGG+FGY+CYD+ HYFLHH KMP FMRK+K+YHLEHHYKN+QLGFGV++ F
Sbjct: 195 PRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSF 254

Query: 353 WDKVFDTYL 361
           WD+VF TYL
Sbjct: 255 WDRVFGTYL 263

>NCAS0G02570 Chr7 complement(460218..460583) [366 bp, 121 aa] {ON}
          Anc_2.536 YMR073C
          Length = 121

 Score = 50.8 bits (120), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 37/53 (69%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ S   +A HN+ +DAW++++G KV D+S ++ E P  +E++  LAG+D T+
Sbjct: 3  QVYSYQQIAEHNKPDDAWIIIEG-KVYDVSKFLDEHPGGDEIIFELAGQDATE 54

>Kwal_47.18167 s47 complement(716570..717253) [684 bp, 227 aa]
          {ON} YNL111C (CYB5) - cytochrome b5 [contig 197] FULL
          Length = 227

 Score = 52.4 bits (124), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 36/59 (61%), Gaps = 1/59 (1%)

Query: 2  SSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          S  S  L  +S D VA+H   +D W+ + G KV D+S+Y+ + P   +++L LAGKD T
Sbjct: 25 SQTSSQLPFISSDEVATHTDADDCWISIHG-KVYDVSSYLPQHPGGAQVMLKLAGKDAT 82

>NDAI0F02730 Chr6 (669821..670186) [366 bp, 121 aa] {ON} Anc_2.166
          Length = 121

 Score = 49.7 bits (117), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 35/53 (66%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ + + +A HN  +D W+V++G KV D+S ++ E P  EE++  LAG D T+
Sbjct: 3  QIYTYEEIAKHNSPDDTWIVIEG-KVYDVSKFLDEHPGGEEIIFELAGTDATE 54

>ZYRO0B09812g Chr2 (765874..766425) [552 bp, 183 aa] {ON} similar to
           uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
           Cytochrome b5 involved in the sterol and lipid
           biosynthesis pathways required for sterol C5-6 and fatty
           acid desaturation
          Length = 183

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 52/98 (53%), Gaps = 9/98 (9%)

Query: 14  DTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT----DRSHEFPGL 69
           + VA HN   DAW++V G KV D++ ++ + P  +E++L LAG+D T    D  H    +
Sbjct: 64  EQVAEHNTPEDAWLIVDG-KVYDVTKFVEDHPGGDEIILDLAGQDGTEAFNDIGHSEDAV 122

Query: 70  NA-DDHLVGYL--ATDLEEKELLSNKDHKVEVKLEGGE 104
           N   D +VG L  A+   + E ++N      V   GGE
Sbjct: 123 NMLKDFIVGSLDPASRPAKSEKVANVAQTSGVT-TGGE 159

>KLTH0D09284g Chr4 (770560..770931) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 46.2 bits (108), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +L S   +A HN +ND W+++ G KV D + ++ E P  EE+LL L G+D T
Sbjct: 3  KLYSYKEIAEHNTENDLWMIIDG-KVYDCTKFMDEHPGGEEVLLDLGGQDAT 53

>KLLA0F27577g Chr6 (2556662..2557180) [519 bp, 172 aa] {ON} some
          similarities with uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5
          Length = 172

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 11/81 (13%)

Query: 10 LVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFPGL 69
          L++ D VA H+ ++D W V+ G KV DI++++ + P   ++LL  AGKD T        L
Sbjct: 5  LITMDEVARHSSRSDCWTVIHG-KVYDITSFLHKHPGGAQVLLKYAGKDST--------L 55

Query: 70 NADD--HLVGYLATDLEEKEL 88
            DD  H +  LA DL+   L
Sbjct: 56 QFDDIGHSMESLAYDLDPGAL 76

>AFL223W Chr6 (19601..20098) [498 bp, 165 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL111C (CYB5)
          Length = 165

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          +L +   +A HN +ND W+++ G KV D + +  E P  +E+L+ LAG+D T+
Sbjct: 42 KLYTYQEIAEHNSENDLWLIING-KVYDCTKFAEEHPGGDEVLIDLAGQDATE 93

>SAKL0E10626g Chr5 (885272..885643) [372 bp, 123 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111C CYB5
          Cytochrome b5 involved in the sterol and lipid
          biosynthesis pathways required for sterol C5-6 and
          fatty acid desaturation
          Length = 123

 Score = 44.7 bits (104), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +L +   +A HN + D W+++ G KV D + +I E P  EE+L+ L G+D T
Sbjct: 3  KLFTYQEIAEHNTEGDLWMIIDG-KVYDCTKFIDEHPGGEEVLVDLGGQDAT 53

>KNAG0I02040 Chr9 (397527..397886) [360 bp, 119 aa] {ON} Anc_2.166
          YNL111C
          Length = 119

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          ++ + + VA H+   DAW+V+  R V +++ ++ E P  EE+LL +AG D T
Sbjct: 3  KIYTYEDVAQHSTSEDAWIVIDNR-VYEVTKFLDEHPGGEEILLEMAGADAT 53

