Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002808.839ON74272433950.0
KAFR0B039108.839ON72465920520.0
TDEL0B005808.839ON71365420390.0
ZYRO0G14168g8.839ON76465720380.0
NCAS0C004208.839ON72565520340.0
CAGL0M02959g8.839ON75865820320.0
NDAI0K004208.839ON77870419590.0
TBLA0D032608.839ON76868219480.0
Kpol_1068.98.839ON74566119120.0
TPHA0I002408.839ON73266419070.0
Smik_13.4908.839ON73266818920.0
YMR277W (FCP1)8.839ON73266818900.0
Skud_13.4498.839ON73467018880.0
Suva_13.4658.839ON73266718590.0
SAKL0D01496g8.839ON68864618030.0
Kwal_27.102638.839ON74365317380.0
KLTH0C03894g8.839ON74562317090.0
ABL127W8.839ON72866016820.0
Ecym_46108.839ON75166216810.0
KLLA0D01595g8.839ON71965716400.0
NCAS0A068005.202ON473511010.002
TPHA0E030705.202ON49451970.005
KNAG0M017405.202ON48145930.014
ZYRO0B10428g5.202ON48245920.021
KLLA0F15620g5.202ON41445900.031
Kpol_2002.1005.202ON47745900.035
YLL010C (PSR1)5.202ON42743890.038
Smik_12.535.202ON41443890.039
Suva_10.655.202ON41543890.044
Suva_10.995.202ON38545880.054
CAGL0D03234g5.202ON41045870.064
TDEL0E042705.202ON45345860.090
AAL158W5.202ON47845860.098
YLR019W (PSR2)5.202ON39793860.099
TPHA0N006705.202ON45243860.11
NDAI0I021705.202ON39145850.12
SAKL0G12870g5.202ON39960850.12
KAFR0J009905.202ON48345850.13
Smik_12.825.202ON39245850.14
Skud_12.575.202ON41543840.15
NCAS0D027405.202ON39845840.18
TBLA0C060905.202ON48451830.26
Ecym_20665.94ON880115820.33
Skud_12.875.202ON39293820.33
Ecym_71045.202ON49240780.84
Kpol_478.165.202ON35051771.1
NDAI0D018605.202ON51451771.1
CAGL0D05610g5.202ON44740761.6
TBLA0H019905.202ON68845752.2
KAFR0A065604.156ON55547752.4
Ecym_72764.156ON59356742.6
CAGL0B03289g1.306ON87040752.6
NCAS0J008804.156ON56648742.7
Smik_14.1872.125ON159375743.1
Kwal_33.151405.202ON41060733.9
Kpol_1016.191.276ON75992724.9
KLLA0D12870g6.271ON58484716.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00280
         (742 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...  1312   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   795   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   790   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   789   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   788   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   787   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   759   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   754   0.0  
Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...   741   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   739   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   733   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   732   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   731   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   720   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   699   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   674   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   662   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   652   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   652   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   636   0.0  
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    44   0.002
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    42   0.005
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    40   0.014
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    40   0.021
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    39   0.031
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    39   0.035
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    39   0.038
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    39   0.039
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    39   0.044
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    39   0.054
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    38   0.064
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    38   0.090
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    38   0.098
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    38   0.099
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    38   0.11 
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     37   0.12 
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    37   0.12 
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    37   0.13 
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    37   0.14 
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    37   0.15 
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    37   0.18 
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    37   0.26 
Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}...    36   0.33 
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    36   0.33 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    35   0.84 
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    34   1.1  
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     34   1.1  
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    34   1.6  
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    33   2.2  
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    33   2.4  
Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}...    33   2.6  
CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} simila...    33   2.6  
NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {...    33   2.7  
Smik_14.187 Chr14 complement(340387..345168) [4782 bp, 1593 aa] ...    33   3.1  
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    33   3.9  
Kpol_1016.19 s1016 complement(46243..48522) [2280 bp, 759 aa] {O...    32   4.9  
KLLA0D12870g Chr4 (1097784..1099538) [1755 bp, 584 aa] {ON} simi...    32   6.8  

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score = 1312 bits (3395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/724 (89%), Positives = 648/724 (89%)

Query: 1   MDLVAPTPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDS 60
           MDLVAPTPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDS
Sbjct: 1   MDLVAPTPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDS 60

Query: 61  DGTGTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGL 120
           DGTGTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGL
Sbjct: 61  DGTGTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGL 120

Query: 121 CTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXX 180
           CTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVE                  
Sbjct: 121 CTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKL 180

Query: 181 XXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAP 240
                  QTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAP
Sbjct: 181 VLVVDLDQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAP 240

Query: 241 RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDE 300
           RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDE
Sbjct: 241 RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDE 300

Query: 301 NGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQ 360
           NGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQ
Sbjct: 301 NGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQ 360

Query: 361 PTMLQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKG 420
           PTMLQMGRRSKLNERGHESK              IMNTEKQLQEKIDQEVKRQEHKLNKG
Sbjct: 361 PTMLQMGRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKG 420

Query: 421 NAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLK 480
           NAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLK
Sbjct: 421 NAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLK 480

Query: 481 DRLADLHKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW 540
           DRLADLHKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW
Sbjct: 481 DRLADLHKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW 540

Query: 541 TNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK 600
           TNKFGA           HLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK
Sbjct: 541 TNKFGATTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK 600

Query: 601 PYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWLX 660
           PYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 
Sbjct: 601 PYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWLN 660

Query: 661 XXXXXXXXXXXXXXXXXXXXXXXXXTTMLDDGEPETGGTPDKRSLFENPDQPAEKKPRIQ 720
                                    TTMLDDGEPETGGTPDKRSLFENPDQPAEKKPRIQ
Sbjct: 661 DEDDEEIPKEDEESEDDEDENDENNTTMLDDGEPETGGTPDKRSLFENPDQPAEKKPRIQ 720

Query: 721 DAEP 724
           DAEP
Sbjct: 721 DAEP 724

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  795 bits (2052), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/659 (59%), Positives = 475/659 (72%), Gaps = 26/659 (3%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGV-DAAAEGDSDGTGT 65
           TPV++  GLPYP+T+DELI  +G  + +G RLFAYKFWY+VE+A   D     ++D   +
Sbjct: 3   TPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQAS 62

Query: 66  TAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCG 125
             KK +RES+EFF++PFEGT++SW++D GDE+      +C ++RPCNHD+VY GLCT CG
Sbjct: 63  HPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQCG 122

Query: 126 REVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXX 185
           +EVDE E           G N TVSH DTNL+ISR E                       
Sbjct: 123 KEVDESE-------QSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVD 175

Query: 186 XXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWY 245
             QTV+HCGVDPTIGEWK DP NPNY+ L+DVQ FALEEEP+LPF+Y+G K P PRKCWY
Sbjct: 176 LDQTVIHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPK-PTPRKCWY 234

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305
           YVKVRPGLK+FFK++APLFEMHIYTMATRAYALEI KIIDP   LFG+RILSRDENGSLT
Sbjct: 235 YVKVRPGLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLT 294

Query: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQ 365
            KSLERLFPTDQSMV +IDDRGDVWNW  NLIKVVPY+FFVGVGDINSNFLPKQQ TMLQ
Sbjct: 295 SKSLERLFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQ 354

