Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002908.837ON3672218251e-108
TPHA0I002208.837ON3772226041e-74
Smik_13.4898.837ON3722215981e-73
Suva_13.4648.837ON3662215901e-72
YMR276W (DSK2)8.837ON3732215858e-72
Skud_13.4488.837ON3642215822e-71
TDEL0B006008.837ON3692215726e-70
Kpol_1068.118.837ON3812225668e-69
KAFR0B039008.837ON3792225598e-68
TBLA0D032308.837ON3752215536e-67
Kwal_27.102758.837ON3792235493e-66
ABL129W8.837ON3452215463e-66
KLLA0D01859g8.837ON3712195432e-65
CAGL0M02937g8.837ON3732215432e-65
ZYRO0G14124g8.837ON3692315412e-65
NDAI0K004408.837ON4042195434e-65
KLTH0C03938g8.837ON3762295362e-64
SAKL0D01540g8.837ON3652215343e-64
NCAS0C004308.837ON3692215319e-64
Ecym_46088.837ON4062305303e-63
Kpol_1036.628.311ON77521111e-06
ZYRO0D05962g8.311ON77521067e-06
TDEL0F043808.311ON77511051e-05
CAGL0B01589g8.311ON77521041e-05
TDEL0G017504.16ON77491004e-05
NDAI0H002704.16ON7749996e-05
Suva_10.32singletonON6249986e-05
Skud_9.205.701ON125491027e-05
Smik_11.3575.701ON125491027e-05
Smik_9.215.701ON124491027e-05
Kwal_YGOB_Anc_5.7015.701ON128491028e-05
KAFR0D022305.701ON128491018e-05
KAFR0H002205.701ON128491018e-05
Suva_11.3305.701ON128491018e-05
Skud_11.3335.701ON128491018e-05
YIL148W (RPL40A)5.701ON128491018e-05
YKR094C (RPL40B)5.701ON128491018e-05
Kpol_1043.695.701ON128491018e-05
KLTH0E01078g5.701ON128491018e-05
ZYRO0G06622g5.701ON128491018e-05
SAKL0E14894g5.701ON128491019e-05
KLLA0A00616g5.701ON128491019e-05
TPHA0E002405.701ON128491019e-05
TPHA0D046005.701ON128491019e-05
TBLA0E021105.701ON128491019e-05
CAGL0G02475g5.701ON128491019e-05
NDAI0E050305.701ON128491019e-05
NCAS0A032105.701ON128491019e-05
NCAS0G002405.701ON128491019e-05
TDEL0B022005.701ON128491011e-04
TPHA0C008908.311ON7752971e-04
Ecym_40195.701ON128491001e-04
AFR285C5.701ON128491001e-04
KNAG0L021205.701ON128491001e-04
Suva_9.405.701ON144701011e-04
TBLA0B032408.837ON284571051e-04
KAFR0C030008.142ON397401052e-04
NDAI0J010708.311ON7752952e-04
TPHA0K022504.16ON15349992e-04
KNAG0J028804.16ON15349992e-04
Ecym_84084.16ON15349992e-04
Suva_10.34singletonON15149992e-04
KNAG0C065805.701ON14949983e-04
NCAS0B035208.311ON7752943e-04
Ecym_41818.386ON15249984e-04
ZYRO0C04026g8.386ON15249984e-04
KLTH0F08734g8.386ON15049974e-04
SAKL0H13926g8.386ON15449974e-04
Kwal_23.33118.386ON15049975e-04
KLLA0D18304g8.386ON15049975e-04
TBLA0G006704.16ON22949995e-04
NDAI0D049304.16ON22949995e-04
KAFR0I014704.16ON22949995e-04
NDAI0G022808.386ON15249975e-04
SAKL0H15818g8.311ON7748925e-04
KLTH0E05852g4.16ON409491015e-04
Kwal_55.206074.16ON23149995e-04
TPHA0C023908.386ON15049966e-04
YLR167W (RPS31)8.386ON15249966e-04
Suva_10.33singletonON25449996e-04
KAFR0H020008.386ON15249966e-04
NCAS0C029408.386ON15249967e-04
TDEL0F051008.386ON15049967e-04
SAKL0H25784g4.16ON30549997e-04
AGL128W8.386ON15249967e-04
CAGL0G08173g8.386ON15249958e-04
Suva_10.2668.386ON15249958e-04
Skud_12.2348.386ON15249958e-04
Smik_12.2298.386ON15249958e-04
Kpol_1030.58.386ON15249958e-04
Kpol_1024.168.386ON15249958e-04
NDAI0B01850singletonON40344998e-04
Suva_10.304.16ON38149998e-04
NDAI0F003005.701ON18749969e-04
KNAG0A027308.386ON15049959e-04
Skud_12.294.16ON38149999e-04
YLL039C (UBI4)4.16ON38149999e-04
ACL062C4.16ON38249990.001
KLLA0E00749g4.16ON38149990.001
SAKL0D11814g1.480ON40047990.001
NCAS0C058504.16ON38849990.001
ZYRO0G07854g4.16ON46049990.001
Kpol_1070.64.16ON53349990.001
Smik_12.184.16ON46049990.001
CAGL0D05082g4.16ON53349990.001
TBLA0H031808.386ON15249940.001
KLLA0F17974g8.311ON7749880.002
NCAS0B045908.142ON44742960.002
YDR139C (RUB1)8.311ON7748860.003
Smik_7.918.142ON39938940.004
TDEL0B046908.142ON44238930.005
TBLA0D022108.142ON56338930.007
Suva_7.818.142ON40138920.007
YGL181W (GTS1)8.142ON39638910.010
KLTH0C03410g1.480ON39147900.012
KLTH0G12540g8.311ON7774810.016
ZYRO0D08140g6.343ON7350790.030
CAGL0L06028g8.142ON50538860.036
Ecym_35721.480ON44346860.044
AFR358W1.480ON41346850.044
Kwal_27.101521.480ON38147850.052
NCAS0G041201.480ON39226840.062
SAKL0H24772g8.142ON41443830.095
KLTH0A06820g6.343ON7345730.20
NCAS0C040908.142ON39648800.22
NCAS0A053906.343ON7351720.22
KAFR0E005301.480ON37950800.22
NDAI0G003301.480ON42726790.27
Skud_7.908.142ON39638780.31
TDEL0C025901.480ON36826780.36
KLLA0C08470g6.343ON7451710.40
ZYRO0F05192g1.480ON38426770.42
Skud_5.531.480ON39726770.43
Suva_5.321.480ON40946770.44
Smik_5.561.480ON39726770.48
YEL037C (RAD23)1.480ON39826770.50
Smik_14.3626.343ON7351700.54
Kpol_541.508.142ON51138760.59
Suva_14.3876.343ON7351690.61
Skud_14.3646.343ON7351690.61
KLLA0E22133g1.480ON38348760.67
TPHA0H004008.142ON46638760.68
TPHA0O004401.480ON36950741.1
CAGL0L01309g1.480ON39226731.3
KNAG0G005101.480ON37568721.6
KNAG0D003706.343ON7350652.6
Ecym_25016.343ON7348642.9
SAKL0A01210g6.343ON7350643.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00290
         (367 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON...   322   e-108
TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837...   237   1e-74
Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276...   234   1e-73
Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276...   231   1e-72
YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}  DSK2Nucle...   229   8e-72
Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276...   228   2e-71
TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {O...   224   6e-70
Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {O...   222   8e-69
KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.8...   219   8e-68
TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {O...   217   6e-67
Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {...   216   3e-66
ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic ho...   214   3e-66
KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} simila...   213   2e-65
CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highl...   213   2e-65
ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} simi...   213   2e-65
NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {O...   213   4e-65
KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {...   211   2e-64
SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {...   210   3e-64
NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}...   209   9e-64
Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar...   208   3e-63
Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [23...    47   1e-06
ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa...    45   7e-06
TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234 ...    45   1e-05
CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa...    45   1e-05
TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16 ...    43   4e-05
NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON} A...    43   6e-05
Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON} Y...    42   6e-05
Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C (REAL)     44   7e-05
Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa] {O...    44   7e-05
Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C (REAL)     44   7e-05
Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128...    44   8e-05
KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa...    44   8e-05
KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa] {O...    44   8e-05
Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387...    44   8e-05
Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387...    44   8e-05
YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}  ...    44   8e-05
YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,...    44   8e-05
Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa] {...    44   8e-05
KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128 a...    44   8e-05
ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128 a...    44   8e-05
SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212) ...    44   9e-05
KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa] {...    44   9e-05
TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa] {O...    44   9e-05
TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083) [...    44   9e-05
TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387 ...    44   9e-05
CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387...    44   9e-05
NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634) [...    44   9e-05
NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa...    44   9e-05
NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa] {O...    44   9e-05
TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa...    44   1e-04
TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]...    42   1e-04
Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}...    43   1e-04
AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp, ...    43   1e-04
KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387...    43   1e-04
Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W (REAL)     44   1e-04
TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.83...    45   1e-04
KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.1...    45   2e-04
NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa...    41   2e-04
TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.1...    43   2e-04
KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.1...    43   2e-04
Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to...    43   2e-04
Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON} ...    43   2e-04
KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304) [...    42   3e-04
NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234 ...    41   3e-04
Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON} ...    42   4e-04
ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar...    42   4e-04
KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa] {O...    42   4e-04
SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa] ...    42   4e-04
Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON...    42   5e-04
KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON} simil...    42   5e-04
TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16...    43   5e-04
NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON}              43   5e-04
KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.70...    43   5e-04
NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON...    42   5e-04
SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 7...    40   5e-04
KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {...    44   5e-04
Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa] {O...    43   5e-04
TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON...    42   6e-04
YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusio...    42   6e-04
Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON} ...    43   6e-04
KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON...    42   6e-04
NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON...    42   7e-04
TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.38...    42   7e-04
SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highl...    43   7e-04
AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic hom...    42   7e-04
CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly ...    41   8e-04
Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W...    41   8e-04
Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W...    41   8e-04
Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W...    41   8e-04
Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}...    41   8e-04
Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON...    41   8e-04
NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {O...    43   8e-04
Suva_10.30 Chr10 complement(67747..67841,68061..68288,68558..690...    43   8e-04
NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701        42   9e-04
KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON...    41   9e-04
Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,...    43   9e-04
YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}  U...    43   9e-04
ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON} S...    43   0.001
KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON...    43   0.001
SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} simila...    43   0.001
NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON}             43   0.001
ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa] {...    43   0.001
Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON...    43   0.001
Smik_12.18 Chr12 complement(49088..49552,49091..49552,49091..495...    43   0.001
CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} simila...    43   0.001
TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.38...    41   0.001
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    39   0.002
NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {O...    42   0.002
YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp, ...    38   0.003
Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]...    41   0.004
TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.1...    40   0.005
TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.1...    40   0.007
Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]...    40   0.007
YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protei...    40   0.010
KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa] {...    39   0.012
KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 7...    36   0.016
ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar ...    35   0.030
CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa] ...    38   0.036
Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa] {O...    38   0.044
AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic ...    37   0.044
Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa] {...    37   0.052
NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON} Anc_1.4...    37   0.062
SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]...    37   0.095
KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON...    33   0.20 
NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142     35   0.22 
NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa] {O...    32   0.22 
KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa] {O...    35   0.22 
NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}...    35   0.27 
Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W (...    35   0.31 
TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa] {O...    35   0.36 
KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly s...    32   0.40 
ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} simila...    34   0.42 
Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON} Y...    34   0.43 
Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON} Y...    34   0.44 
Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON} Y...    34   0.48 
YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}  RA...    34   0.50 
Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON...    32   0.54 
Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {O...    34   0.59 
Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON...    31   0.61 
Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON...    31   0.61 
KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]...    34   0.67 
TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142...    34   0.68 
TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.48...    33   1.1  
CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa] ...    33   1.3  
KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}...    32   1.6  
KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343 Y...    30   2.6  
Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON} s...    29   2.9  
SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar ...    29   3.0  