>TDEL0F01210 Chr6 complement(216322..216702) [381 bp, 126 aa] {ON}
          Anc_2.166 YNL111C
          Length = 126

 Score = 44.3 bits (103), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 16 VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          +A HN   D W+VV G KV D++ ++ E P  +E++L LAG+D ++
Sbjct: 10 IAEHNSAEDIWIVVDG-KVYDVTKFMDEHPGGDEIILDLAGQDASE 54

>Kwal_26.8461 s26 (794482..794853) [372 bp, 123 aa] {ON} YNL111C
          (CYB5) - 1:1 [contig 61] FULL
          Length = 123

 Score = 44.3 bits (103), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +L S   +A HN + D W+++ G KV D + ++ E P  EE+L+ L G+D T
Sbjct: 3  KLYSYKEIAEHNTEKDLWMIIDG-KVYDCTKFMDEHPGGEEVLVDLGGQDAT 53

>TBLA0B01310 Chr2 (276173..276544) [372 bp, 123 aa] {ON} Anc_2.166
          YNL111C
          Length = 123

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +L S + +A+HN    AW++++  KV D++ ++   P  +E++L LAG+D T
Sbjct: 3  KLYSYEEIAAHNTTESAWIIIKD-KVYDVTKFLDSHPGGDEIILELAGQDAT 53

>Kpol_505.14 s505 (37085..37456) [372 bp, 123 aa] {ON}
          (37085..37456) [372 nt, 124 aa]
          Length = 123

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 16 VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          +A HN     W+V+ G KV D + ++ E P  +E++L LAG+D T+
Sbjct: 10 IAEHNTTESCWIVIDG-KVYDTTKFLDEHPGGDEIILDLAGQDATE 54

>Ecym_5420 Chr5 (865505..865942) [438 bp, 145 aa] {ON} similar to
          Ashbya gossypii AFL223W
          Length = 145

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 16 VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +A HN + D W+++ G KV D S +  E P  +E+LL L G+D T
Sbjct: 10 IADHNSEQDLWLIING-KVYDCSKFADEHPGGDEVLLDLGGQDAT 53

>KLTH0A04026g Chr1 complement(337200..337901) [702 bp, 233 aa]
          {ON} weakly similar to uniprot|P40312 Saccharomyces
          cerevisiae YNL111C CYB5 Cytochrome b5, involved in the
          sterol and lipid biosynthesis pathways
          Length = 233

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 10 LVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
          ++S++ +A+H    D W+ + G  V D+S Y+ + P   +++L LAGKD T +
Sbjct: 33 VISREELATHTSAEDCWLAIHG-AVYDVSRYLTQHPGGAQVMLKLAGKDATAQ 84

>Suva_14.228 Chr14 complement(413753..414115) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ S   VA HN   + W+++   KV D+S +  E P  +E+++ L G+D TD
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATD 54

>TPHA0F01790 Chr6 (412270..412818) [549 bp, 182 aa] {ON} Anc_2.166
           YNL111C
          Length = 182

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 14  DTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFPGLNADD 73
           + +A HN    +W+V++G KV +++ ++ E P  +E++  LAG   TD +  F  +   D
Sbjct: 66  EEIAEHNTTESSWIVIEG-KVYNVTKFLDEHPGGDEIIFDLAG---TDATENFEDIGHSD 121

Query: 74  HLVGYLAT 81
             +  L T
Sbjct: 122 QALKVLKT 129

>KLLA0F23672g Chr6 (2212223..2212594) [372 bp, 123 aa] {ON}
          similar to uniprot|P40312 Saccharomyces cerevisiae
          YNL111C CYB5 Cytochrome b5 involved in the sterol and
          lipid biosynthesis pathways required for sterol C5-6
          and fatty acid desaturation
          Length = 123

 Score = 39.7 bits (91), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +L++   V+ H   +D W+++ G KV D + ++ E P  +E+L+ L G+D T
Sbjct: 3  KLLTYKEVSEHKTVDDLWMIIDG-KVYDCTKFVDEHPGGDEILVDLGGQDAT 53

>Skud_14.221 Chr14 complement(407119..407481) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 39.3 bits (90), Expect = 0.002,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ S   VA HN   + W+++   KV D+S +  E P  +E+++ L G+D T+
Sbjct: 3  KVYSYQEVAEHNGPENCWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATE 54

>KAFR0I00520 Chr9 complement(107239..108999) [1761 bp, 586 aa] {ON}
           Anc_4.304 YML054C
          Length = 586

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S+ + T  L+  + VA H   +D WVV+ G  V DI+++I   P   ++L + AGKD+T
Sbjct: 73  ISNEAITTRLILPEEVAKHKTPDDCWVVINGY-VYDITSFIMSHPGGPDVLETNAGKDVT 131

>NCAS0A02770 Chr1 (528814..530643) [1830 bp, 609 aa] {ON} 
          Length = 609

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 1/56 (1%)