Query: 366 MGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGD 425
           +GRRS+  E+  E+               IM+TEK+LQEKID+EVKRQE  L+       
Sbjct: 355 LGRRSR--EKAKEAD---------ELLTDIMDTEKKLQEKIDEEVKRQEKNLSH-QVVPT 402

Query: 426 EQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485
           E+    ++KEEWTKKLE SASVEVQQ+NRPLA LQ+HLHNQ+LL+D+DDEL++LKD LA 
Sbjct: 403 EESVSNETKEEWTKKLEHSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAK 462

Query: 486 LHKRYYSTLKENPQD---TNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTN 542
           +H  YYS L+    D    +I+ IM +LK  VF+ CHFVFSGLIPL+T+++ ADIV+WT+
Sbjct: 463 VHNEYYSILENKSLDESGADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTS 522

Query: 543 KFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPY 602
            FGA           H+ITKTPGT KARLAK+FN DIKIVHPDW+FECLI+W  VD KPY
Sbjct: 523 MFGAESSSEINEVTTHVITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPY 582

Query: 603 LLIVEDPVSEAQVREFKEKLTRQK--ERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
            LIVE+P+S+ ++++F+E L  +K  ER   Q S        +  +  +DLFA G SWL
Sbjct: 583 TLIVEEPISDRELKKFREDLNNRKLTERNNEQNSGDITGTIVENFDNTVDLFATGTSWL 641

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/654 (59%), Positives = 474/654 (72%), Gaps = 32/654 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TPV S   LPYP+T+D+LI  +G  V +G RLFA+KFWY+VE+A          +  G  
Sbjct: 3   TPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIAS------SPDENEGGH 56

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            KK+VRES+EFFE+PFEG ++SW+VD GDE+  P   +C + RPCNHD+VY GLCTLCG+
Sbjct: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
           EVDE E             NL +SH D NL++SR E                        
Sbjct: 117 EVDESE---------QFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDL 167

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEWKRD  NPNYEAL+DVQSFAL+EEPILP LY+G K P  RKCWYY
Sbjct: 168 DQTVIHCGVDPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPV-RKCWYY 226

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VKVRPGLK+FF ++APLFEMHIYTMATRAYALEIAKIIDPD SLFGDRILSRDENGS+T 
Sbjct: 227 VKVRPGLKEFFDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQ 286

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLP+QQ TMLQ+
Sbjct: 287 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQL 346

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GR ++  ++  ES               IM+TEK+LQEKID+EVKRQE KLN   A+G+E
Sbjct: 347 GRGAR--KKTQESD---------ELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMASGEE 395

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
              P +SK++  KKLE+SAS+EVQQ+NRPLATLQKH+HNQ+LLVD+DDEL YL++ LA +
Sbjct: 396 VPAP-ESKDQLAKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKV 454

Query: 487 HKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545
           H  YY TL +++ +  +I++++  +K++VF+DCHFVFSGLIPL TN+  ADIV+WTN FG
Sbjct: 455 HDEYYKTLGQDSEKKADIKTLLPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFG 514

Query: 546 AXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605
           A           H+IT+TPGT KAR+AKAFN +IK+VHPDW+FECL+ W+ VD KPY LI
Sbjct: 515 AQSSPEIDDSTTHVITRTPGTYKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELI 574

Query: 606 VEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
           VE   ++ ++ ++K+KL R+      Q    A+  A       I+LFAGG SWL
Sbjct: 575 VEQTATDEELGDYKQKLARRSSALAEQEMELAMESAKNGT---INLFAGGTSWL 625

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  789 bits (2038), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/657 (58%), Positives = 480/657 (73%), Gaps = 30/657 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TPV++   LPYP+T+D+LI  +G  V +G RLFAYKFWY+VE+A   +  E D +G    
Sbjct: 3   TPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIAS--SPDENDGNGGAQH 60

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
           +KK+VRES+EFFESPFEG +VSW+VD GDE+      +C + RPCNHDVVY GLCT+CG+
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
           EVDE +   A         NL +SH DTNL++SR E                        
Sbjct: 121 EVDENDQMEA---------NLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDL 171

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEWK+DP NPNYE L+DVQ F+LEEEPI+P +Y+G + P  RKCWY+
Sbjct: 172 DQTVIHCGVDPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPE-RKCWYF 230

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VKVRPGL++FF +LAPL+EMHIYTMATR YALEIAKIIDPD SLFGDRILSRDENGSLT 
Sbjct: 231 VKVRPGLREFFAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQ 290

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLP+QQ  +LQ+
Sbjct: 291 KSLERLFPTDQSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQL 350

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR+  +++  ES               IM+TEK+LQEKID+EVKRQE KL+      DE
Sbjct: 351 GRRT--HKKPQESD---------ELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDE 399

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
               G+SKE+ TKKLE+SAS+EVQQ+NRPLATLQKH+HNQ+LLVD+DDEL+YLKD LA +
Sbjct: 400 -PVQGESKEQLTKKLEYSASLEVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKI 458

Query: 487 HKRYYSTLKE-NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545
           H++YY  L E N    +IQS++  +K +VF+DC+FVFSGLIPL TN++ ADIV+WT  FG
Sbjct: 459 HRKYYKLLDEGNENSADIQSLVPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFG 518

Query: 546 AXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605
           A           H+ITKTPGT KAR+AK FN ++K+VHPDW+FECL+ W  VD KPY LI
Sbjct: 519 AITSSEIDENTTHVITKTPGTYKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELI 578

Query: 606 VEDPVSEAQVREFKEKLTRQ---KERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
           ++DP +E ++++FK K+ ++   +E+   Q    AL+   +  +  ++LFAGG SWL
Sbjct: 579 IQDPATEEEIQDFKRKIEQRHLIEEQRREQFESEALMKTAQ--DSTLNLFAGGTSWL 633

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  788 bits (2034), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/655 (59%), Positives = 478/655 (72%), Gaps = 24/655 (3%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           T +++  GLPYP+T+D+LI  VGD V +GDRL AYKFW+VV++A   +  + D     T 
Sbjct: 3   TQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVAS--SPDDNDVSSPPTA 60

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            KKS+RES+EFFESP++G ++SW+VD GDEI  P   L  + RPCNHDVVY GLCTLCG 
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
           EVDE +  A+     G G NLT+SH DTNL+IS  E                        
Sbjct: 121 EVDEDDNDAS-----GSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDL 175

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEWK DP+NPN+E L+DV+ F+LEEEPILP LY+G K P  RKCWYY
Sbjct: 176 DQTVIHCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPL-RKCWYY 234

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VKVRPGLK+F +++APLFEMHIYTMATRAYA EIAKIIDP+  LFGDRILSRDENGS+T 
Sbjct: 235 VKVRPGLKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTT 294

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFPTDQSMV VIDDRGDVWNW  NLIKVVPYNFFVGVGDINSNFLPKQQ TMLQ+
Sbjct: 295 KSLERLFPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQL 354

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRRS+   +  E                IM++EK+L+EKIDQEVKRQE +L+  +A  +E
Sbjct: 355 GRRSREKSKDTED-----------LLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEE 403