>KNAG0J00290 Chr10 complement(44234..45337) [1104 bp, 367 aa] {ON}
           Anc_8.837 YMR276W
          Length = 367

 Score =  322 bits (825), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 170/221 (76%), Positives = 170/221 (76%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL
Sbjct: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           EEYKITDGHTVHLVK                                    QQPGFNPLA
Sbjct: 61  EEYKITDGHTVHLVKSGGAKSAGSSSSSSEATTAAGTAGTAPAAGASMAAGQQPGFNPLA 120

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGYNLPMPSADMF               QSQEEILSMLENPIFQSQMNEMFSN
Sbjct: 121 DLTSARYAGYNLPMPSADMFGPDGGLTSGGGPGGPQSQEEILSMLENPIFQSQMNEMFSN 180

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR
Sbjct: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221

 Score =  147 bits (370), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 72/72 (100%), Positives = 72/72 (100%)

Query: 296 DAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSL 355
           DAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSL
Sbjct: 296 DAAAFMQAMSRNGATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSL 355

Query: 356 QGALDALLNGDV 367
           QGALDALLNGDV
Sbjct: 356 QGALDALLNGDV 367

>TPHA0I00220 Chr9 (39858..40991) [1134 bp, 377 aa] {ON} Anc_8.837
           YMR276W
          Length = 377

 Score =  237 bits (604), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 147/222 (66%), Gaps = 10/222 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M I+V +K GQN+WDVAV  EP   T+ +FKE+++  + +P  NQRLIYSGKILKDA+T+
Sbjct: 1   MSISVQIKSGQNKWDVAV--EP-SNTILEFKEIISKASDIPAGNQRLIYSGKILKDAETV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXQQPGFNPL 119
           E YKI DGH++HLVK                                     Q  GFNPL
Sbjct: 58  ESYKIQDGHSIHLVKSGDASANAAKSSTAAAATANAAAGSAESAVPTNITSGQTNGFNPL 117

Query: 120 ADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFS 179
           ADLTSARYAGYNLPMPSADMF                +Q+++LSMLENP+FQSQMNEM S
Sbjct: 118 ADLTSARYAGYNLPMPSADMFGPDGGMTNMP------NQDDMLSMLENPVFQSQMNEMLS 171

Query: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           NPQMV+++I SNPQLQA+GPQAREM QSP FRQMLTNPDM+R
Sbjct: 172 NPQMVEYMINSNPQLQALGPQAREMFQSPFFRQMLTNPDMIR 213

 Score = 93.2 bits (230), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 48/53 (90%)

Query: 315 APQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           A +DTRPPE RYE QLRQLNDMGF +FDRN+AALRR+GGS+QGALDALLN DV
Sbjct: 325 AQEDTRPPEVRYESQLRQLNDMGFFEFDRNIAALRRSGGSVQGALDALLNNDV 377

>Smik_13.489 Chr13 (801868..802986) [1119 bp, 372 aa] {ON} YMR276W
           (REAL)
          Length = 372

 Score =  234 bits (598), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 125/221 (56%), Positives = 146/221 (66%), Gaps = 10/221 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M + + +K GQ++W+V+VA E   +TV+QFKE ++   GVPV NQRLIYSGKILKD QT+
Sbjct: 1   MSLNIHIKSGQDKWEVSVAPE---STVSQFKEAISKANGVPVANQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E Y I DGH+VHLVK                                    Q  GFNPLA
Sbjct: 58  ESYHIQDGHSVHLVKSQPKPQPGAAAGTNNATATGAAAGTVATPNMSSG--QSAGFNPLA 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY L MPSADMF                +Q+E+L M+ENPIFQSQMNEM SN
Sbjct: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDS----NNQDELLRMMENPIFQSQMNEMLSN 170

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNPDM+R
Sbjct: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 211

 Score =  106 bits (264), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 55/59 (93%)

Query: 309 ATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           A+A A+ P+DTRPPEERYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 314 ASAQASQPEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 372

>Suva_13.464 Chr13 (801516..802616) [1101 bp, 366 aa] {ON} YMR276W
           (REAL)
          Length = 366

 Score =  231 bits (590), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 125/221 (56%), Positives = 145/221 (65%), Gaps = 9/221 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M + V VK GQ++W+V+VA E   +TV QFKE ++   G+PV NQRLIYSGKILKD QT+
Sbjct: 1   MSLNVYVKSGQDKWEVSVAPE---STVLQFKEAISEANGIPVANQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E Y I DGH+VHLVK                                    Q  GFNPLA
Sbjct: 58  ESYHIQDGHSVHLVKSQPRPQAGAATGAGGDAGASATNASVSATPNMSSG-QSAGFNPLA 116

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY L MPSADMF                +Q+E+L M++NPIFQSQMNEM SN
Sbjct: 117 DLTSARYAGY-LNMPSADMFGPDGGALNNDS----NNQDELLRMMDNPIFQSQMNEMLSN 171

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNPDM+R
Sbjct: 172 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 212

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 46/51 (90%), Positives = 50/51 (98%)

Query: 317 QDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           +DTRPPEERYEQQLRQLNDMGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 316 EDTRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 366

>YMR276W Chr13 (818827..819948) [1122 bp, 373 aa] {ON}
           DSK2Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein, required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle, involved in proteolysis,
           interacts with the proteasome
          Length = 373

 Score =  229 bits (585), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 143/221 (64%), Gaps = 10/221 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M + + +K GQ++W+V VA E   +TV QFKE +    G+PV NQRLIYSGKILKD QT+
Sbjct: 1   MSLNIHIKSGQDKWEVNVAPE---STVLQFKEAINKANGIPVANQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E Y I DGH+VHLVK                                    Q  GFNPLA
Sbjct: 58  ESYHIQDGHSVHLVKSQPKPQTASAAGANNATATGAAAGTGATPNMSSG--QSAGFNPLA 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY L MPSADMF                +Q+E+L M+ENPIFQSQMNEM SN
Sbjct: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDS----NNQDELLRMMENPIFQSQMNEMLSN 170

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNPDM+R
Sbjct: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPDMIR 211

 Score =  100 bits (248), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 46/55 (83%), Positives = 51/55 (92%)

Query: 313 AAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           A+  +DTRPPEERYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 319 ASQAEDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 373

>Skud_13.448 Chr13 (792186..793277) [1092 bp, 364 aa] {ON} YMR276W
           (REAL)
          Length = 364

 Score =  228 bits (582), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 143/221 (64%), Gaps = 10/221 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M + + +K GQ++W+VAVA E    TV QFKE ++    +PV NQRLIYSGKILKD QT+
Sbjct: 1   MSLNIHIKSGQDKWEVAVAPE---CTVLQFKEAISKANSIPVANQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           + Y I DGH+VHLVK                                    Q  GFNPLA
Sbjct: 58  DSYHIQDGHSVHLVKSQPKPDAGGATGANNATATSAAVGTSATPNMSSG--QSAGFNPLA 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY L MPSADMF                +Q+E+L M+ENPIFQSQMNEM SN
Sbjct: 116 DLTSARYAGY-LNMPSADMFGPDGGALNNDS----NNQDELLRMMENPIFQSQMNEMLSN 170

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQMLTNP+M+R
Sbjct: 171 PQMLDFMIQSNPQLQAMGPQARQMLQSPMFRQMLTNPEMMR 211

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 55/59 (93%)

Query: 309 ATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           A+A A+ P+D+RPPEERYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 306 ASAQASQPEDSRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 364

>TDEL0B00600 Chr2 complement(115615..116724) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  224 bits (572), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 141/221 (63%), Gaps = 10/221 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M ITV VK GQ++W+V+V  E    TVA+FK+ +A V+ +P  NQRLIYSGKILKD Q +
Sbjct: 1   MSITVQVKCGQSKWEVSVNPE---KTVAEFKDEIAKVSEIPAANQRLIYSGKILKDDQNV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E YKI DGH +HLVK                                    Q  GFNPL+
Sbjct: 58  ESYKIQDGHAIHLVKSGGGGGNTAAKASTSSQESNTAAPGSATVPSNIASGQTGGFNPLS 117

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAG+   +PSADMF                +Q+++L MLENPIFQSQMNEM SN
Sbjct: 118 DLTSARYAGFT-NLPSADMFGPDGGLTNMP------NQDDMLGMLENPIFQSQMNEMLSN 170