Query: 5   SRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           S T   +S D V  HN +ND W+V+ G +V D+++++   P   +++   AGKD++
Sbjct: 89  SSTKSPISTDEVTKHNSENDCWIVING-QVYDLTSFMSIHPGGSDIIKLNAGKDVS 143

>CAGL0L03828g Chr12 (442660..443025) [366 bp, 121 aa] {ON} similar
          to uniprot|P40312 Saccharomyces cerevisiae YNL111c CYB5
          Length = 121

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 27/45 (60%), Gaps = 1/45 (2%)

Query: 16 VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          V+ HN++ D W+++ G  V D+S ++ E P  +E++    G D T
Sbjct: 10 VSEHNKEGDCWIIIDG-SVYDVSKFLDEHPGGDEIIFEHRGTDAT 53

>Kpol_1014.5 s1014 complement(3107..4897) [1791 bp, 596 aa] {ON}
           complement(3107..4897) [1791 nt, 597 aa]
          Length = 596

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 39/58 (67%), Gaps = 1/58 (1%)

Query: 4   NSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
           + ++L++++   V  HN K+D WVV+    V D++ +I++ P  +++++  AGKD+++
Sbjct: 84  SKKSLKIITPQEVIKHNSKDDCWVVINDI-VYDLTFFIKKHPGGQDVIVGNAGKDVSN 140

>Smik_14.216 Chr14 complement(396585..396947) [363 bp, 120 aa]
          {ON} YNL111C (REAL)
          Length = 120

 Score = 38.5 bits (88), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ S   VA HN   + W+++   KV D+S +  E P  +E+++ L G+D T+
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSKFKDEHPGGDEIIMDLGGQDATE 54

>YNL111C Chr14 complement(416940..417302) [363 bp, 120 aa] {ON}
          CYB5Cytochrome b5, involved in the sterol and lipid
          biosynthesis pathways; acts as an electron donor to
          support sterol C5-6 desaturation
          Length = 120

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 9  ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          ++ S   VA HN   + W+++   KV D+S +  E P  +E+++ L G+D T+
Sbjct: 3  KVYSYQEVAEHNGPENFWIIIDD-KVYDVSQFKDEHPGGDEIIMDLGGQDATE 54

>KAFR0B04550 Chr2 (946561..946941) [381 bp, 126 aa] {ON} Anc_2.166
          YNL111C
          Length = 126

 Score = 37.4 bits (85), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 16 VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
          VA H   +D W+ + G KV ++S ++ E P  +E++  LAG D T+
Sbjct: 10 VAEHVLPDDCWIAIDG-KVYNVSKFLDEHPGGDEIIYELAGSDATE 54

>SAKL0F16610g Chr6 (1373674..1375368) [1695 bp, 564 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 564

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSH 64
           ++ D V  HN  +D W+V+ G  V DI+ +I+  P     L+ +AG+D T++ H
Sbjct: 88  ITVDEVKLHNNIDDCWIVLNG-DVYDITEFIKIHPGGAARLMEVAGRDATEKFH 140

>ADL085C Chr4 complement(535293..536114) [822 bp, 273 aa] {ON}
           NOHBY406; No homolog in Saccharomyces cerevisiae
          Length = 273

 Score = 38.9 bits (89), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           L  +S + V+ H  ++D W ++ GR V DI+  +   P   ++LL  AG+D T
Sbjct: 90  LRKISIEEVSQHTSRDDCWFIIHGR-VYDITGLLENHPGGTKILLKYAGRDAT 141

>NDAI0D04710 Chr4 (1106280..1108130) [1851 bp, 616 aa] {ON}
           Anc_4.304
          Length = 616

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%), Gaps = 1/52 (1%)

Query: 10  LVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
           L+S D VA H+   D WVV+   KV D++++I   P   +++ S AGKD+T+
Sbjct: 95  LISPDEVAKHHTPADCWVVIHD-KVYDLTSFIPIHPGGPDIIKSNAGKDVTN 145

>SAKL0F08316g Chr6 complement(634949..635485) [537 bp, 178 aa]
          {ON} some similarities with uniprot|P00175
          Saccharomyces cerevisiae YML054C CYB2 Cytochrome b2
          (L-lactate cytochrome-c oxidoreductase), component of
          the mitochondrial intermembrane space, required for
          lactate utilization; expression is repressed by glucose
          and anaerobic conditions
          Length = 178

 Score = 37.7 bits (86), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 14/55 (25%), Positives = 33/55 (60%), Gaps = 1/55 (1%)

Query: 8  LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
          + ++S   V  HN+ +D W+++ G KV ++++++ + P    ++L   G+D T +
Sbjct: 1  MHVISPSEVVKHNRPDDCWMIIHG-KVYNLTSFLSQHPGGAHVILQYGGRDATKQ 54

>KLTH0C11770g Chr3 (970979..972835) [1857 bp, 618 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 618