Query: 427 QQTP-GQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485
             T  G++KEE +KK+E+SAS+EVQQ+NRPLA LQKH H+Q+LL+D+DDEL++LKD L  
Sbjct: 404 PPTSAGENKEEISKKIEYSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVR 463

Query: 486 LHKRYYSTLKENPQ-DTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKF 544
           +H +YY+ LK++ +   +I+ IM  +K  V  +C FVFSGLIPL T++Q ADIVIWTN F
Sbjct: 464 IHDKYYNVLKKDGELKADIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTF 523

Query: 545 GAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLL 604
           GA           H+ITKTPGT KARLAK+FNP IKI+HPDW+FECL  W+ VD KPY L
Sbjct: 524 GAISTSDIDEKTTHVITKTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYEL 583

Query: 605 IVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
           IVE PVSE ++ EFK+KL +++  A   T+   L PAN     +++LF+GG+SWL
Sbjct: 584 IVEQPVSETELEEFKKKLAKRQLLA---TANENLSPANGTNSAELELFSGGMSWL 635

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  787 bits (2032), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/658 (59%), Positives = 481/658 (73%), Gaps = 27/658 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGT- 65
           TPV++  GLPYP+TVDEL+  +G  V +G RLFAYKFWY+VE+A      + D +G    
Sbjct: 3   TPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPEIE 62

Query: 66  TAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCG 125
            +K+ VRES+EF+E+PFEG ++SW+VD  DEI GP   +C ++RPCNHD+VY GLCT+CG
Sbjct: 63  KSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTMCG 122

Query: 126 REVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXX 185
           +EVDEY+          V  NLT+SH DTNL++SR E                       
Sbjct: 123 KEVDEYD---------QVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVD 173

Query: 186 XXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWY 245
             QTV+HCGVDPTIGEWK DP NPNYE L+DV+ F+LEEEPILP +Y+G K P  R CWY
Sbjct: 174 LDQTVIHCGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPV-RTCWY 232

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305
           YVK+RPGLK+FF+++APL+EMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT
Sbjct: 233 YVKIRPGLKEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 292

Query: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQ 365
            KSL RLFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINSNFLPKQQ TMLQ
Sbjct: 293 QKSLTRLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQ 352

Query: 366 MGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGD 425
           +GRR++   +  E                IM+TEK+LQEKID+EVKRQE KLN   A   
Sbjct: 353 LGRRTRQKIKESEE-----------LLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMATA- 400

Query: 426 EQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLAD 485
           E+ T  +SKE+  KKLEFSAS+EVQQ+NRPLA LQKHLH+Q+LL+D+DDELFYLKD LA 
Sbjct: 401 EESTDQESKEKIAKKLEFSASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAY 460

Query: 486 LHKRYYSTLKE--NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNK 543
           +HK +Y  L++  +  + +I  ++ +LK +VF++CHFVFSGLIPL T+++ ADIVIWT+ 
Sbjct: 461 IHKEFYHLLEDASDQNEADITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSL 520

Query: 544 FGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYL 603
           FGA           H++TKTPGT KARLAKAFNPDIK+VHPDWIFECL  W+R+D KPYL
Sbjct: 521 FGAESTSDIDEHTTHVVTKTPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPYL 580

Query: 604 LIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKP--AEPDIDLFAGGISWL 659
           LIVE PVSE ++ EFK+KL ++K++ E            +    EP + LF G  SWL
Sbjct: 581 LIVEQPVSEDELIEFKKKLEQKKKKLEELEIEEEEELNERANQMEPTMPLFGGDTSWL 638

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/704 (54%), Positives = 478/704 (67%), Gaps = 60/704 (8%)

Query: 3   LVAPTPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAE----- 57
           +  PT + +  GLPYP+T+DEL+  +G  +++ DRL AYKFWYVVE+A      E     
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 58  ---------------GDSDGTGTTAKKS--------------------VRESVEFFESPF 82
                            ++ T  T + S                    VRES+EFF+ P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 83  EGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEIQAAAAASGG 142
           +G + SW V+ GD+I GP  PLC ++RPCNHDV+Y GLCTLCG+EVDE +I   +     
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLS----- 175

Query: 143 VGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXXXQTVVHCGVDPTIGEW 202
            GPNLT+SH DTNL+IS  E                         QTV+HCGVDPTIGEW
Sbjct: 176 -GPNLTISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEW 234

Query: 203 KRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYYVKVRPGLKQFFKRLAP 262
           KRDP NPN+E L+DV+ FALEEEPILP +Y+G K PA RKCWYYVKVRPGLK FF+++AP
Sbjct: 235 KRDPTNPNFETLKDVKEFALEEEPILPLMYMGPKPPA-RKCWYYVKVRPGLKDFFQKVAP 293

Query: 263 LFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSLERLFPTDQSMVTV 322
           LFEMHIYTMATRAYA EIAKIIDP   LFG+RILSRDENGSLT KSLERLFPTDQSMV +
Sbjct: 294 LFEMHIYTMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVII 353

Query: 323 IDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRRSKLNERGHESKXX 382
           IDDRGDVWNW  NLIKV+PYNFFVGVGDINSNFLPKQQ TMLQ+GRRS   E    +K  
Sbjct: 354 IDDRGDVWNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTK-- 411

Query: 383 XXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE-QQTPGQSKEEWTKKL 441
                       IM+TEK LQ KI++EVKRQE KLN   A  +E   T G++KEE +KK+
Sbjct: 412 ----ENDDLLTDIMDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKI 467

Query: 442 EFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADLHKRYYSTLKENPQDT 501
           E+SAS+EVQQKNRPLATLQKH H+Q+LL+D+D+EL++LKD L+ +H +YY  L++  ++ 
Sbjct: 468 EYSASLEVQQKNRPLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENK 527

Query: 502 -----NIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGAXXXXXXXXXX 556
                +I+ IM Q+K  V QDCHFVFSGLIPL TN+Q +DIVIWTN FGA          
Sbjct: 528 DSIEPDIKYIMPQMKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENT 587

Query: 557 XHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEAQVR 616
            H+ITKTPGT KARLAK+++PDIKIVHPDW+FECL++W+ V+ KPY L+VE  VS+ ++ 
Sbjct: 588 THVITKTPGTYKARLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELA 647

Query: 617 EFKEKLTRQKERAE-RQTSRTALLPANKPAEPDIDLFAGGISWL 659
           +F  KL R+ + +E +       LP       +++LFAGG SWL
Sbjct: 648 DFNRKLERRIQLSELKDEGLYNKLPDGNIDINEVNLFAGGTSWL 691

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  754 bits (1948), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/682 (56%), Positives = 474/682 (69%), Gaps = 39/682 (5%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELA----GVDAAAEGDSDG 62
           TPV+S A LP+P+T+D+LI  +G  V +G RLFAYKFWY+VE+A      D  +E  SD 
Sbjct: 3   TPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSSDL 62

Query: 63  TGTTA------------KKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRP 110
           +G  +            KKS+RES+EFFESPFEG ++ W+VD GDEI      LC ++RP
Sbjct: 63  SGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIKRP 122