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQMVDF+IQSNPQLQAMGPQAR++LQSP FRQMLTNP M+R
Sbjct: 171 PQMVDFMIQSNPQLQAMGPQARQLLQSPFFRQMLTNPQMLR 211

 Score =  100 bits (248), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (86%)

Query: 308 GATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           G  A   A QD RPPEERYEQQLRQLNDMGF DF++NVAALRR+GGS+QGALD+LLNGDV
Sbjct: 310 GGAAQQRAEQDNRPPEERYEQQLRQLNDMGFFDFEKNVAALRRSGGSVQGALDSLLNGDV 369

>Kpol_1068.11 s1068 complement(21199..22344) [1146 bp, 381 aa] {ON}
           complement(21199..22344) [1146 nt, 382 aa]
          Length = 381

 Score =  222 bits (566), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 118/222 (53%), Positives = 140/222 (63%), Gaps = 10/222 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           MGI + +K GQN+W+V V       TV Q KE +A V+ +PVENQRLIYSGKILKD Q L
Sbjct: 1   MGIKIHIKSGQNKWEVTVDVS---NTVLQLKEEIAKVSEIPVENQRLIYSGKILKDDQVL 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXQQPGFNPL 119
           E YKI D H++HLVK                                     Q  GFNPL
Sbjct: 58  EFYKIQDEHSIHLVKSGGASKTNTSASAAAASTSTATNSDSNAPLPSNIAAGQSGGFNPL 117

Query: 120 ADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFS 179
           +DLTSARYAGY L +PSADMF                +Q+++L MLENP+FQSQMNEM S
Sbjct: 118 SDLTSARYAGYGLNLPSADMFGPDGGMNSMP------NQDDMLRMLENPVFQSQMNEMLS 171

Query: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           NPQM+DF+IQSNPQLQAMGP+AR+M QSP FRQMLTNP+M+R
Sbjct: 172 NPQMIDFMIQSNPQLQAMGPEARQMFQSPFFRQMLTNPEMIR 213

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 46/50 (92%)

Query: 318 DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           D RPPEERYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALDALL+ DV
Sbjct: 332 DNRPPEERYESQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLSNDV 381

>KAFR0B03900 Chr2 (810391..811530) [1140 bp, 379 aa] {ON} Anc_8.837
           YMR276W
          Length = 379

 Score =  219 bits (559), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 139/222 (62%), Gaps = 11/222 (4%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M IT+ +K GQN+WDV         ++A  KE ++ ++ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MSITIHIKSGQNKWDVNTNLS---DSIATLKEEISKISEIPATNQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXQQPGFNPL 119
           E YKI +GH++HLVK                                     Q  GFNPL
Sbjct: 58  ESYKIEEGHSIHLVKSGGNVARNSAATNTTPTATSNENTNSAPSVPSNIASGQTGGFNPL 117

Query: 120 ADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFS 179
            DLTSARYAGY L MPSADMF                SQ+++L ML+NP+FQSQMNEM S
Sbjct: 118 NDLTSARYAGY-LNMPSADMFGPDGGLNSGP------SQDDMLRMLDNPVFQSQMNEMLS 170

Query: 180 NPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           NPQM+DF+IQSNPQLQAMGPQAR+MLQSPMFRQML NPDM+R
Sbjct: 171 NPQMIDFMIQSNPQLQAMGPQARQMLQSPMFRQMLINPDMIR 212

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/53 (88%), Positives = 49/53 (92%)

Query: 315 APQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           A QD RPPEERYE QLRQLNDMGF DFDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 327 AQQDNRPPEERYEAQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 379

>TBLA0D03230 Chr4 complement(796939..798066) [1128 bp, 375 aa] {ON}
           Anc_8.837 YMR276W
          Length = 375

 Score =  217 bits (553), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 139/221 (62%), Gaps = 12/221 (5%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M I+V +K GQN WDV + +    +T+  FK+ +A V+ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MTISVHIKSGQNTWDVEIEAS---STIKDFKDKIAIVSEIPAPNQRLIYSGKILKDDQTI 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E YKI DGH++H+VK                                       GFNPL+
Sbjct: 58  ESYKIQDGHSIHMVKSGAHATASSTTNSMTTTNTTAPQNNNGSSGMSTGRGS--GFNPLS 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY   +PSADMF               QSQ+++L MLENP+FQSQMNEM SN
Sbjct: 116 DLTSARYAGY-TNLPSADMFGPDGGSFAS------QSQDDMLHMLENPVFQSQMNEMLSN 168

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           P++VDFLI SNPQLQ++GPQAR M QSPMFRQMLTNPDM+R
Sbjct: 169 PEIVDFLINSNPQLQSLGPQARTMFQSPMFRQMLTNPDMIR 209

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 46/49 (93%)

Query: 316 PQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLN 364
           P+D RPPEERYE QLRQLNDMGF DFD+NVAALRR+GGS+QGA++ALL+
Sbjct: 325 PEDNRPPEERYEHQLRQLNDMGFFDFDKNVAALRRSGGSVQGAVNALLS 373

>Kwal_27.10275 s27 complement(273277..274416) [1140 bp, 379 aa] {ON}
           YMR276W (DSK2) - ubiquitin-like protein [contig 37] FULL
          Length = 379

 Score =  216 bits (549), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 117/223 (52%), Positives = 140/223 (62%), Gaps = 12/223 (5%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M ITV VK GQ++WDV+V ++   +TVAQFK  +A  + +  ENQRLIYSGKILKD QTL
Sbjct: 1   MSITVHVKSGQSKWDVSVDAD---STVAQFKTAIAETSQIAPENQRLIYSGKILKDDQTL 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXX--XXXXXXXXXXXXXXXXXXXXXXXXQQPGFNP 118
           E YKI DGH VHLVK                                      Q  GFNP
Sbjct: 58  ESYKILDGHAVHLVKSGTKSGSGAIGAPGSGSTAPTNTASSGAAAAPASLSSGQAGGFNP 117

Query: 119 LADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMF 178
           L+DLTSARYAGY L +PSAD F                + +++L MLENP+ QSQMNEM 
Sbjct: 118 LSDLTSARYAGY-LNLPSADSFGPDGGMTSAP------NSDDMLRMLENPVMQSQMNEML 170

Query: 179 SNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           SNPQM+DFLIQ +PQLQ+MGPQAR+MLQSP FRQM+TNP+M+R
Sbjct: 171 SNPQMIDFLIQQSPQLQSMGPQARQMLQSPFFRQMMTNPEMIR 213

 Score =  105 bits (261), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 48/52 (92%), Positives = 51/52 (98%)

Query: 316 PQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           PQDTRPPEERYEQQLRQLNDMGF +FDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 328 PQDTRPPEERYEQQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 379

>ABL129W Chr2 (153723..154760) [1038 bp, 345 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR276W (DSK2)
          Length = 345

 Score =  214 bits (546), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 116/221 (52%), Positives = 135/221 (61%), Gaps = 12/221 (5%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M I + VK GQNRW+V+V +     +V + K+ +A V+ +P ENQRLIYSGKILKD QT+
Sbjct: 1   MTIKIQVKSGQNRWEVSVEAS---GSVGELKQEIAKVSEIPAENQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E YKI DGH +HLVK                                    Q  GFNPLA
Sbjct: 58  ESYKIADGHAIHLVKSGGAKAAPAASAAGGESTGAAAGAGAVPSSISAG--QSGGFNPLA 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLT ARYAGY   +PS DMF                 QEEI+ MLENPIFQSQMNEM +N
Sbjct: 116 DLTGARYAGYT-NLPSTDMFGPDGGLNSAV------GQEEIIGMLENPIFQSQMNEMLNN 168

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DFLIQ +P LQAMGP AREMLQSP FRQMLTNPD++R
Sbjct: 169 PQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMLTNPDIIR 209

 Score =  100 bits (249), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 47/50 (94%), Positives = 48/50 (96%)

Query: 318 DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           D RPPEERYEQQLRQLNDMGF DFDRNVAALRRAGGS+QGALDALLNGDV
Sbjct: 296 DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRAGGSVQGALDALLNGDV 345

>KLLA0D01859g Chr4 (161628..162743) [1116 bp, 371 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 371

 Score =  213 bits (543), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 115/219 (52%), Positives = 135/219 (61%), Gaps = 10/219 (4%)

Query: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62
           I+V VK GQN W V + S     T+  FKE ++GV+GVP +NQRLIYSGKILKD +T+E 
Sbjct: 4   ISVHVKSGQNNWTVEIESA---ATIRAFKETISGVSGVPADNQRLIYSGKILKDTETVES 60

Query: 63  YKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLADL 122
           YKI DGH+VH+VK                                    Q  GFNPLADL
Sbjct: 61  YKIQDGHSVHMVKSGGASAATTGSTTTGSAASPAATNSAAPSNISAG--QTGGFNPLADL 118

Query: 123 TSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSNPQ 182
           T ARYAG    +PSADMF                + E +L MLENPIFQSQMNEM SNPQ
Sbjct: 119 TGARYAGL-ANLPSADMFGPDGGLNSSNGA----NPESMLQMLENPIFQSQMNEMLSNPQ 173

Query: 183 MVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           MVDFLIQ NPQLQA+GP+AR+MLQSP FRQM+T+P M+R
Sbjct: 174 MVDFLIQQNPQLQALGPRARDMLQSPFFRQMMTDPQMIR 212

 Score =  101 bits (251), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/69 (73%), Positives = 55/69 (79%), Gaps = 1/69 (1%)

Query: 300 FMQAMSRNGATAPAAAPQ-DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGA 358
            + +M    + A  AAP  D RPPEERYE QLRQLNDMGF DFDRNVAALRRAGGS+QGA
Sbjct: 303 LLASMFGGNSNATGAAPAVDNRPPEERYESQLRQLNDMGFFDFDRNVAALRRAGGSVQGA 362

Query: 359 LDALLNGDV 367
           LDALLNGDV
Sbjct: 363 LDALLNGDV 371

>CAGL0M02937g Chr13 (331097..332218) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276w DSK2
          Length = 373