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           VS   V  HN+++D WVV+ G  V D++A+I + P    ++   AGKD++
Sbjct: 119 VSATEVIRHNKEDDCWVVIDG-YVYDVTAFIDQHPGGSAVIRGNAGKDVS 167

>Skud_7.226 Chr7 (402118..403647) [1530 bp, 509 aa] {ON} YGL055W
           (REAL)
          Length = 509

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFP 67
           L L  K T  + +++N   V++ G  V D+S YI E P  E L+ +  GKD T       
Sbjct: 408 LPLWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAFS--G 464

Query: 68  GLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTF 111
           G+    +    +  D+    +  +K+  V +  + GE +++  F
Sbjct: 465 GVYRHSNAAQNVLADMRVAIIKESKNSAVRMASKRGEVYETGKF 508

>TPHA0B01820 Chr2 complement(406416..408146) [1731 bp, 576 aa] {ON}
           Anc_4.304 YML054C
          Length = 576

 Score = 37.7 bits (86), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 36/55 (65%), Gaps = 1/55 (1%)

Query: 6   RTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +  ++++ + VA HN+++D WVV+    V +++ +I   P  + ++++ +GKD+T
Sbjct: 68  KNSKVITPEEVARHNKRDDCWVVIND-SVYNLTDFIDSHPGGKNVIVANSGKDVT 121

>CAGL0I00418g Chr9 (30058..31530) [1473 bp, 490 aa] {ON} highly
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055w OLE1 stearoyl-CoA desaturase
          Length = 490

 Score = 37.4 bits (85), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 29/49 (59%), Gaps = 1/49 (2%)

Query: 12  SKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +K+     N++ND  V+V G  V D+S YI E P  E+LL +  GKD T
Sbjct: 390 TKEEFLEKNRENDGLVIVGG-IVHDVSGYITEHPGGEKLLKNALGKDAT 437

>ZYRO0B02090g Chr2 complement(169589..170173) [585 bp, 194 aa] {ON}
           similar to gnl|GLV|KLLA0E18535g Kluyveromyces lactis
           KLLA0E18535g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 194

 Score = 36.2 bits (82), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 2/57 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLS-LAGKDITDRSHEF 66
           V K+ +  HN K+D W V+QG KV  ++ Y    P   ++LL   AGKD T   +E+
Sbjct: 119 VDKELLRRHNTKDDCWCVIQG-KVYCLTNYFDFHPGGVDILLRYCAGKDATKMFNEY 174

>ZYRO0C18524g Chr3 (1450641..1452305) [1665 bp, 554 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 554

 Score = 37.0 bits (84), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 19  HNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           HN  ND W+V+ G ++ D++++I + P     LL +AG+D T +
Sbjct: 84  HNNVNDCWIVLNG-EIYDVTSFIGKHPGGAARLLEVAGRDATAK 126

>YGL055W Chr7 (398628..400160) [1533 bp, 510 aa] {ON}  OLE1Delta(9)
           fatty acid desaturase, required for monounsaturated
           fatty acid synthesis and for normal distribution of
           mitochondria
          Length = 510

 Score = 37.0 bits (84), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFP 67
           L +  K T  + +++N   V++ G  V D+S YI E P  E L+ +  GKD T       
Sbjct: 409 LPMWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAFS--G 465

Query: 68  GLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTF 111
           G+    +    +  D+    +  +K+  + +  + GE +++  F
Sbjct: 466 GVYRHSNAAQNVLADMRVAVIKESKNSAIRMASKRGEIYETGKF 509

>KLLA0B14795g Chr2 (1299429..1301099) [1671 bp, 556 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 556

 Score = 37.0 bits (84), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           VS   V  HN+ +D W+V+   +V DI+ ++ + P     L+  AG+D T+R
Sbjct: 81  VSVKEVKMHNRIDDCWIVIDN-EVYDITKFLSQHPGGVARLMEFAGRDATER 131

>NCAS0A02780 Chr1 (531072..532880) [1809 bp, 602 aa] {ON} Anc_4.304
          Length = 602

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%), Gaps = 1/45 (2%)

Query: 16  VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           VA HN   D W+V+ G  V D++++I   P   +++ S AGKD+T
Sbjct: 94  VARHNTPADCWIVINGV-VYDLTSFIPVHPGGADIIKSNAGKDVT 137

>ZYRO0B13728g Chr2 (1110636..1112432) [1797 bp, 598 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 598

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S D VA HN  +D WVV+ G  V D++ +    P    ++ S AGKD++
Sbjct: 84  ISPDEVAKHNSPDDCWVVIDGY-VYDLTEFAPVHPGGPTVIKSNAGKDVS 132

>TDEL0H02180 Chr8 (369539..370150) [612 bp, 203 aa] {ON} 
          Length = 203

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 6  RTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          R L  +    V  HN  +D W+ + GR V D++  + + P   ++LL  AG D T
Sbjct: 20 RNLPKIRLAEVREHNTAHDCWMAIHGR-VYDVTPILSKHPGGCQILLKYAGMDAT 73