Query: 111 CNHDVVYNGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXX 170
           CNHD+VY G+CT CG+EVD+ +I  A+         L++SH DTNL+ISR E        
Sbjct: 123 CNHDIVYAGICTQCGKEVDDSDIMDAS---------LSISHTDTNLKISRKEARDIDQSS 173

Query: 171 XXXXXXXXXXXXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPF 230
                            QTV+HCGVDPTIGEWK DP+NPNYE L+DV+SF+L+EEPILP 
Sbjct: 174 MSRLKKIKKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPP 233

Query: 231 LYVGGKRPAPRKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
            Y+G  RP  RKCWYYVKVRPGLK+FF ++APL+EMHIYTMATRAYALEIAKIIDPD SL
Sbjct: 234 SYMG-PRPPVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSL 292

Query: 291 FGDRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGD 350
           FG RILSRDENGSLT KSLERLFPTDQSMV +IDDRGDVWNWC NLIKV+PYNFFVG+GD
Sbjct: 293 FGSRILSRDENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGD 352

Query: 351 INSNFLPKQQPTMLQMGRRSKLNERGHESKXXXXXXXXXXXX-----------XXIMNTE 399
           INSNFLP+QQ TMLQ+G RS   +  +E+                          IM+TE
Sbjct: 353 INSNFLPRQQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTE 412

Query: 400 KQLQEKIDQEVKRQEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATL 459
           K+LQ+KID+EV+RQE KL K      +  +   S  E +KK+EFSAS+EVQQ+NRPLATL
Sbjct: 413 KKLQKKIDEEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATL 472

Query: 460 QKHLHNQKLLVDNDDELFYLKDRLADLHKRYYSTLKENPQDT-NIQSIMTQLKTRVFQDC 518
           Q+H  NQ+LL+D+DDELFYLKD L ++H  +Y  L E+  ++ +IQ++M +LK  VF   
Sbjct: 473 QRHRQNQRLLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGY 532

Query: 519 HFVFSGLIPLNTNVQAADIVIWTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPD 578
           +FVFSGLIPL T+++ ADIV+WTN FGA           H+ITKT GT KARLAKAFNP+
Sbjct: 533 NFVFSGLIPLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPE 592

Query: 579 IKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRT-A 637
           IK+VHPDWIFECL+ W+R+  KPY LI+E P SE ++ EFK+KL  + E  E++   T A
Sbjct: 593 IKVVHPDWIFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMETEA 652

Query: 638 LLPANKPAEPDIDLFAGGISWL 659
              A    +P IDLFA G SWL
Sbjct: 653 QFEALNTRDPAIDLFASGTSWL 674

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/661 (55%), Positives = 463/661 (70%), Gaps = 34/661 (5%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TPV +  GLPYP+T+ +LI  +G  V +G RLFAYKFWY+VE+A   +  E D       
Sbjct: 3   TPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAK--SPDENDDGVNDEH 60

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
           +KKS+RES+EFF+SPFEG +VSW+VD GDEI  P   +C + RPCNHD+VY G+CT+CG+
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
           EVDE         S  V  NLT+SH DTNL++SR E                        
Sbjct: 121 EVDE---------SDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDL 171

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTI EWK DP NPN+E LRDV+SF LEEEPILP +Y+G K P   KCWYY
Sbjct: 172 DQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPK-PPTHKCWYY 230

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGLK+FF+ ++ L+EMHIYTMATR+YA EIAKIIDPD +LF DRILSR+ENGSLTH
Sbjct: 231 VKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTH 290

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKV PYNFFVG+GDINSNFLP+QQ TMLQ+
Sbjct: 291 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQL 350

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR   N +  E                IM+TEK+LQEKID+EVKRQE  L+  +AA  E
Sbjct: 351 GRR---NHKKTED--------TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGE 399

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
           + +    KE+ TKK+EFSAS+EVQQ+NRPLA LQKH+HNQ+LL D+DDELFYLKD L ++
Sbjct: 400 EISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNV 459

Query: 487 HKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGA 546
            ++YY  LK + ++  IQ++M +LK +V + C+FVFSGLIPL TN+Q ADIV+WTN FGA
Sbjct: 460 QQKYYEELKTD-KEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGA 518

Query: 547 XXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIV 606
                      H+ITKTP T KA++AKAF  DIK++HPDW+FECL+ W+ +   PY   +
Sbjct: 519 QSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578

Query: 607 EDPVSEAQVREFKEKLTRQKER--------AERQTSRTALLPANKPAEPDIDLFAGGISW 658
               ++ ++ EFKE L R+K++        +E      +  P+++ A   +DLFA G SW
Sbjct: 579 IPTATDKELNEFKEALERRKKKETKTKITVSEESLEGDSNSPSSQGAS--VDLFASGASW 636

Query: 659 L 659
           L
Sbjct: 637 L 637

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  739 bits (1907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/664 (55%), Positives = 462/664 (69%), Gaps = 32/664 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGT--- 63
           TPV    G+PYP+T+ +LI  VG  +++GDRLFAYKFWY+VE+A   +  E D +G    
Sbjct: 3   TPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAK--SPDELDVNGNVQD 60

Query: 64  GTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTL 123
           G  +KK++RES++FF++PFEGT++ W+VD GDEI  PG  +C ++RPC+HD+VY G+CT+
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 124 CGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXX 183
           CG+EVDE +          V  NLT+SH DTNL++SR E                     
Sbjct: 121 CGKEVDERD---------QVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILV 171

Query: 184 XXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKC 243
               QTV+HCGVDPTI EWK DP NPNYE LR+V+SF LEEE ILP +Y+G K P   KC
Sbjct: 172 VDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPV-HKC 230

Query: 244 WYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGS 303
            YYVKVRPGLK+FF+++AP++EMHIYTMATRAYA EIAKIIDPD SLFG+RILSRDENGS
Sbjct: 231 SYYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGS 290

Query: 304 LTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTM 363
           LTHKSLERLFPTDQSMV +IDDRGDVWNW  NLIKV PYNFFVG+GDINSNFLP+QQ TM
Sbjct: 291 LTHKSLERLFPTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATM 350

Query: 364 LQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAA 423
           LQMGRR+      H ++              I++TEK+LQEKID+EVKRQE  L   +AA
Sbjct: 351 LQMGRRN------HNAE---KEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAA 401

Query: 424 GDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRL 483
             E+        + TKK+EFSAS+EVQQ+NRPLA LQKH+HNQ+LL D+DDEL YLK+ L
Sbjct: 402 LGEEAVAQVRNGDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEIL 461

Query: 484 ADLHKRYYSTLK---ENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIW 540
           A +   +Y  L+    N  DT+IQ +M +LK  VF+DC+FVFSGLIPL T++Q ADIV+W
Sbjct: 462 ATVQSEFYKALELKNGNSDDTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLW 521

Query: 541 TNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVK 600
           T  FGA           H+ITKTPGT KAR+AK+FNP IK+VHPDW+FECL  W+ VD K
Sbjct: 522 TKMFGASSTSNITENTTHVITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEK 581

Query: 601 PYLLIVEDPVSEAQVREFKEKL-TRQKERAERQTSRTALL----PANKPAEPDIDLFAGG 655
            + L V+   SE ++ EFK+ L  R K +     + +  L          +  +DLFAGG
Sbjct: 582 SFELKVDQVASERELEEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGG 641