 Score =  213 bits (543), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 114/221 (51%), Positives = 137/221 (61%), Gaps = 14/221 (6%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M IT+ +K GQN+WDV++  +P +T +   KE +A V+ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MSITIHIKSGQNKWDVSI--DPSQT-ILNLKEEIAKVSEIPSGNQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E Y I D H +H+VK                                    Q  GFNPLA
Sbjct: 58  ESYNIKDDHAIHMVKSGGNASTSNAPTNANESSNSSTTAVPSNIASG----QTGGFNPLA 113

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLT ARYAGY   +PSADMF                 Q+E+L M+ENPIFQSQMNEM SN
Sbjct: 114 DLTGARYAGY-ANLPSADMFGPDGGINNAP------DQDEMLRMMENPIFQSQMNEMLSN 166

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           P+M+DF+IQSNPQLQAMGPQAR+MLQSP FRQMLTNP M+R
Sbjct: 167 PEMLDFMIQSNPQLQAMGPQARQMLQSPFFRQMLTNPAMIR 207

 Score =  105 bits (262), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%)

Query: 308 GATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           G   PA A +D RPPEERYEQQLRQLNDMGF DFDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 314 GGQLPAPAQEDNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 373

>ZYRO0G14124g Chr7 (1125418..1126527) [1110 bp, 369 aa] {ON} similar
           to uniprot|P48510 Saccharomyces cerevisiae YMR276W DSK2
           Nuclear-enriched ubiquitin-like polyubiquitin- binding
           protein required for spindle pole body (SPB) duplication
           and for transit through the G2/M phase of the cell cycle
           involved in proteolysis interacts with the proteasome
          Length = 369

 Score =  213 bits (541), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/231 (51%), Positives = 142/231 (61%), Gaps = 22/231 (9%)

Query: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62
           ITV +K GQN+W+V V  +P E+TV+ FKE ++ V+ +P  +QRLIYSGKILKD QTL+ 
Sbjct: 4   ITVQIKSGQNKWEVTV--DP-ESTVSTFKEEISKVSEIPASSQRLIYSGKILKDDQTLQF 60

Query: 63  YKITDGHTVHLVKXXXXXXXXXXXXXXXXX------------XXXXXXXXXXXXXXXXXX 110
           Y + DGH+VHLVK                                               
Sbjct: 61  YNLQDGHSVHLVKSSKAPGNASGGSSSTAAATAGSGASAVPPSGNASTTPTTGAPSNLSA 120

Query: 111 XQQPGFNPLADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIF 170
            Q  GFNPLADLTSARYAG+   +PSADMF                +QE++L+ML+NPIF
Sbjct: 121 GQSGGFNPLADLTSARYAGFT-SLPSADMFGPDGGATNMP------NQEDLLNMLDNPIF 173

Query: 171 QSQMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           QSQMNEM SNPQMVDF+IQSNPQLQAMGPQAR+M QSP FRQMLTNP M+R
Sbjct: 174 QSQMNEMLSNPQMVDFMIQSNPQLQAMGPQARQMFQSPFFRQMLTNPQMIR 224

 Score =  100 bits (248), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 52/60 (86%)

Query: 308 GATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           GA +    PQD RPPEERYE QLRQLN+MGF DFDRNVAALRR+GGS+QGALD+LLNGDV
Sbjct: 310 GAPSQQQQPQDNRPPEERYETQLRQLNEMGFFDFDRNVAALRRSGGSVQGALDSLLNGDV 369

>NDAI0K00440 Chr11 complement(99224..100438) [1215 bp, 404 aa] {ON}
           Anc_8.837 YMR276W
          Length = 404

 Score =  213 bits (543), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 136/219 (62%), Gaps = 14/219 (6%)

Query: 3   ITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEE 62
           I++ +K GQN W V++ +     ++A  K+ +A V+ +P  NQRLIYSGKILKD Q ++ 
Sbjct: 4   ISIHIKSGQNNWQVSIDTT---ASIATLKDEIAKVSEIPATNQRLIYSGKILKDDQNVDF 60

Query: 63  YKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLADL 122
           Y I DGH+VHLV+                                    Q  GFNPLADL
Sbjct: 61  YNIQDGHSVHLVRSGKKSTPTPATTNTTTNASNNTVPSNISAG------QTGGFNPLADL 114

Query: 123 TSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSNPQ 182
           TSARYAGYNL +PSAD F                + +E LSML+NPI QSQMNEM SNPQ
Sbjct: 115 TSARYAGYNLNLPSADAFGPDGGMNQSGT-----NPDEFLSMLDNPIVQSQMNEMLSNPQ 169

Query: 183 MVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           M+DF+IQSNPQLQAMGPQAR+M QSPMFRQMLTNPDM+R
Sbjct: 170 MIDFMIQSNPQLQAMGPQARQMFQSPMFRQMLTNPDMIR 208

 Score = 99.4 bits (246), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/62 (75%), Positives = 53/62 (85%), Gaps = 2/62 (3%)

Query: 308 GATAPAAAPQ--DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNG 365
           GA AP+  PQ  DTRPPEERYE QLRQLNDMGF DFDRN+AALRR GGS++ A++ALLNG
Sbjct: 343 GAGAPSTTPQQQDTRPPEERYETQLRQLNDMGFFDFDRNIAALRRTGGSVEAAVNALLNG 402

Query: 366 DV 367
           DV
Sbjct: 403 DV 404

>KLTH0C03938g Chr3 complement(344354..345484) [1131 bp, 376 aa] {ON}
           some similarities with uniprot|P48510 Saccharomyces
           cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin-binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 376

 Score =  211 bits (536), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/229 (49%), Positives = 139/229 (60%), Gaps = 18/229 (7%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M ITV +K GQN+WDVA+  +P  +T+AQFK  +A  + +  ENQRLIYSGKILKD QT+
Sbjct: 1   MSITVHIKSGQNKWDVAI--DP-SSTIAQFKSAIAAQSEIAPENQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXX--------XXXXXXXXXQ 112
           E YKI D H+VHLVK                                            Q
Sbjct: 58  ESYKILDDHSVHLVKSGGSKKATSPGATAAASGDATATGATSTPAAQPQQSAPANLSTGQ 117

Query: 113 QPGFNPLADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQS 172
             GFNPL+DLTSARYAG+ L +PSAD F                + +++L MLENP+ QS
Sbjct: 118 GNGFNPLSDLTSARYAGF-LNLPSADSFGPDGGMTSAP------NSDDVLRMLENPVMQS 170

Query: 173 QMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           QMNEM SNPQM+DFLIQ +PQLQ+MGPQAR +LQSP FRQM+TNPDM+R
Sbjct: 171 QMNEMLSNPQMIDFLIQQSPQLQSMGPQARTLLQSPFFRQMMTNPDMIR 219

 Score =  104 bits (260), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%)

Query: 308 GATAPAAAPQDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           GA A    PQDTRPPEERYE QLRQLNDMGF +FDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 317 GAGAANQQPQDTRPPEERYEHQLRQLNDMGFFEFDRNVAALRRSGGSVQGALDALLNGDV 376

>SAKL0D01540g Chr4 complement(124423..125520) [1098 bp, 365 aa] {ON}
           similar to uniprot|P48510 Saccharomyces cerevisiae
           YMR276W DSK2 Nuclear-enriched ubiquitin-like
           polyubiquitin- binding protein required for spindle pole
           body (SPB) duplication and for transit through the G2/M
           phase of the cell cycle involved in proteolysis
           interacts with the proteasome
          Length = 365

 Score =  210 bits (534), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 115/221 (52%), Positives = 137/221 (61%), Gaps = 12/221 (5%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M IT+ +K GQN+WDV++  EP   TV + KE ++ V+ +P  NQRLIYSGKILKD QT+
Sbjct: 1   MSITLHIKSGQNKWDVSI--EP-TNTVIELKEAISKVSEIPPANQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E YKI D H VHLV+                                    Q  GFNPLA
Sbjct: 58  ESYKIADDHAVHLVRSGGPKPAASKSESTSATDTGAAAAAAVPSNISSG--QTGGFNPLA 115

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLT ARYAGY   +PSADMF                + +EIL+ML+NPI QSQMNEM SN
Sbjct: 116 DLTGARYAGY-ANLPSADMFGPDGGLTNAP------NSDEILNMLDNPIVQSQMNEMLSN 168

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQMVDF+IQ NPQLQAMGP+ARE+LQS  FRQM+TNPDM+R
Sbjct: 169 PQMVDFMIQQNPQLQAMGPRARELLQSDYFRQMMTNPDMIR 209

 Score =  100 bits (248), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 46/50 (92%), Positives = 48/50 (96%)

Query: 318 DTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           D RPPEERYEQQLRQLNDMGF DFDRNVAALRR+GGS+QGALDALLNGDV
Sbjct: 316 DNRPPEERYEQQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDALLNGDV 365

>NCAS0C00430 Chr3 complement(67718..68827) [1110 bp, 369 aa] {ON}
           Anc_8.837 YMR276W
          Length = 369

 Score =  209 bits (531), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 142/221 (64%), Gaps = 15/221 (6%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M I++ VK GQN W V++  +P  +T+ Q KE +A V+ VP  NQRLI+SGKILKD QT+
Sbjct: 1   MSISIHVKSGQNNWQVSI--DPA-STILQLKEEIAKVSEVPATNQRLIFSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQPGFNPLA 120
           E YKI DG ++H+VK                                    +  GFNPL+
Sbjct: 58  EFYKILDGLSIHMVKSGGGSANKNKSPPPQANTTATPVAPNMAAG------ETGGFNPLS 111

Query: 121 DLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQSQMNEMFSN 180
           DLTSARYAGY L +PSAD F                +Q+E+L ML+NP+FQSQMNEM SN
Sbjct: 112 DLTSARYAGY-LNLPSADTFGPDGGLNNSGP-----NQDEMLRMLDNPVFQSQMNEMLSN 165

Query: 181 PQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           PQM+DF+IQ+NPQLQAMGPQAR++LQ+PMFRQMLTNPDM+R
Sbjct: 166 PQMLDFIIQANPQLQAMGPQARQILQNPMFRQMLTNPDMIR 206