>Smik_7.225 Chr7 (393200..394732) [1533 bp, 510 aa] {ON} YGL055W
           (REAL)
          Length = 510

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/104 (24%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFP 67
           L +  K T  + +++N   V++ G  V D+S YI E P  E L+ +  GKD T       
Sbjct: 409 LPVWDKQTFLAKSKENKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDATKAFS--G 465

Query: 68  GLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTF 111
           G+    +    +  D+    +  +K+  + +  + GE +++  F
Sbjct: 466 GVYRHSNAAQNVLADMRVAIIKESKNSAIRMASKRGEVYETGKF 509

>Kpol_348.12 s348 complement(21978..22631) [654 bp, 217 aa] {ON}
           complement(21978..22631) [654 nt, 218 aa]
          Length = 217

 Score = 35.4 bits (80), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 32/52 (61%), Gaps = 2/52 (3%)

Query: 10  LVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLS-LAGKDIT 60
           +++K  VA H   +D W +++G KV  IS Y +  P  +++L++  +G+D T
Sbjct: 142 MITKKMVAKHKDIDDCWCIIRG-KVYSISNYFKFHPGGDKILINQCSGRDCT 192

>Smik_13.92 Chr13 complement(163135..164910) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   VA HN+ +D WVV+ G  V D++ ++   P  ++++   AGKD+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIKFNAGKDVT 139

>YML054C Chr13 complement(165533..167308) [1776 bp, 591 aa] {ON}
           CYB2Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase), component of the mitochondrial
           intermembrane space, required for lactate utilization;
           expression is repressed by glucose and anaerobic
           conditions
          Length = 591

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 31/50 (62%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   VA HN+ +D WVV+ G  V D++ ++   P  ++++   AGKD+T
Sbjct: 91  ISPAEVAKHNKPDDCWVVINGY-VYDLTRFLPNHPGGQDVIKFNAGKDVT 139

>KNAG0E03860 Chr5 (763388..765202) [1815 bp, 604 aa] {ON} Anc_4.304
           YML054C
          Length = 604

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   VA HN  +D WVV++G  V +++ +I   P    ++ S AGKD+T
Sbjct: 92  ISPSEVAKHNTPDDCWVVIEGY-VYNLTEFIPTHPGGPMVIKSNAGKDVT 140

>NDAI0D04700 Chr4 (1103670..1105547) [1878 bp, 625 aa] {ON} 
          Length = 625

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           ++ + +  HN   D WVV+  + V D++ +I+  P    ++ S AGKD+T
Sbjct: 105 ITPNELMKHNTPEDCWVVINNQ-VYDLTTFIQVHPGGPNIIRSNAGKDVT 153

>ADR212C Chr4 complement(1074194..1076659) [2466 bp, 821 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKR079C
          Length = 821

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 3/62 (4%)

Query: 314 IHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFG--VSNWFWDKVFDTYLGKDAPISPMK 371
           IH  LH  K+P+F R LK  +L H + ++ LG    +  W+     D    K   ++P K
Sbjct: 511 IHRLLHKVKIPRFFRDLKMIYLSHLHADHHLGIASLLKEWYLHNKEDPE-AKIYLVAPWK 569

Query: 372 YD 373
           YD
Sbjct: 570 YD 571

>SAKL0G16852g Chr7 (1452894..1454636) [1743 bp, 580 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 580

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 1/45 (2%)

Query: 16  VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           VA HN   D WVV+ G  V D++ +I   P    ++ + AGKD+T
Sbjct: 86  VAKHNDPKDCWVVIDGY-VYDLTEFIHSHPGGPTIIENNAGKDVT 129

>CAGL0K10736g Chr11 (1046127..1047908) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054c CYB2 lactate dehydrogenase cytochrome b2
          Length = 593

 Score = 34.7 bits (78), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   V  HN   D WVV+ G  V D++ +I   P   +++ + AGKD+T
Sbjct: 90  ISPSEVIKHNTPEDCWVVIDGY-VYDLTNFIALHPGGPDIIKTNAGKDVT 138

>Kwal_23.2823 s23 (29032..30714) [1683 bp, 560 aa] {ON} YML054C
           (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 246] FULL
          Length = 560

 Score = 34.7 bits (78), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 19  HNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           HN+ ND W+V+   +V D++++I   P   + +L +AG D T++
Sbjct: 89  HNKLNDCWIVLND-EVYDVTSFIAAHPGGVQRILEVAGSDATEK 131

>Kwal_14.807 s14 complement(57218..58954) [1737 bp, 578 aa] {ON}
           YML054C (CYB2) - Cytochrome b2 [L--lactate cytochrome-c
           oxidoreductase] [contig 245] FULL
          Length = 578

 Score = 34.3 bits (77), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 9   ELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           E +    VA H++ +D WVV+ G  V D+S +I   P    ++ + AGKD++
Sbjct: 77  ESIRPQEVAKHSKPDDCWVVINGY-VYDLSDFIAVHPGGPAIIKANAGKDVS 127