Query: 656 ISWL 659
            SWL
Sbjct: 642 SSWL 645

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/668 (55%), Positives = 460/668 (68%), Gaps = 41/668 (6%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELA---GVDAAAEGDSDGT 63
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE A   GVD      S G 
Sbjct: 3   TQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASETGVDDNEHDASPGG 62

Query: 64  GTTAK------KSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVY 117
           G  +       K +RES+EFFESP+EG ++SW+VD GDE+      +C ++RPCNHD+VY
Sbjct: 63  GAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVY 122

Query: 118 NGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXX 177
            GLCT CG+EV       +A A  GV  ++     D +LQIS  E               
Sbjct: 123 GGLCTQCGKEV-------SADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRD 172

Query: 178 XXXXXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGK- 236
                     QT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232

Query: 237 ---RPAP-RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFG 292
              RP P RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFG
Sbjct: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292

Query: 293 DRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 353 SNFLPKQQPTMLQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKR 412
           SNFLPKQ   MLQ+GR+++  ++  ES+              IM+ EK+LQEKID+EVKR
Sbjct: 353 SNFLPKQSTGMLQLGRKTR--QKSQESQ---------ELLTDIMDNEKKLQEKIDKEVKR 401

Query: 413 QEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDN 472
           QE KLN   A   E+    +SKEE TKKLE+SAS+EVQQ+NRPLA LQKHLH+QKLLVD+
Sbjct: 402 QEEKLNHQLATA-EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDD 460

Query: 473 DDELFYLKDRLADLHKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTN 531
           DDEL+YL   L+++H  YY  L +EN  + N+  I+  LK +VFQ+C FVFSGLIPL T+
Sbjct: 461 DDELYYLMGTLSNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTD 520

Query: 532 VQAADIVIWTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECL 591
           +Q +DIVIWT+ FGA           HLITK P T KARLAK FNP+IKIVHPDWIFECL
Sbjct: 521 IQRSDIVIWTSTFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECL 580

Query: 592 IKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDL 651
           + W++VD KPY LIV+ P+S+ +++ F+ +L +++E  E    +  +L + +    +++L
Sbjct: 581 VNWKKVDEKPYTLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQE----NLNL 636

Query: 652 FAGGISWL 659
           FA G SWL
Sbjct: 637 FATGTSWL 644

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/668 (54%), Positives = 460/668 (68%), Gaps = 41/668 (6%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAG--------VDAAAEG 58
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE A          D +  G
Sbjct: 3   TQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSPGG 62

Query: 59  DSDGTGTTA-KKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVY 117
            +   G +   K +RES+EFFESP+EG ++SW+VD GDE+      +C ++RPCNHD+VY
Sbjct: 63  SAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDIVY 122

Query: 118 NGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXX 177
            GLCT CG+EV       +A A  GV  ++     D +LQIS  E               
Sbjct: 123 GGLCTQCGKEV-------SADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRD 172

Query: 178 XXXXXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGK- 236
                     QT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDG 232

Query: 237 ---RPAP-RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFG 292
              RP P RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFG
Sbjct: 233 SMLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFG 292

Query: 293 DRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDIN 352
           DRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 353 SNFLPKQQPTMLQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKR 412
           SNFLPKQ   MLQ+GR+++  ++  ES+              IM+ EK+LQEKID+EVKR
Sbjct: 353 SNFLPKQSTGMLQLGRKTR--QKSQESQ---------ELLTDIMDNEKKLQEKIDKEVKR 401

Query: 413 QEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDN 472
           QE KLN   A   E+    +SKEE TKKLE+SAS+EVQQ+NRPLA LQKHLH+QKLLVD+
Sbjct: 402 QEEKLNHQLATA-EEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDD 460

Query: 473 DDELFYLKDRLADLHKRYYSTL-KENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTN 531
           DDEL+YL   L+++HK YY  L ++N  + N+  I+  LK +VFQ+C+FVFSGLIPL T+
Sbjct: 461 DDELYYLMGTLSNIHKTYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTD 520

Query: 532 VQAADIVIWTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECL 591
           +Q +DIVIWT+ FGA           HLITK P T KARLAK FNP IKIVHPDWIFECL
Sbjct: 521 IQRSDIVIWTSTFGATSTPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECL 580

Query: 592 IKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDL 651
           + W++VD KPY LIV+ P+S+ +++ F+ +L +++E  E    +  +L + +    +++L
Sbjct: 581 VNWKKVDEKPYTLIVDSPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQE----NLNL 636

Query: 652 FAGGISWL 659
           FA G SWL
Sbjct: 637 FAAGTSWL 644

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/670 (54%), Positives = 460/670 (68%), Gaps = 44/670 (6%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           T + S  GLPYP+ +D+L+P VG  +  GDRL  YKFWY+VE A  D   + D++   T 
Sbjct: 3   TQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERAS-DTTGDDDNEHDATP 61

Query: 67  AK-----------KSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDV 115
                        K +RES+EFFESP+EG ++SW+VD GDEI      +C ++RPCNHD+
Sbjct: 62  GGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDI 121

Query: 116 VYNGLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXX 175
           VY GLCT CG+EV       +A A  GV  ++     D +LQIS  E             
Sbjct: 122 VYGGLCTQCGKEV-------SADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLR 171

Query: 176 XXXXXXXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGG 235
                       QT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+  
Sbjct: 172 RDKKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNE 231

Query: 236 -----KRPAPRKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
                K P  RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYA++IAKI+DP   L
Sbjct: 232 DGSVLKPPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGEL 291

Query: 291 FGDRILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGD 350
           FGDRILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGD
Sbjct: 292 FGDRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGD 351

Query: 351 INSNFLPKQQPTMLQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEV 410
           INSNFLPKQ   MLQ+GR+++  ++  ES+              IM+ EK+LQEKID+EV
Sbjct: 352 INSNFLPKQSTGMLQLGRKTR--QKSQESQ---------ELLTDIMDNEKKLQEKIDKEV 400

Query: 411 KRQEHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLV 470
           KRQE KLN   A   E+ +  +SKEE TKKLE+SAS+EVQQ+NRPLA LQKHLH+QKLLV
Sbjct: 401 KRQEEKLNHQLATA-EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLV 459

Query: 471 DNDDELFYLKDRLADLHKRYYSTLKE-NPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLN 529
           D+DDEL+YL   L+++H  YY  + + N  + N+  I+  LK +VFQ+CHFVFSGLIPL 
Sbjct: 460 DDDDELYYLMGTLSNIHNTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLG 519

Query: 530 TNVQAADIVIWTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFE 589
           T++Q +DIVIWT+ FGA           HLITK P T KARLAK FNP+IKI+HPDWIFE
Sbjct: 520 TDIQRSDIVIWTSTFGATSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFE 579

Query: 590 CLIKWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDI 649
           CL+ W++VD KPY LIV+ P+S+ +++ F+++L +++E  E    +  +L    P E ++
Sbjct: 580 CLVNWKKVDEKPYTLIVDSPISDEELQNFQKQLQKRQEYLEENQQQQHML---TPQE-NL 635