 Score = 94.7 bits (234), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%)

Query: 317 QDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           +DTRPPEERYE QLRQLNDMGF DFDRNVAALRR+GG+++ AL+ALLNGDV
Sbjct: 319 EDTRPPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGNVESALNALLNGDV 369

>Ecym_4608 Chr4 (1185310..1186530) [1221 bp, 406 aa] {ON} similar to
           Ashbya gossypii ABL129W
          Length = 406

 Score =  208 bits (530), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 111/230 (48%), Positives = 137/230 (59%), Gaps = 19/230 (8%)

Query: 1   MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
           M I++ VK GQN+W V+  ++P  +++   K+ +A V+ +P ENQRLIYSGKILKD QT+
Sbjct: 1   MSISLHVKSGQNKWQVS--ADP-SSSIGTLKQRIAEVSHIPAENQRLIYSGKILKDDQTV 57

Query: 61  EEYKITDGHTVHLVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQP------ 114
           E YKI DGH++HLV+                                      P      
Sbjct: 58  ESYKIADGHSIHLVRSGGGKVSGSSGATGGASGSVEAVGSGGRNSTAGSGSTVPNNITAG 117

Query: 115 ---GFNPLADLTSARYAGYNLPMPSADMFXXXXXXXXXXXXXXXQSQEEILSMLENPIFQ 171
              GFNPLADLT ARYAGY   +PS DMF                 QEEIL ML+NPIFQ
Sbjct: 118 QMGGFNPLADLTGARYAGY-ANLPSTDMFGPDGGLNSAI------GQEEILGMLDNPIFQ 170

Query: 172 SQMNEMFSNPQMVDFLIQSNPQLQAMGPQAREMLQSPMFRQMLTNPDMVR 221
           SQ+NEM +NPQM+DFLIQ +P LQAMGP AREMLQSP FRQM+TNPD++R
Sbjct: 171 SQVNEMLANPQMIDFLIQQHPHLQAMGPAAREMLQSPFFRQMMTNPDVIR 220

 Score = 94.0 bits (232), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 48/51 (94%)

Query: 317 QDTRPPEERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           +D RPPEERY+QQL QLN+MGF DFDRNVAALRR+GGS+QGAL+ALLNGDV
Sbjct: 356 EDNRPPEERYQQQLEQLNEMGFVDFDRNVAALRRSGGSVQGALNALLNGDV 406

>Kpol_1036.62 s1036 complement(173662..173746,173844..173992) [234
          bp, 77 aa] {ON}
          complement(173662..173746,173844..173992) [234 nt, 78
          aa]
          Length = 77

 Score = 47.4 bits (111), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 31/52 (59%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          G   V   KEL+    G+P   QRLI+ GK + D QT++  K+TDG  +HLV
Sbjct: 19 GSDKVYHIKELLEEKEGIPPSQQRLIFQGKQIDDEQTVDSAKLTDGMQLHLV 70

>ZYRO0D05962g Chr4 (506710..506858,506936..507020) [234 bp, 77 aa]
          {ON} similar to uniprot|Q03919 Saccharomyces cerevisiae
          YDR139C RUB1 Ubiquitin-like protein with similarity to
          mammalian NEDD8
          Length = 77

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 31/52 (59%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          GE  + + KEL+    G+P   QRLI+ GK + D QT+   K+ DG  +HLV
Sbjct: 19 GEDPIYRIKELLEEKEGIPPSQQRLIFQGKQIDDQQTVSSAKLVDGMQLHLV 70

>TDEL0F04380 Chr6 complement(823866..823950,824011..824159) [234
          bp, 77 aa] {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 45.1 bits (105), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 31/51 (60%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          +  + + K+L+    G+P   QRLI+ GK + D QTLE  K+ DG  +HLV
Sbjct: 20 DAPIYRIKQLLEEKEGIPPSQQRLIFQGKQIDDRQTLEAAKLVDGMVLHLV 70

>CAGL0B01589g Chr2 (145132..145280,145404..145488) [234 bp, 77 aa]
          {ON} highly similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139c RUB1
          Length = 77

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (57%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          GE  V   KEL+    G+P   QRLI+ GK + +  T+   K++DG  +HLV
Sbjct: 19 GEDKVYHIKELLEEKEGIPASQQRLIFHGKQINNDDTISTAKLSDGMQLHLV 70

>TDEL0G01750 Chr7 (343412..343645) [234 bp, 77 aa] {ON} Anc_4.16
          YLL039C
          Length = 77

 Score = 43.1 bits (100), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0H00270 Chr8 complement(45883..46116) [234 bp, 77 aa] {ON}
          Anc_4.16
          Length = 77

 Score = 42.7 bits (99), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.32 Chr10 complement(68200..68385) [186 bp, 62 aa] {ON}
          YLL039C (REAL)
          Length = 62

 Score = 42.4 bits (98), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 8  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 56

>Skud_9.20 Chr9 (46249..46623) [375 bp, 125 aa] {ON} YKR094C
          (REAL)
          Length = 125

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 19 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_11.357 Chr11 complement(608082..608456) [375 bp, 125 aa]
          {ON} YKR094C (REAL)
          Length = 125

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 19 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 67

>Smik_9.21 Chr9 (46848..47219) [372 bp, 124 aa] {ON} YKR094C
          (REAL)
          Length = 124

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 18 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 66

>Kwal_YGOB_Anc_5.701 s55 (88799..88806,89169..89547) [387 bp, 128
          aa] {ON} ANNOTATED BY YGOB -
          Length = 128

 Score = 43.9 bits (102), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0D02230 Chr4 (449707..449714,450088..450466) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KAFR0H00220 Chr8 (32171..32178,32513..32891) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_11.330 Chr11 complement(602690..603068,603446..603453) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_11.333 Chr11 complement(599496..599874,600245..600252) [387
          bp, 128 aa] {ON} YKR094C (REAL)
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YIL148W Chr9 (68708..68715,69150..69528) [387 bp, 128 aa] {ON}
          RPL40AFusion protein, identical to Rpl40Bp, that is
          cleaved to yield ubiquitin and a ribosomal protein of
          the large (60S) ribosomal subunit with similarity to
          rat L40; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YKR094C Chr11 complement(617996..618374,618743..618750) [387 bp,
          128 aa] {ON}  RPL40BFusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1043.69 s1043 complement(145335..145721) [387 bp, 128 aa]
          {ON} complement(145335..145721) [387 nt, 129 aa]
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0E01078g Chr5 (105372..105379,105743..106121) [387 bp, 128
          aa] {ON} highly similar to uniprot|P61864 Saccharomyces
          cerevisiae YKR094c RPL40B and highly similar to
          uniprot|P61864 Saccharomyces cerevisiae YIL148w RPL40A
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0G06622g Chr7 (527968..527975,528043..528421) [387 bp, 128
          aa] {ON} highly similar to uniprot|P14796 Saccharomyces
          cerevisiae YKR094C RPL40B
          Length = 128

 Score = 43.5 bits (101), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0E14894g Chr5 complement(1235488..1235866,1236205..1236212)
          [387 bp, 128 aa] {ON} highly similar to uniprot|P61864
          Saccharomyces cerevisiae YLR167W RPS31 and highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YIL148W and highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094C and highly similar to
          uniprot|P04838 Saccharomyces cerevisiae YLL039C Fusion
          proteins that are cleaved to yield a ribosomal protein
          of the small (40S) subunit and ubiquitin
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0A00616g Chr1 (59180..59187,59727..60105) [387 bp, 128 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YKR094C RPL40B Fusion protein, identical to
          Rpl40Ap, that is cleaved to yield ubiquitin and a
          ribosomal protein of the large (60S) ribosomal subunit
          with similarity to rat L40; ubiquitin may facilitate
          assembly of the ribosomal protein into ribosomes
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0E00240 Chr5 (33468..33475,34104..34482) [387 bp, 128 aa]
          {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0D04600 Chr4 complement(1005511..1005889,1006076..1006083)
          [387 bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0E02110 Chr5 complement(516651..517029,517297..517304) [387
          bp, 128 aa] {ON} Anc_5.701 YIL148W
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G02475g Chr7 complement(220990..221368,222103..222110) [387
          bp, 128 aa] {ON} highly similar to uniprot|P04838
          Saccharomyces cerevisiae YKR094c UBI2 ubiquitin and
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YIL148w UBI1 ubiquitin
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0E05030 Chr5 complement(1148916..1149294,1149627..1149634)
          [387 bp, 128 aa] {ON} Anc_5.701
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0A03210 Chr1 (633779..633786,634077..634455) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0G00240 Chr7 (39394..39401,39701..40079) [387 bp, 128 aa]
          {ON} Anc_5.701
          Length = 128

 Score = 43.5 bits (101), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0B02200 Chr2 (395520..395527,395598..395976) [387 bp, 128 aa]
          {ON} 
          Length = 128

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TPHA0C00890 Chr3 (187882..188030,188103..188187) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 42.0 bits (97), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 29/52 (55%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          G   V   K+L+    G+P   QRLI+ GK + D QT+E   + DG  +HLV
Sbjct: 19 GSDKVFHIKDLLEEKEGIPPSQQRLIFQGKQIDDEQTVESANLIDGMQLHLV 70

>Ecym_4019 Chr4 (48709..48716,49112..49490) [387 bp, 128 aa] {ON}
          similar to Ashbya gossypii AFR285C 1-intron
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>AFR285C Chr6 complement(950588..950966,951128..951135) [387 bp,
          128 aa] {ON} Syntenic homolog of Saccharomyces
          cerevisiae YKR094C (RPL40B) and YIL148W (RPL40A);
          1-intron
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KNAG0L02120 Chr12 complement(379968..380346,380662..380669) [387
          bp, 128 aa] {ON} 
          Length = 128

 Score = 43.1 bits (100), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_9.40 Chr9 (63806..64240) [435 bp, 144 aa] {ON} YIL148W
          (REAL)
          Length = 144

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 9/70 (12%)

Query: 14 WDVAVASEPGET---------TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYK 64
          +D  V +  G+T         T+   K  +    G+P + QRLI++GK L+D +TL +Y 
Sbjct: 17 FDSFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 76