>TDEL0D01140 Chr4 complement(214858..216612) [1755 bp, 584 aa] {ON}
           Anc_4.304 YML054C
          Length = 584

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 39/76 (51%), Gaps = 4/76 (5%)

Query: 7   TLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEF 66
           T + +    V  HN  +D WVV+ G  V D+S +I   P    ++ + AGKD+   S  F
Sbjct: 74  TKKSIDPKEVEKHNAPDDCWVVIDGY-VYDLSDFIPSHPGGPAVIRANAGKDV---SAIF 129

Query: 67  PGLNADDHLVGYLATD 82
             L+A D +  Y+A +
Sbjct: 130 DPLHAPDVIEKYIAPE 145

>KLLA0E18459g Chr5 (1641507..1641953) [447 bp, 148 aa] {ON} similar
           to uniprot|Q59TA9 Candida albicans CaO19 Potential
           heme/steroid binding protein and some similarites with
           YMR073C uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 148

 Score = 33.1 bits (74), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 3/51 (5%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITD 61
           V+K+ + ++  K++ W V+  RKV  I AY+   P  E +L   AGKD+T 
Sbjct: 72  VNKEALKAN--KDNFWCVIN-RKVYCIKAYLSYHPGGEVILKQCAGKDVTS 119

>KLLA0D02640g Chr4 complement(225482..227251) [1770 bp, 589 aa] {ON}
           similar to uniprot|P00175 Saccharomyces cerevisiae
           YML054C CYB2 Cytochrome b2 (L-lactate cytochrome-c
           oxidoreductase) component of the mitochondrial
           intermembrane space required for lactate utilization
           expression is repressed by glucose and anaerobic
           conditions
          Length = 589

 Score = 34.3 bits (77), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 38/70 (54%), Gaps = 4/70 (5%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFPGLN 70
           VS   VA H+   D WVV++G  V +++ +I   P    ++ + AGKD+T     F  ++
Sbjct: 90  VSPTEVAKHSSPKDCWVVIEGY-VYNLTDFISAHPGGPAIIENNAGKDVT---KIFAPIH 145

Query: 71  ADDHLVGYLA 80
           A D +  Y+A
Sbjct: 146 APDVIEKYIA 155

>KLTH0D06930g Chr4 complement(604805..605419) [615 bp, 204 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073C Hypothetical ORF
          Length = 204

 Score = 33.5 bits (75), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLL-SLAGKDIT 60
           V+K  +  HN   D W V+  R V  +S+Y+   P   E+LL + AGKD T
Sbjct: 129 VTKAQLQKHNTAEDCWCVLNQR-VYCVSSYLDFHPGGAEILLRTAAGKDAT 178

>Suva_13.105 Chr13 complement(168279..170054) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 34.3 bits (77), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 29/50 (58%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   VA HN  +D WVV+ G  V D++ ++   P   +++   AG+D+T
Sbjct: 91  ISPAEVAKHNSADDCWVVINGY-VYDLTRFVPNHPGGPDVIKYNAGRDVT 139

>NDAI0I01620 Chr9 complement(382761..384086) [1326 bp, 441 aa] {ON}
           Anc_6.106
          Length = 441

 Score = 33.9 bits (76), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 40/90 (44%), Gaps = 2/90 (2%)

Query: 20  NQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFPGLNADDHLVGYL 79
           N  N+  +V+    + D++ Y +E P  E+LL S  GKD T R+ +  G+    +    +
Sbjct: 351 NSNNNRKLVIISGIIHDVTNYTKEHPGGEKLLNSAVGKDGT-RAFQ-GGVYRHSNSAHNV 408

Query: 80  ATDLEEKELLSNKDHKVEVKLEGGETFDSS 109
             D+    L   KD  +      GE FD  
Sbjct: 409 LADMRIAILKEKKDSAINFVKRRGEKFDKQ 438

>Skud_13.92 Chr13 complement(163654..165429) [1776 bp, 591 aa] {ON}
           YML054C (REAL)
          Length = 591

 Score = 33.9 bits (76), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 30/50 (60%), Gaps = 1/50 (2%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S   VA HN+ +D WVV+ G  V D++ ++   P   +++   AG+D+T
Sbjct: 91  ISPAEVAKHNKADDCWVVINGY-VYDLTRFMPNHPGGPDVIKFNAGRDVT 139

>SAKL0A09570g Chr1 complement(838406..839041) [636 bp, 211 aa] {ON}
           similar to gnl|GLV|CAGL0K03069g Candida glabrata
           CAGL0K03069g and weakly similar to YMR073C
           uniprot|Q04772 Saccharomyces cerevisiae YMR073C
           Hypothetical ORF
          Length = 211

 Score = 33.1 bits (74), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLS-LAGKDIT 60
           + KD +  H   +D W V++G KV  +SAY    P   E+LL+  AG+D T
Sbjct: 136 IDKDELIKHKTVDDCWCVLKG-KVYCLSAYFDFHPGGVEILLNKCAGRDAT 185