Query: 650 DLFAGGISWL 659
           +LFA G SWL
Sbjct: 636 NLFAAGTSWL 645

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/667 (55%), Positives = 460/667 (68%), Gaps = 40/667 (5%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVE--------LAGVDAAAEG 58
           T + S  GLPYP+ +D+LIP VG  +  GDRL  YKFWY+VE            D++  G
Sbjct: 3   TQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSPGG 62

Query: 59  DSDGTGTTAKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYN 118
              G+ +   K +RES+EFFESP+EG ++SW+VD GDEI      +C ++RPCNHD+VY 
Sbjct: 63  GGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIVYG 122

Query: 119 GLCTLCGREVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXX 178
           GLCT CG+EV       +A A  GV  ++     D +LQIS  E                
Sbjct: 123 GLCTQCGKEV-------SADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDK 172

Query: 179 XXXXXXXXXQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVG--GK 236
                    QT++HCGVDPTI EWK DP NPN+E LRDV+SF L+EE +LP +Y+   G 
Sbjct: 173 KLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGS 232

Query: 237 RPAP---RKCWYYVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGD 293
            P P   RKCWYYVKVRPGLK+FF ++APLFEMHIYTMATRAYAL+IAKI+DP   LFGD
Sbjct: 233 VPKPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGD 292

Query: 294 RILSRDENGSLTHKSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINS 353
           RILSRDENGSLT KSL +LFPTDQSMV VIDDRGDVWNWC NLIKVVPYNFFVGVGDINS
Sbjct: 293 RILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINS 352

Query: 354 NFLPKQQPTMLQMGRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQ 413
           NFLPKQ   MLQ+GR+++  ++  ES+              IM+ EK+LQEKID EVKRQ
Sbjct: 353 NFLPKQSTGMLQLGRKTR--QKSQESQ---------ELITDIMDNEKKLQEKIDIEVKRQ 401

Query: 414 EHKLNKGNAAGDEQQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDND 473
           E +LN   A   E+ +  +SKEE TKKLE+SAS+EVQQ+NRPLA LQKHLH+QKLLVD+D
Sbjct: 402 EEQLNHQLATA-EEPSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDD 460

Query: 474 DELFYLKDRLADLHKRYYSTLKENPQ-DTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNV 532
           DEL YL   L ++HK YY  L +  + + N+  I+  LK +VFQ+C+FVFSGLIPL T++
Sbjct: 461 DELHYLMSTLLNIHKTYYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDI 520

Query: 533 QAADIVIWTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLI 592
           Q +DIVIWT+ FGA           HLITK PGT KARLAK FNP+IK+VHPDWIFECL+
Sbjct: 521 QRSDIVIWTSTFGATSTSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLV 580

Query: 593 KWERVDVKPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLF 652
            W++VD KPY LIV+ P+S+ +++ F+++L +++E  +    +  +L    P E +I+LF
Sbjct: 581 NWKKVDEKPYTLIVDSPISDDELQSFQKQLQKKQEYLDEHHEQQHML---MPQE-NINLF 636

Query: 653 AGGISWL 659
           A G SWL
Sbjct: 637 AAGTSWL 643

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/646 (54%), Positives = 441/646 (68%), Gaps = 31/646 (4%)

Query: 14  GLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTTAKKSVRE 73
            LPYP+T+ +L    GD + +G RLFAYK+W   ++           + T T  KK   +
Sbjct: 10  NLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVT-------SPNDTSTKPKKQRVD 62

Query: 74  SVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGREVDEYEI 133
            +  F+SP EG +VS+++  GDE       +  +++ C HDV Y GLC +CG+ V+EY  
Sbjct: 63  LIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGKSVEEYSS 122

Query: 134 QAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXXXQTVVHC 193
            +A+  S      LT+SH +TN++IS  +                         QTV+HC
Sbjct: 123 NSASDPSQN---KLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQTVIHC 179

Query: 194 GVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYYVKVRPGL 253
           GVDPTIGEW RDP+NPNYEAL+D++SFAL EEPILP  Y+G K PA RKCWYYVK+RPGL
Sbjct: 180 GVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPA-RKCWYYVKLRPGL 238

Query: 254 KQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTHKSLERLF 313
           K+FF+++AP FE+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGS+THKSLERLF
Sbjct: 239 KEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLERLF 298

Query: 314 PTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQMGRRSKLN 373
           P DQSMV +IDDRGDVWNWC NLIKVVPY+FFVGVGDINSNFLP+QQ +ML +GRR +  
Sbjct: 299 PMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRHRKK 358

Query: 374 ERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDEQQTPGQS 433
               E                I++TEK+LQEKID+EVKRQE KL+K     ++Q     S
Sbjct: 359 AEEEE------------LLTDILDTEKKLQEKIDEEVKRQEEKLSK--MTEEKQPEDTNS 404

Query: 434 KEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADLHKRYYST 493
           KE+  KKLE SAS+EVQQ+NRPLA LQKHLHNQKLL+D+DDEL +L   L  +H +YY  
Sbjct: 405 KEDLAKKLEHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYED 464

Query: 494 LKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGAXXXXXXX 553
           L ++    NI+++M QLK RVF  C FVFSGLIPL T+V+ ADI +WT+ FGA       
Sbjct: 465 LSKHSSPPNIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADID 524

Query: 554 XXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEA 613
               H+ITKTPGT KARLAKAFNP+IK+VHPDWIFECL+ W+RVD K Y L++E PVSE 
Sbjct: 525 EATTHIITKTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEE 584

Query: 614 QVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
           ++ +FK+KL  +K+ A+ Q         ++ +  +I+L AG  SWL
Sbjct: 585 ELDDFKKKLENEKKDAQIQEE------VDRVSSDEINLLAGNDSWL 624

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/653 (52%), Positives = 442/653 (67%), Gaps = 30/653 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TP+     LP+P+T+ +L    G+ V++G RLF YK+W   EL  V  A   ++     +
Sbjct: 3   TPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYW---ELQDVITAPNEEA-----S 54

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            KK   + +  F+SP EGT+VS  V  GDE       +  LR+PC+H+V Y  LC +CG+
Sbjct: 55  KKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCGK 114

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
            VDE +  +  + SG     LTV+H +TN+++S  +                        
Sbjct: 115 AVDEDD--SNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDL 172

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTI EW  DP NPNY+AL++V++F+L+E+PILP  Y+G  RP PR+C YY
Sbjct: 173 DQTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-PRPPPRRCQYY 231

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGL++FF ++AP FE+HIYTMATRAYALEIAKIIDP  +LFGDRILSRDENGSLTH
Sbjct: 232 VKLRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTH 291

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFP DQSMV +IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML M
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHM 351

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR +      E                IM+TEK+LQEKIDQEVK+QE K NK   + + 
Sbjct: 352 GRRHRKKAEEEE------------LLTDIMDTEKKLQEKIDQEVKKQEEKFNK--ISEEN 397

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
           Q     SKE+ TKKLE +AS+EVQQ+NRPLA LQKH++NQKLL+D+DDEL +L + L ++
Sbjct: 398 QPDRSMSKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNV 457

Query: 487 HKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGA 546
           H+ YY  L +     +I+ +M Q+K +VF  CHFVFSGLIPL TN++ ADIV+WTN FGA
Sbjct: 458 HRTYYEELAKTEVFPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGA 517