Query: 65 ITDGHTVHLV 74
          I    T+HLV
Sbjct: 77 IQKESTLHLV 86

>TBLA0B03240 Chr2 (756434..757288) [855 bp, 284 aa] {ON} Anc_8.837
          YMR276W
          Length = 284

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 33/57 (57%), Gaps = 7/57 (12%)

Query: 25 TTVAQFKELVAGVA-------GVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T  ++  EL++ +         +P  NQRLIYSG+IL   +TL++Y   DGH + ++
Sbjct: 14 TIESELDELISDITIKIKDHLDIPPNNQRLIYSGRILDPEKTLKDYNFKDGHCIIVI 70

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 37/59 (62%), Gaps = 3/59 (5%)

Query: 156 QSQEEILSMLENPIFQSQMNEMFSNPQ-MVDFLIQSNPQLQAMGPQ-AREMLQSPMFRQ 212
           + + E+L +L++P    Q NEM  N Q ++ FLIQ+NP L+ M    AR++L+ P  ++
Sbjct: 136 EVERELLQVLDHP-RSFQENEMLLNNQNLLRFLIQTNPHLRHMDINGARQVLRDPRLQR 193

>KAFR0C03000 Chr3 (597127..598320) [1194 bp, 397 aa] {ON} Anc_8.142
           YGL181W
          Length = 397

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 30/40 (75%)

Query: 323 EERYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           E  Y +Q+RQL +MGFSD ++N+ AL+++ G++  A+D L
Sbjct: 187 ESDYRRQVRQLKEMGFSDSEKNLKALKKSNGNMNRAIDVL 226

>NDAI0J01070 Chr10 (247102..247250,247366..247450) [234 bp, 77 aa]
          {ON} Anc_8.311 YDR139C
          Length = 77

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          G   V + KEL+    G+P   QRLI+ GK + D Q++    + DG  +HLV
Sbjct: 19 GNEPVYRIKELLEEKEGIPPSQQRLIFQGKQIDDEQSVSSANLVDGMQLHLV 70

>TPHA0K02250 Chr11 (482029..482490) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0J02880 Chr10 (550889..551350) [462 bp, 153 aa] {ON} Anc_4.16
          YLL039C
          Length = 153

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Ecym_8408 Chr8 (845058..845519) [462 bp, 153 aa] {ON} similar to
          Ashbya gossypii ACL062C
          Length = 153

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>Suva_10.34 Chr10 complement(69167..69622) [456 bp, 151 aa] {ON}
          YALI0E18986g (REAL)
          Length = 151

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

>KNAG0C06580 Chr3 complement(1275504..1275945,1276297..1276304)
          [450 bp, 149 aa] {ON} 
          Length = 149

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0B03520 Chr2 complement(621285..621369,621473..621621) [234
          bp, 77 aa] {ON}
          Length = 77

 Score = 40.8 bits (94), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/52 (38%), Positives = 29/52 (55%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          G   V + KE++    G+P   QRLI+ GK + D QT+    + DG  +HLV
Sbjct: 19 GTDPVYRIKEMLEEKEGIPPSQQRLIFQGKQIDDEQTVSSANLIDGMQLHLV 70

>Ecym_4181 Chr4 complement(379972..380430) [459 bp, 152 aa] {ON}
          similar to Ashbya gossypii AGL128W
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>ZYRO0C04026g Chr3 (318229..318687) [459 bp, 152 aa] {ON} similar
          to uniprot|P05759 Saccharomyces cerevisiae YLR167W
          RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes interacts genetically
          with translation factor eIF2B
          Length = 152

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLTH0F08734g Chr6 complement(754886..755338) [453 bp, 150 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 150

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H13926g Chr8 complement(1189515..1189979) [465 bp, 154 aa]
          {ON} similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167W RPS31 and similar to uniprot|P04838
          Saccharomyces cerevisiae YIL148W and similar to
          uniprot|P04838 Saccharomyces cerevisiae YKR094C and
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039C Fusion proteins that are cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 154

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kwal_23.3311 s23 complement(238458..238910) [453 bp, 150 aa] {ON}
          YLR167W (RPS31) - Ribosomal protein S31 (S37) (YS24)
          [contig 251] FULL
          Length = 150

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0D18304g Chr4 (1545371..1545823) [453 bp, 150 aa] {ON}
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLR167W RPS31 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin; ubiquitin may facilitate assembly of the
          ribosomal protein into ribosomes; interacts genetically
          with translation factor eIF2B
          Length = 150

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TBLA0G00670 Chr7 (142636..143325) [690 bp, 229 aa] {ON} Anc_4.16
          YLL039C
          Length = 229

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0D04930 Chr4 (1172741..1173430) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0I01470 Chr9 (306964..307653) [690 bp, 229 aa] {ON} Anc_5.701
          YIL148W
          Length = 229

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>NDAI0G02280 Chr7 complement(511522..511980) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 42.0 bits (97), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H15818g Chr8 (1379077..1379225,1379297..1379381) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 40.0 bits (92), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 30/48 (62%)

Query: 27 VAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          V + KEL+    G+P   QRLI+ GK ++D QT++   ++ G  +HLV
Sbjct: 23 VYRIKELLEEKEGIPPSQQRLIFQGKQIEDDQTVDSANLSSGMQLHLV 70

>KLTH0E05852g Chr5 complement(528861..530090) [1230 bp, 409 aa] {ON}
           highly similar to uniprot|P04838 Saccharomyces
           cerevisiae YLL039c UBI4 ubiquitin
          Length = 409

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 126 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 174

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 202 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 250

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 278 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 326

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 354 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 402

>Kwal_55.20607 s55 complement(488683..489378) [696 bp, 231 aa]
          {ON} YLL039C (UBI4) - 1:1 [contig 144] FULL
          Length = 231

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>TPHA0C02390 Chr3 complement(536137..536589) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>YLR167W Chr12 (498947..499405) [459 bp, 152 aa] {ON}  RPS31Fusion
          protein that is cleaved to yield a ribosomal protein of
          the small (40S) subunit and ubiquitin; ubiquitin may
          facilitate assembly of the ribosomal protein into
          ribosomes; interacts genetically with translation
          factor eIF2B
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.33 Chr10 complement(68388..69152) [765 bp, 254 aa] {ON}
          YLL039C (REAL)
          Length = 254

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

>KAFR0H02000 Chr8 complement(369778..370236) [459 bp, 152 aa] {ON}
          Anc_8.386 YLR167W
          Length = 152

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NCAS0C02940 Chr3 complement(552015..552473) [459 bp, 152 aa] {ON}
          Anc_8.386
          Length = 152

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>TDEL0F05100 Chr6 (959574..960026) [453 bp, 150 aa] {ON} Anc_8.386
          YLR167W
          Length = 150

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>SAKL0H25784g Chr8 (2259314..2260231) [918 bp, 305 aa] {ON} highly
          similar to uniprot|P04838 Saccharomyces cerevisiae
          YLL039c UBI4 ubiquitin
          Length = 305

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

>AGL128W Chr7 (470174..470632) [459 bp, 152 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YLR167W (RPS31)
          Length = 152

 Score = 41.6 bits (96), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>CAGL0G08173g Chr7 (776549..777007) [459 bp, 152 aa] {ON} highly
          similar to uniprot|P61864 Saccharomyces cerevisiae
          YLR167w UBI3 Fusion protein that is cleaved to yield a
          ribosomal protein of the small (40S) subunit and
          ubiquitin
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Suva_10.266 Chr10 (471118..471576) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.234 Chr12 (445677..446135) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Smik_12.229 Chr12 (446071..446529) [459 bp, 152 aa] {ON} YLR167W
          (REAL)
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1030.5 s1030 complement(10263..10721) [459 bp, 152 aa] {ON}
          complement(10263..10721) [459 nt, 153 aa]
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Kpol_1024.16 s1024 complement(58683..59141) [459 bp, 152 aa] {ON}
          complement(58683..59141) [459 nt, 153 aa]
          Length = 152

 Score = 41.2 bits (95), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>NDAI0B01850 Chr2 complement(440321..441532) [1212 bp, 403 aa] {ON} 
          Length = 403

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (63%), Gaps = 2/44 (4%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALL--NGD 366
           +Y ++LR+L +MGF D D N  AL  A G L GA+D L   NGD
Sbjct: 166 KYSRELRRLQNMGFRDIDINTEALVLARGDLNGAIDILTQDNGD 209

>Suva_10.30 Chr10
          complement(67747..67841,68061..68288,68558..69013,
          69256..69622) [1146 bp, 381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++ K L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAEKQLEDGRTLSDYNIQKESTLHLV 374

>NDAI0F00300 Chr6 (66116..66679) [564 bp, 187 aa] {ON} Anc_5.701
          Length = 187

 Score = 41.6 bits (96), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 81  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 129

>KNAG0A02730 Chr1 complement(296966..297418) [453 bp, 150 aa] {ON}
          Anc_8.386 YLR167W
          Length = 150

 Score = 41.2 bits (95), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>Skud_12.29 Chr12 complement(55051..55829,56058..56424) [1146 bp,
          381 aa] {ON} YLL039C (REAL)
          Length = 381

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>YLL039C Chr12 complement(64062..65207) [1146 bp, 381 aa] {ON}
          UBI4Ubiquitin, becomes conjugated to proteins, marking
          them for selective degradation via the ubiquitin-26S
          proteasome system; essential for the cellular stress
          response; encoded as a polyubiquitin precursor
          comprised of 5 head-to-tail repeats
          Length = 381

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ACL062C Chr3 complement(255353..256501) [1149 bp, 382 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YLL039C
          (UBI4)
          Length = 382

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>KLLA0E00749g Chr5 complement(74948..76093) [1146 bp, 381 aa] {ON}
          highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 381

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>SAKL0D11814g Chr4 (981832..983034) [1203 bp, 400 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 400

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 30/47 (63%)

Query: 25 TTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          +TV Q K+ +A       +  +LI+SGK+L+D +TLEE K+ DG  V
Sbjct: 22 STVLQAKQQLASTKSCDEDQIKLIFSGKVLQDGKTLEECKLKDGDQV 68

>NCAS0C05850 Chr3 (1203331..1204497) [1167 bp, 388 aa] {ON} 
          Length = 388