>TBLA0I01530 Chr9 (334102..334767) [666 bp, 221 aa] {ON} Anc_2.536
           YMR073C
          Length = 221

 Score = 33.1 bits (74), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 33/52 (63%), Gaps = 2/52 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLA-GKDITD 61
           +++  ++ H + +D W V++GR V  IS Y+   P  +++L++   GKD+++
Sbjct: 144 INQKILSEHQEVDDCWCVIKGR-VYSISRYMDYHPGGKQILINTCLGKDVSN 194

>TDEL0D00190 Chr4 (29971..31629) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score = 33.9 bits (76), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           +S   +  HN  +D W+ + G +V D++A+++  P     L+ +AG D T++
Sbjct: 75  ISASELRKHNTVHDCWIALNG-EVYDVTAFLQMHPGGVARLMEVAGGDATEK 125

>KLTH0C11858g Chr3 (979073..980740) [1668 bp, 555 aa] {ON} similar
           to uniprot|P00175 Saccharomyces cerevisiae YML054C CYB2
           Cytochrome b2 (L-lactate cytochrome-c oxidoreductase)
           component of the mitochondrial intermembrane space
           required for lactate utilization expression is repressed
           by glucose and anaerobic conditions
          Length = 555

 Score = 33.9 bits (76), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%)

Query: 16  VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDR 62
           V  HN+ +D W+V+ G +V D++++++  P     ++ +AG D T +
Sbjct: 81  VMQHNKPDDCWIVLNG-EVYDVTSFLQMHPGGAARIMEVAGNDATRK 126

>TDEL0B04890 Chr2 complement(857124..861830) [4707 bp, 1568 aa] {ON}
           Anc_2.125 YNL139C
          Length = 1568

 Score = 33.9 bits (76), Expect = 0.82,   Method: Composition-based stats.
 Identities = 15/48 (31%), Positives = 25/48 (52%)

Query: 234 RFLFHFDDWLPENNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLC 281
           R +F++ +W  E ++  ++  L+   H Y  + G RL V P L   LC
Sbjct: 497 RAVFYYPEWTSELSLVNSVEDLIKTSHEYFSIIGVRLAVCPKLISKLC 544

>CAGL0I05016g Chr9 complement(460019..461539) [1521 bp, 506 aa] {ON}
           highly similar to uniprot|P00899 Saccharomyces
           cerevisiae YER090w TRP2
          Length = 506

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 20/43 (46%), Gaps = 5/43 (11%)

Query: 289 FKLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLK 331
           FKL  +       +GG  GYI YD I YF      PK  R LK
Sbjct: 107 FKLATNVPGLPKLSGGAIGYISYDCIRYF-----EPKTKRDLK 144

>Suva_7.216 Chr7 (391750..393162) [1413 bp, 470 aa] {ON} YGL055W
           (REAL)
          Length = 470

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           L +  K T  +  + N   V++ G  V D+S YI E P  E L+ +  GKD T
Sbjct: 405 LPVWDKQTFLAKTKDNKGLVIISG-IVHDVSGYISEHPGGETLIKTALGKDAT 456

>CAGL0M13101g Chr13 (1288111..1289136) [1026 bp, 341 aa] {ON}
           similar to uniprot|P35735 Saccharomyces cerevisiae
           YKL051w
          Length = 341

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 2/52 (3%)

Query: 290 KLLPHYVACAGFAGGMFGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKN 341
            L P ++ACAG+ G   GY+      YF    + P  M   K  H+E  Y N
Sbjct: 58  NLRPLFIACAGWQG--LGYVITIACEYFQRAGRWPFRMPNSKSPHVEAEYDN 107

>ZYRO0D16654g Chr4 complement(1380316..1380888) [573 bp, 190 aa]
           {ON} conserved hypothetical protein
          Length = 190

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 7/131 (5%)

Query: 1   MSSNSRTLELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +S +   L  +S D +  H    D W+V+ GR V +++  +   P   ++LL   G+D T
Sbjct: 20  LSVDDEDLPSLSWDEIRKHMTPPDCWMVIHGR-VYNVAPVLASHPGGSQILLHYVGRDAT 78

Query: 61  DRSHEFPGLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTFVKDLPTEDK 120
                +P  +   H +  L  D+    L    ++  E ++ GG    S     D   +++
Sbjct: 79  -----YP-FDDVGHSMESLIFDMPPGSLKGKLENCAESRVRGGYVRGSDGKNDDNEDKEE 132

Query: 121 LSIATDTKRDY 131
           + +     + Y
Sbjct: 133 VVVTQSQAQSY 143

>SAKL0A07326g Chr1 (648420..649862) [1443 bp, 480 aa] {ON}
           uniprot|Q9HFB2 Saccharomyces kluyveri Sk Delta 9- fatty
           acid desaturase
          Length = 480

 Score = 32.3 bits (72), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 21  QKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           + N   V+V G  V D+S YI E P  E L+ + AGKD T
Sbjct: 392 KSNPGLVIVSG-IVHDVSGYITEHPGGETLIQAAAGKDAT 430