Query: 547 XXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIV 606
                      H+ITKTPGT KARLAK++NPDIKIVHPDWIFECL+KW R D KPY LI+
Sbjct: 518 QTSSDIDENTTHVITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELII 577

Query: 607 EDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAEPDIDLFAGGISWL 659
           E  VS  ++ EF+  L ++++ AE+  +R +L    +    +++L AG   WL
Sbjct: 578 EQEVSSDELEEFQRNL-KKRQMAEK-AARESL---QQETGEELNLLAGNDMWL 625

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/623 (53%), Positives = 429/623 (68%), Gaps = 29/623 (4%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TP+   + LP+PVT+ +L    GD V +G RLF YK+W   EL  +  A   ++      
Sbjct: 3   TPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYW---ELQDIITAPNEEA-----P 54

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            KK   + +  F+SP EGT+VS ++  GDE       +  + + C+H+V Y GLC +CG+
Sbjct: 55  KKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCGK 114

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
            V+E +     + +G     LTV+H +TN+++S  +                        
Sbjct: 115 TVEEDD--QNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDL 172

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTI EW  DP NPNY+AL++V++F+L+E+PILP  Y+G  RP PRKC YY
Sbjct: 173 DQTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMG-PRPPPRKCQYY 231

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGL++FF ++AP FE+HIYTMATRAYALEIAKIIDP   LFGDRILSRDENGSLTH
Sbjct: 232 VKLRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTH 291

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFP DQSMV +IDDRGDVW+WC NLIKVVPYNFFVGVGDINSNFLP+QQ +ML +
Sbjct: 292 KSLERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHL 351

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR++      E                IM+TEK+LQEKIDQEVK+QE K NK N    E
Sbjct: 352 GRRNRKKAEEEE------------LLTDIMDTEKKLQEKIDQEVKKQEEKFNKIN----E 395

Query: 427 QQTPGQ--SKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLA 484
           +  P +  SKE+ TKKLE +AS+EVQQ+NRPLA LQKH++NQKLL D+DDEL +L + L 
Sbjct: 396 ENQPERPISKEDLTKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILL 455

Query: 485 DLHKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKF 544
           ++HK YY  L E  Q  +I+++M Q+K++VF+ CHFVFSGLIPL TNV+ ADIV+WT+ F
Sbjct: 456 NVHKTYYDKLAEQGQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMF 515

Query: 545 GAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLL 604
           GA           H+ITKTPGT KARLAK +NP+IK++HPDWIFECL+KW RV+ KPY L
Sbjct: 516 GATTSVDVDEATTHVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYEL 575

Query: 605 IVEDPVSEAQVREFKEKLTRQKE 627
             E  VS  ++ EFK++L ++K+
Sbjct: 576 TTEQDVSPEELEEFKKRLDKKKQ 598

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/660 (51%), Positives = 432/660 (65%), Gaps = 47/660 (7%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TP+     LPYP+T+ +L    GD V +G RL AYK+W +V++       E         
Sbjct: 3   TPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAGK------ 56

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
           A+K   + V  F+SP  GTVVS DV  GDE      P+  +R+ C HDV Y GLC  CG+
Sbjct: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
            V++     A AA G     LTVSH +T++++S  +                        
Sbjct: 117 AVED----EAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDL 172

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEW +DP NPNYEAL+DVQSF+L+EEP+LP  Y+G K P  RKCWYY
Sbjct: 173 DQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPT-RKCWYY 231

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGLK+FF ++AP FE+HIYTMATRAYALEIAKIIDPD  LFGDRILSRDENGSLT 
Sbjct: 232 VKLRPGLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQ 291

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFP DQSMV VIDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP QQ +ML +
Sbjct: 292 KSLERLFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHL 351

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR++   +  E                I++TEK+L+EKI++EVKRQE ++++      +
Sbjct: 352 GRRNRKKPKQEEE-----------LLTDILDTEKKLKEKINEEVKRQEDQMHRLT----D 396

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
           ++ P     +  KKLE +AS+EVQQ+NRPLA LQKH+ N++LL D+DDEL +L + L  +
Sbjct: 397 EKLP--DTRDIAKKLEHNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKV 454

Query: 487 HKRYYSTLK-----ENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWT 541
           H  YY  L+     E+P   +I+ +M +LK  VF+ C FVFSGLIPL+TN++ ADIV+WT
Sbjct: 455 HSAYYDQLQRYNSGEDPI-PDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWT 513

Query: 542 NKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKP 601
           N FGA           HLIT+TPGT KARLAK+FNP IKIVHPDWIFECL+ WERV+  P
Sbjct: 514 NMFGASTTANLDYNTTHLITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESP 573

Query: 602 YLLIVEDPVSEAQVREFKEKLTRQKERAE--RQTSRTALLPANKPAEPDIDLFAGGISWL 659
           Y LIVE+PV E  +  FK  L   +++ +   Q SR++LL           L  G  SWL
Sbjct: 574 YELIVEEPVGEEYLENFKRDLAEAQKKVDPPAQDSRSSLL-----------LLDGNGSWL 622

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  652 bits (1681), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/662 (50%), Positives = 433/662 (65%), Gaps = 36/662 (5%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           TP+     LPYP+TV +L    GD V RG RLFAYK+W   ++      + GD    G +
Sbjct: 3   TPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIV----TSPGDESAGGKS 58

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            ++ + + V  F+SP  G VVS ++  GDE       +  +++PC HDV Y GLC  CG+
Sbjct: 59  KRQRI-DLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQCGQ 117

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
            V++ +   +   +      LT+SH + N++IS  +                        
Sbjct: 118 TVEDEQTSGSLLDNQA---KLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVDL 174

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEW +DP NPNYE+L+DV+SF+L EEP+LP  Y+G K P  RKCWYY
Sbjct: 175 DQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPK-PPTRKCWYY 233

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGL+ FF  +AP FE+HIYTMATR YALEIAKIIDPD +LFGDRILSRDENGSLT 
Sbjct: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFP DQSMV +IDDRGDVWNWC NLIKVVPY+FFVG+GDINSNFLP+QQ +ML +
Sbjct: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GRR++   +  E                I++TEK+L+ KI +EVKRQE ++ K +    E
Sbjct: 354 GRRNRKKLKQDEE-----------LLTDILDTEKKLKVKISEEVKRQEEEMQKLS----E 398

Query: 427 QQTPGQ--SKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLA 484
           ++ P    SKE+  KKLE +AS+EVQQ+NRPLA LQKHLHN++LL+D+DDEL +L D L 
Sbjct: 399 EKIPDHTTSKEDIAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILL 458

Query: 485 DLHKRYYSTLKENPQDT-----NIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVI 539
            +H  YY  L++N         +I+ ++  LK  VF+ C+FVFSGLIPL+TN+  ADIV+
Sbjct: 459 RVHSAYYDQLEKNKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVL 518

Query: 540 WTNKFGAXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDV 599
           WTN FGA           HLITKTPGT KARLA +FN DIKIVHPDWIFEC++ W+RVD 
Sbjct: 519 WTNTFGAKTTINIDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDE 578