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

>ZYRO0G07854g Chr7 complement(634289..635671) [1383 bp, 460 aa]
          {ON} highly similar to uniprot|P04838 Saccharomyces
          cerevisiae YLL039c UBI4 ubiquitin
          Length = 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 402 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

>Kpol_1070.6 s1070 complement(16980..18581) [1602 bp, 533 aa] {ON}
          complement(16980..18581) [1602 nt, 534 aa]
          Length = 533

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 402 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 478 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>Smik_12.18 Chr12
          complement(49088..49552,49091..49552,49091..49546)
          [1383 bp, 460 aa] {ON} YLL039C (REAL)
          Length = 460

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 176 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 224

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 252 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 300

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 330 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 378

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 406 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 454

>CAGL0D05082g Chr4 (488733..490334) [1602 bp, 533 aa] {ON} similar
          to uniprot|P04838 Saccharomyces cerevisiae YLL039c UBI4
          ubiquitin
          Length = 533

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 98  TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 174 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 250 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 326 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 402 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 450

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26  TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
           T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 478 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526

>TBLA0H03180 Chr8 (775282..775740) [459 bp, 152 aa] {ON} Anc_8.386
          YLR167W
          Length = 152

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 30/49 (61%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          T+   K  +    G+P + QRLI++GK L+D +TL +Y I    T+HLV
Sbjct: 22 TIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 38.5 bits (88), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 27/49 (55%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          TV   KEL+    G+P   Q+LI+ GK + D  T+    + DG  +HLV
Sbjct: 22 TVYHIKELLEEKEGIPPSQQKLIFQGKQIDDNATIGSADLQDGSLLHLV 70

>NCAS0B04590 Chr2 complement(835478..836821) [1344 bp, 447 aa] {ON}
           Anc_8.142 YGL181W
          Length = 447

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 26/42 (61%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGD 366
           +Y +QLR L DMGF+D D NV AL    G++   ++ L + +
Sbjct: 155 KYSRQLRSLKDMGFNDVDNNVEALNICNGNINKTINILTSNE 196

>YDR139C Chr4 complement(733618..733702,733776..733924) [234 bp,
          77 aa] {ON}  RUB1Ubiquitin-like protein with similarity
          to mammalian NEDD8; conjugation (neddylation)
          substrates include the cullins Cdc53p, Rtt101p, and
          Cul3p; activated by Ula1p and Uba3p (E1 enzyme pair);
          conjugation mediated by Ubc12p (E2 enzyme)
          Length = 77

 Score = 37.7 bits (86), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 27 VAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          V   KEL+    G+P   QRLI+ GK + D  T+ +  + +G  +HLV
Sbjct: 23 VYHIKELLEEKEGIPPSQQRLIFQGKQIDDKLTVTDAHLVEGMQLHLV 70

>Smik_7.91 Chr7 (152642..153637,153905..154108) [1200 bp, 399 aa]
           {ON} YGL181W (REAL)
          Length = 399

 Score = 40.8 bits (94), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY +QL +L DMGFSD ++N+ AL  A G++  A+D L
Sbjct: 196 RYSRQLLELRDMGFSDANKNLDALSSAHGNINRAIDYL 233

>TDEL0B04690 Chr2 (832571..833899) [1329 bp, 442 aa] {ON} Anc_8.142
           YGL181W
          Length = 442

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 23/38 (60%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY ++LR L +MG+ D D N  AL  A G L  A+D L
Sbjct: 193 RYSRELRTLKEMGYDDIDHNAEALSHAHGDLNRAIDIL 230

>TBLA0D02210 Chr4 (555236..556927) [1692 bp, 563 aa] {ON} Anc_8.142
           YGL181W
          Length = 563

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           +Y +QL++LNDMGF++ D N  AL  + G +  ALD L
Sbjct: 219 KYSRQLKELNDMGFTNTDNNAEALSISRGDINRALDLL 256

>Suva_7.81 Chr7 (153418..154434,154933..155121) [1206 bp, 401 aa]
           {ON} YGL181W (REAL)
          Length = 401

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY +QL +L DMGF+D ++N+ AL  A G+L  A+D L
Sbjct: 194 RYSRQLAELRDMGFNDKNKNLDALSSAHGNLSRAIDYL 231

>YGL181W Chr7 (157906..159096) [1191 bp, 396 aa] {ON}  GTS1Protein
           involved in Arf3p regulation and in transcription
           regulation; localizes to the nucleus and to endocytic
           patches; contains an N-terminal Zn-finger and ArfGAP
           homology domain, a C-terminal glutamine-rich region, and
           a UBA (ubiquitin associated) domain; gts1 mutations
           affect budding, cell size, heat tolerance, sporulation,
           life span, ultradian rhythms, endocytosis; expression
           oscillates in a pattern similar to metabolic
           oscillations
          Length = 396

 Score = 39.7 bits (91), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY +QL +L DMGF D ++N+ AL  A G++  A+D L
Sbjct: 194 RYSRQLAELKDMGFGDTNKNLDALSSAHGNINRAIDYL 231

>KLTH0C03410g Chr3 complement(295299..296474) [1176 bp, 391 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 391

 Score = 39.3 bits (90), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 30/47 (63%)

Query: 25 TTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          +T+++ K+ +A          +LIYSGKIL+D +T+ +YK+ DG  V
Sbjct: 22 STISEAKQRLAENKDCDESQIKLIYSGKILQDDRTIADYKLNDGDQV 68

>KLTH0G12540g Chr7 (1065801..1065949,1066013..1066097) [234 bp, 77
          aa] {ON} similar to uniprot|Q03919 Saccharomyces
          cerevisiae YDR139C RUB1 Ubiquitin-like protein with
          similarity to mammalian NEDD8
          Length = 77

 Score = 35.8 bits (81), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 39/74 (52%), Gaps = 4/74 (5%)

Query: 1  MGITVGVKQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTL 60
          M +TV    G+   ++ V  +P +  V + KE +    G+P   QRLI+ GK + D +++
Sbjct: 1  MKLTVKTLTGK---EIPVVVDP-DDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSV 56

Query: 61 EEYKITDGHTVHLV 74
              ++ G  +HLV
Sbjct: 57 SSANLSSGMQLHLV 70

>ZYRO0D08140g Chr4 (705216..705437) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 35.0 bits (79), Expect = 0.030,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 28/50 (56%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          E  V  FK++++   G P    +L+  G ILKD  +L++Y+I D   + L
Sbjct: 21 EDLVGDFKKILSVQIGTPASKIQLVKGGSILKDHISLDDYEIHDNTFLEL 70

>CAGL0L06028g Chr12 complement(677581..679098) [1518 bp, 505 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181w GTS1
          Length = 505

 Score = 37.7 bits (86), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 27/38 (71%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           +Y ++LRQL ++GF++  +N+ A+  + G + GALD L
Sbjct: 211 KYGRELRQLRELGFTNEQKNIDAITYSHGDVNGALDYL 248

>Ecym_3572 Chr3 complement(1083184..1084515) [1332 bp, 443 aa]
          {ON} similar to Ashbya gossypii AFR358W
          Length = 443

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          T+A+ K+L+A          ++I+SGK+L+D  TL+  K+ DG  V
Sbjct: 24 TIAEAKQLLAKEKQCDESQLKMIFSGKVLQDGHTLDACKLKDGDQV 69

>AFR358W Chr6 (1087725..1088966) [1242 bp, 413 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YEL037C (RAD23)
          Length = 413

 Score = 37.4 bits (85), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 28/46 (60%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          T+A+ K+++A          ++I+SGK+L+D  TLE  K+ DG  V
Sbjct: 24 TIAEAKQMLARAKQCDESQLKMIFSGKVLQDGNTLEGCKLKDGDQV 69

>Kwal_27.10152 s27 complement(216695..217840) [1146 bp, 381 aa]
          {ON} YEL037C (RAD23) - ubiquitin-like protein [contig
          41] FULL
          Length = 381

 Score = 37.4 bits (85), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 25 TTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          +TV + K+ +A          +LIYSGKIL+D +T+ +YK+ DG  V
Sbjct: 22 STVNEAKQKLAENKECDDSQIKLIYSGKILQDDRTIGDYKLKDGDQV 68

>NCAS0G04120 Chr7 (768760..769938) [1179 bp, 392 aa] {ON}
          Anc_1.480 YEL037C
          Length = 392

 Score = 37.0 bits (84), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+DA+TLE+  + DG  V
Sbjct: 43 KLIYSGKVLQDAKTLEDCGLKDGDQV 68

>SAKL0H24772g Chr8 complement(2155837..2157081) [1245 bp, 414 aa]
           {ON} weakly similar to uniprot|P40956 Saccharomyces
           cerevisiae YGL181W GTS1 Contains a zinc-finger in the N-
           terminus and a long Gln-rich region in the C-terminus
           regulates ultradian rhythm cell size cell cycle lifespan
           sporulation heat tolerance and multidrug transport
          Length = 414

 Score = 36.6 bits (83), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDALLNGDV 367
           R+  QLR L ++G+ D D NV AL  A G +  ALD +L  DV
Sbjct: 184 RHSHQLRNLKELGYLDTDSNVEALVLARGDINLALD-ILEADV 225

>KLTH0A06820g Chr1 complement(569895..570116) [222 bp, 73 aa] {ON}
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1
          Length = 73

 Score = 32.7 bits (73), Expect = 0.20,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITD 67
          GE TV  FK+++A   G+      L   G +LKD  TL++Y++ D
Sbjct: 20 GEDTVGDFKKVLALQLGISWTKIVLQKGGAVLKDHITLDDYEVHD 64

>NCAS0C04090 Chr3 (833393..834583) [1191 bp, 396 aa] {ON} Anc_8.142
          Length = 396

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 27/48 (56%), Gaps = 1/48 (2%)

Query: 316 PQDTRPPEERYEQQLRQLNDMGFS-DFDRNVAALRRAGGSLQGALDAL 362
           P D+R    +Y +QL +L DMG+S D  R   AL R  G +  +LD +
Sbjct: 189 PHDSRHGRFKYSRQLNELRDMGYSTDTQRIKDALERTHGDINRSLDII 236