>KLLA0C05566g Chr3 complement(497877..499310) [1434 bp, 477 aa] {ON}
           similar to uniprot|P21147 Saccharomyces cerevisiae
           YGL055W OLE1 Fatty acid desaturase required for
           monounsaturated fatty acid synthesis and for normal
           distribution of mitochondria
          Length = 477

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 1/53 (1%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           L +  KD      + N+  VV+ G  V D+S YI E P  E L+ +  GKD T
Sbjct: 379 LPVWDKDEFMEKLKSNNGLVVISG-IVHDVSGYITEHPGGETLIQASLGKDAT 430

>Skud_5.175 Chr5 (273267..274937) [1671 bp, 556 aa] {ON} YER060W
           (REAL)
          Length = 556

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 47/101 (46%), Gaps = 4/101 (3%)

Query: 143 LIPQVLFGSFTKDFYVDQIHRPRHY-GKGSAPLFGNFLEPISKTAWYVVPIVWGPVVLYF 201
           L+P  LF  F  +  + Q+   R+  G  +A +F +F+  I+   W V+ I     +L  
Sbjct: 156 LLPVALFSLFGVELGLRQMILSRYLAGNVTARIF-SFINVIACVGWCVLNISVSAQLLNM 214

Query: 202 LGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHFDDW 242
           +      + PI+A  L   GG V  L+ +  +R +  ++ W
Sbjct: 215 VNEGSGHVCPIWAGCLIIAGGTV--LVTFFGYRVIHAYEKW 253

>NCAS0D03250 Chr4 (608476..609969) [1494 bp, 497 aa] {ON} Anc_6.106
          Length = 497

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 43/104 (41%), Gaps = 3/104 (2%)

Query: 8   LELVSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDITDRSHEFP 67
           L +  K       Q N   VV+ G  + DIS YI E P  E L+    GKD T R+ +  
Sbjct: 396 LPVWDKKEFVEQAQLNKNLVVISG-IIHDISNYIPEHPGGESLIKQALGKDAT-RAFQ-G 452

Query: 68  GLNADDHLVGYLATDLEEKELLSNKDHKVEVKLEGGETFDSSTF 111
           G+         + ++L    L  N +  +      GE FD + F
Sbjct: 453 GVYRHSTAAQNVLSELRVAVLKENGNAAMNFVKRRGEQFDKNKF 496

>TPHA0G03550 Chr7 complement(755688..756344) [657 bp, 218 aa] {ON}
           Anc_2.536 YMR073C
          Length = 218

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLS-LAGKDITDRSHEF 66
           +S+  VA HN  +D W +++G KV  I+ Y    P  +++L +  +G D T++ +++
Sbjct: 143 ISEKMVAEHNTVDDCWCIIKG-KVYCITNYFEYHPGGDKILKNFCSGVDATEQFYKY 198

>Kwal_26.8046 s26 complement(621715..622311) [597 bp, 198 aa] {ON}
           YMR073C - Hypothetical ORF [contig 55] FULL
          Length = 198

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 11  VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLL-SLAGKDIT 60
           ++K  +A H    D W V+  +KV  IS+Y+   P   ++L+   AGKD T
Sbjct: 123 INKAQLAQHKAPEDCWCVIN-QKVYCISSYLDFHPGGVDILMKGAAGKDCT 172

>AAR153C Chr1 complement(619953..621389) [1437 bp, 478 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL055W
           (OLE1)
          Length = 478

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 20  NQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
           +++N   VV+ G  V D+S YI E P  E L+ +  GKD T
Sbjct: 390 SRENSGLVVISG-IVHDVSGYITEHPGGETLIQAALGKDAT 429

>Ecym_4346 Chr4 (739106..739735) [630 bp, 209 aa] {ON} similar to
          Ashbya gossypii ADL085C
          Length = 209

 Score = 30.8 bits (68), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 1/50 (2%)

Query: 11 VSKDTVASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLLSLAGKDIT 60
          +S   V  H   +D W ++   KV DI+  +   P   + LL  AG+D T
Sbjct: 6  ISLSEVRRHTSADDCWFIIH-NKVYDITNLLSTHPGGAKTLLKYAGRDAT 54

>CAGL0K03069g Chr11 complement(285190..285774) [585 bp, 194 aa] {ON}
           weakly similar to uniprot|Q04772 Saccharomyces
           cerevisiae YMR073c
          Length = 194

 Score = 30.0 bits (66), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 16  VASHNQKNDAWVVVQGRKVVDISAYIRERPEKEELLL-SLAGKDIT 60
           +A HN   D W V+ G KV  IS+Y+   P   ++L+   +G+D T
Sbjct: 124 LARHNTAEDCWTVING-KVYSISSYLSFHPGGAKILIDKSSGQDST 168

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.143    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,096,486
Number of extensions: 2092911
Number of successful extensions: 6920
Number of sequences better than 10.0: 114
Number of HSP's gapped: 7106
Number of HSP's successfully gapped: 114
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 66 (30.0 bits)