>NCAS0A05390 Chr1 complement(1067778..1067999) [222 bp, 73 aa]
          {ON} Anc_6.343 YNR032C-A
          Length = 73

 Score = 32.3 bits (72), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 27/51 (52%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          GE +V  FK++++   G       L   G +LKD  TLE+Y+I D   + L
Sbjct: 20 GEDSVGDFKKVLSIQLGTQPNKIVLQKGGNVLKDHITLEDYEIHDNTNLEL 70

>KAFR0E00530 Chr5 complement(113019..114158) [1140 bp, 379 aa]
          {ON} Anc_1.480 YEL037C
          Length = 379

 Score = 35.4 bits (80), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 25 TTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHLV 74
          +T+   K  +A +    ++  +LI+SGK+LKD QT+    + D   V ++
Sbjct: 21 STILDAKNKLASIKSCDIDQIKLIFSGKVLKDDQTVSSCGLKDNDQVIMM 70

>NDAI0G00330 Chr7 complement(54805..56088) [1284 bp, 427 aa] {ON}
          Anc_1.480 YEL037C
          Length = 427

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 21/26 (80%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          ++IYSGK+L+D QT+EE ++ +G  +
Sbjct: 43 KIIYSGKVLQDGQTVEECQLKEGDQI 68

>Skud_7.90 Chr7 (163529..164719) [1191 bp, 396 aa] {ON} YGL181W
           (REAL)
          Length = 396

 Score = 34.7 bits (78), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 26/38 (68%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY +QL +L DMG++D  +N+ AL  A G++  ++D L
Sbjct: 194 RYSRQLIELRDMGYNDTAKNLDALSFAHGNINRSIDYL 231

>TDEL0C02590 Chr3 complement(448900..450006) [1107 bp, 368 aa]
          {ON} Anc_1.480 YEL037C
          Length = 368

 Score = 34.7 bits (78), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 21/26 (80%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+D+++L+E  + DG  V
Sbjct: 43 KLIYSGKVLQDSKSLQESGLKDGDQV 68

>KLLA0C08470g Chr3 (742530..742754) [225 bp, 74 aa] {ON} highly
          similar to uniprot|Q6Q546 Saccharomyces cerevisiae
          YNR032C-A HUB1 Ubiquitin-like protein modifier
          Length = 74

 Score = 32.0 bits (71), Expect = 0.40,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 1/51 (1%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSG-KILKDAQTLEEYKITDGHTVHL 73
          E TV  FK++++   G    ++ ++  G  +LKD  TLE+Y++ DG  + L
Sbjct: 21 EDTVGDFKKVLSVQLGTASASKIVLQKGGSVLKDHITLEDYEVHDGTNLEL 71

>ZYRO0F05192g Chr6 (434982..436136) [1155 bp, 384 aa] {ON} similar
          to uniprot|P32628 Saccharomyces cerevisiae YEL037C
          RAD23
          Length = 384

 Score = 34.3 bits (77), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+DA+ L+E  + DG  V
Sbjct: 43 KLIYSGKVLQDAKNLQESGLKDGDQV 68

>Skud_5.53 Chr5 complement(79502..80695) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+D++T+ E  + DG  V
Sbjct: 43 KLIYSGKVLQDSKTVSECGLKDGDQV 68

>Suva_5.32 Chr5 complement(56798..58027) [1230 bp, 409 aa] {ON}
          YEL037C (REAL)
          Length = 409

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          T+ + K  +A  +       +LIYSGK+L+D++T+ E  + DG  V
Sbjct: 23 TIFEAKTKLAQSSSCEESQIKLIYSGKVLQDSKTVSECGLKDGDQV 68

>Smik_5.56 Chr5 complement(83505..84698) [1194 bp, 397 aa] {ON}
          YEL037C (REAL)
          Length = 397

 Score = 34.3 bits (77), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+D++T+ E  + DG  V
Sbjct: 43 KLIYSGKVLQDSKTVSECGLKDGDQV 68

>YEL037C Chr5 complement(81407..82603) [1197 bp, 398 aa] {ON}
          RAD23Protein with ubiquitin-like N terminus, subunit of
          Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that
          binds damaged DNA; enhances protein deglycosylation
          activity of Png1p; also involved, with Rad4p, in
          ubiquitylated protein turnover
          Length = 398

 Score = 34.3 bits (77), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 20/26 (76%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LIYSGK+L+D++T+ E  + DG  V
Sbjct: 43 KLIYSGKVLQDSKTVSECGLKDGDQV 68

>Smik_14.362 Chr14 complement(645208..645426) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 31.6 bits (70), Expect = 0.54,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          GE TV  FK++++   G       L   G +LKD  +LE+Y++ D   + L
Sbjct: 20 GEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLEL 70

>Kpol_541.50 s541 complement(162130..163665) [1536 bp, 511 aa] {ON}
           complement(162130..163665) [1536 nt, 512 aa]
          Length = 511

 Score = 33.9 bits (76), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 23/38 (60%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           RY ++L +L +MGF+D D N  A+  A G +  A+  L
Sbjct: 233 RYSRELNRLREMGFNDIDNNAEAMSLANGDISRAITIL 270

>Suva_14.387 Chr14 complement(668510..668728) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 31.2 bits (69), Expect = 0.61,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          GE TV  FK++++   G       L   G +LKD  +LE+Y++ D   + L
Sbjct: 20 GEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>Skud_14.364 Chr14 complement(655336..655554) [219 bp, 73 aa] {ON}
          YNR032C-A (REAL)
          Length = 73

 Score = 31.2 bits (69), Expect = 0.61,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 27/51 (52%)

Query: 23 GETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          GE TV  FK++++   G       L   G +LKD  +LE+Y++ D   + L
Sbjct: 20 GEDTVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDETNLEL 70

>KLLA0E22133g Chr5 complement(1974635..1975786) [1152 bp, 383 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037C RAD23
          Length = 383

 Score = 33.9 bits (76), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 27/48 (56%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          + T++  KEL+A          +LIY+GKIL+D +T+    + +G  V
Sbjct: 20 DATISHAKELIAEQKQCDASQIKLIYAGKILQDPKTVSGCNLKEGDQV 67

>TPHA0H00400 Chr8 (77122..78522) [1401 bp, 466 aa] {ON} Anc_8.142
           YGL181W
          Length = 466

 Score = 33.9 bits (76), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 22/38 (57%)

Query: 325 RYEQQLRQLNDMGFSDFDRNVAALRRAGGSLQGALDAL 362
           +Y + ++ L  MG++D D N  AL  A G +  A+D L
Sbjct: 227 KYSRHIKNLEQMGYTDIDNNAEALSIAHGDINQAIDIL 264

>TPHA0O00440 Chr15 (78697..79806) [1110 bp, 369 aa] {ON} Anc_1.480
          YEL037C
          Length = 369

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 22 PGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTV 71
          P  +TV   K+ +A          +LIYSGK+L+D+ ++E   + DG  V
Sbjct: 19 PASSTVLHAKKQLAEQKECDDSQIKLIYSGKVLQDSNSIEGCGLKDGDQV 68

>CAGL0L01309g Chr12 complement(148931..150109) [1179 bp, 392 aa]
          {ON} similar to uniprot|P32628 Saccharomyces cerevisiae
          YEL037c RAD23 nucleotide excision repair protein
          Length = 392

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 18/26 (69%)

Query: 46 RLIYSGKILKDAQTLEEYKITDGHTV 71
          +LI+SGK+LKD  ++E     DG+ V
Sbjct: 43 KLIFSGKVLKDGDSVESCNFKDGNEV 68

>KNAG0G00510 Chr7 complement(85742..86869) [1128 bp, 375 aa] {ON}
          Anc_1.480 YEL037C
          Length = 375

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 5/68 (7%)

Query: 8  KQGQNRWDVAVASEPGETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITD 67
          K+ +   DV +  E    +V   KE +A       E  +LI+SGK+L+DA+   E  + +
Sbjct: 10 KKNKETLDVDLEHE----SVKDVKEKLAAARDCDAEQIKLIFSGKVLQDAKPFAETGLKE 65

Query: 68 G-HTVHLV 74
            H + +V
Sbjct: 66 NDHVIMMV 73

>KNAG0D00370 Chr4 (51604..51825) [222 bp, 73 aa] {ON} Anc_6.343
          YNR032C-A
          Length = 73

 Score = 29.6 bits (65), Expect = 2.6,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 27/50 (54%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          E +V  FK++VA   GV      L   G +LKD  TL +Y++ +G  + L
Sbjct: 21 EDSVGDFKKVVAVQLGVMPGKIVLQKGGVVLKDHITLMDYEVHEGTNLEL 70

>Ecym_2501 Chr2 complement(982410..982631) [222 bp, 73 aa] {ON}
          similar to Ashbya gossypii AER266C
          Length = 73

 Score = 29.3 bits (64), Expect = 2.9,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 26 TVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          T+  FK++++   G       L   G  LKD  TLE+Y+I DG  + L
Sbjct: 23 TIGDFKKVLSIQLGSSHNKLVLQKGGSSLKDLITLEDYEIHDGTNLEL 70

>SAKL0A01210g Chr1 (118298..118519) [222 bp, 73 aa] {ON} similar
          to uniprot|Q6Q546 Saccharomyces cerevisiae YNR032C-A
          HUB1
          Length = 73

 Score = 29.3 bits (64), Expect = 3.0,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 27/50 (54%)

Query: 24 ETTVAQFKELVAGVAGVPVENQRLIYSGKILKDAQTLEEYKITDGHTVHL 73
          E TV  FK++++   G       L   G +LKD  TL++Y++ +G  + L
Sbjct: 21 EDTVGDFKKVLSLQLGTQHTKIILQKGGSVLKDHITLDDYEVHNGTNLEL 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.131    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,157,152
Number of extensions: 692892
Number of successful extensions: 2482
Number of sequences better than 10.0: 151
Number of HSP's gapped: 2500
Number of HSP's successfully gapped: 256
Length of query: 367
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 256
Effective length of database: 40,753,473
Effective search space: 10432889088
Effective search space used: 10432889088
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)