Query: 600 KPYLLIVEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANK--PAEPDIDLFAGGIS 657
           KPY LIVE+PVS+  +  FK++L   +E  + + S  A + + K       + L  G  S
Sbjct: 579 KPYELIVEEPVSKEYLENFKKEL---EETEKSKNSVDANISSQKYETFNDAMILLGGSDS 635

Query: 658 WL 659
           WL
Sbjct: 636 WL 637

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/657 (50%), Positives = 423/657 (64%), Gaps = 39/657 (5%)

Query: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66
           T V   + LPYP+TV +L  + GD V +G RLFAY++W   +   V    E         
Sbjct: 5   TNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYW---DFQDVLVKYE-------EK 54

Query: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126
            KK   + V  F+SP  GTV  W     DE       +  +R+ CNHD+ Y GLC  CG 
Sbjct: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114

Query: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEXXXXXXXXXXXXXXXXXXXXXXXX 186
            VDE +             NLT+SH +TN+++S  +                        
Sbjct: 115 TVDEED----------NSKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDL 164

Query: 187 XQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246
            QTV+HCGVDPTIGEW RDP+NPNY+AL+DV+SF LE+EPI+P  Y G K PA RK WYY
Sbjct: 165 DQTVIHCGVDPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPA-RKSWYY 223

Query: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306
           VK+RPGLK+FF+ ++P FEMHIYTMATR+YA EIAKIIDP   LFGDRILSRDENGSLT 
Sbjct: 224 VKLRPGLKEFFEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTT 283

Query: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366
           KSLERLFP DQSMV VIDDRGDVWNW  NLIKVVPY+FFVG+GDINSNFLP+QQ ++L +
Sbjct: 284 KSLERLFPMDQSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHL 343

Query: 367 GRRSKLNERGHESKXXXXXXXXXXXXXXIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426
           GR  +   R  E +              I++ EK+L+EKID+EVKRQE  ++        
Sbjct: 344 GRHHR---RKQEEE---------KLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTR 391

Query: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486
           ++    +KE+ +KKLE SAS+EVQQ+NRPLA LQKHLHNQ LL+D+DDEL +L   L  +
Sbjct: 392 KEGGPPNKEDISKKLEHSASLEVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRV 451

Query: 487 HKRYYSTLKENPQD-TNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFG 545
           HK Y++   E P++  +I+ ++ Q+K +VFQ CHFVFSGLIPL T+V+ ADIV+WT+ FG
Sbjct: 452 HKEYFNQYTEAPKNPPDIKYLLPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFG 511

Query: 546 AXXXXXXXXXXXHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605
           A           H+IT T  T KARLAK+FNPDIKIVHPDW+FECL++WERV   PY L+
Sbjct: 512 ATTSSDINYKTTHIITTTSRTFKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELL 571

Query: 606 VEDPVSEAQVREFKEKLTRQKERAERQTSRTALLPANKPAE---PDIDLFAGGISWL 659
           ++DPV E +V+EFKEKL   K+ +   +S       N+  E    +  L AG  SWL
Sbjct: 572 IQDPVDEDKVKEFKEKL--DKKISNPSSSVNPFEDGNEDEEVLGDEFHLLAGNDSWL 626

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 296
           YV  RPG+++F KR+  LFE+ ++T +   Y   +  I+DP + L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 296
           YV  RPG+ +F KR++ L+E+ ++T +   Y   +  I+DP  ++   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 28/45 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F +R+  L+E+ ++T +   Y   +  I+D DKS+
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F K++  LFE+ I+T +   Y   +  I+D  KS+
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDKHKSV 394

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F +R+  L+E+ ++T +   Y   +  I+D DK++
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 39.3 bits (90), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  +FE+ ++T +   Y   +  I+D  KS+
Sbjct: 345 YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDK 288
           YV  RPG+++F +R+  LFE+ ++T +   Y   +  I+D DK
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDK 337

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDK 288
           YV  RPG+++F +R+  LFE+ ++T +   Y   +  I+D DK
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADK 324

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDK 288
           YV  RPG+++F +R+  LFE+ ++T +   Y   +  I+D DK
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDK 325

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 38.5 bits (88), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 29/45 (64%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F  R++ L+E+ ++T +   YA  +   +DP++++
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 38.1 bits (87), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  L+E+ ++T +   Y   +  I+D  KS+
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQHKSI 322

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.7 bits (86), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  L+E+ ++T +   Y   +  I+D  K++
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTI 365

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  LFE+ ++T +   Y   +  I+D  K++
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILDQYKAV 390

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 37.7 bits (86), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 30/93 (32%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305
           YV  RPG+ +F  R++ L+E+ ++T +   YA  +   +DP              NG++ 
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDP--------------NGTIH 310

Query: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIK 338
           H    RLF            R   +N+  N IK
Sbjct: 311 H----RLF------------REACYNYEGNYIK 327

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 25/43 (58%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDK 288
           YV  RPG+ +F K +  L+E+ ++T +   Y   +  I+DP K
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDPHK 362

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F +R+A L+E+ ++T +   Y   +  I+D   S+
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKS----LFGDRILSRDEN 301
           YV  RPG+ +F +R+  L+E+ ++T +   Y   +  I+DP  +    LF D   + D N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  +FE+ ++T +   Y   +  ++D  KS+
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLDKGKSI 395

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F  R+  L+E+ ++T +   YA  +   +DP+ ++
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 27/43 (62%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDK 288
           YV  RPG+++F +R+  LFE+ ++T +   Y   +  I+D +K
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTNK 325

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ +F KR+  L+E+ ++T +   Y   +  I+D   S+
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILDQSNSV 310

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 28/51 (54%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 296
           YV  RPG+ +F + +   +E+ I+T +   YA  +  ++D D +L   R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>Ecym_2066 Chr2 complement(110523..113165) [2643 bp, 880 aa] {ON}
           similar to Ashbya gossypii ADL145C
          Length = 880

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 45/115 (39%), Gaps = 11/115 (9%)

Query: 511 KTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKF---GAXXXXXXXXXXXHLITKTPGTN 567
           KT   +DC+   S     +    AA+  ++T+     G            H+IT  P   
Sbjct: 115 KTHFMKDCYVYVS-----SQQFSAAEYELYTSMLTYMGGCCMDYLSTKVTHIITSDPKDQ 169

Query: 568 KARLAKAFNP-DIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEAQVREFKEK 621
              + K FN  ++  V   W+ EC ++ E V    YL  V   +S  +V    EK
Sbjct: 170 AVLVLKRFNKFEVLTVSSAWLAECFVRQEYVSEAAYL--VGSEMSNEEVTALAEK 222

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 30/93 (32%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLT 305
           YV  RPG+ +F  R++ ++E+ ++T +   YA  +   +DP              NG++ 
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDP--------------NGTIH 305

Query: 306 HKSLERLFPTDQSMVTVIDDRGDVWNWCANLIK 338
           H    RLF            R   +N+  N IK
Sbjct: 306 H----RLF------------REACYNYEGNYIK 322

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 34.7 bits (78), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 24/40 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIID 285
           YV  RPG+ +F +R+  L+E+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 296
           YV  RPG+  F +  + LFE+ I+T +   Y   +  I+D    L   R+ 
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLF 267

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRIL 296
           YV  RPG+ +F +++  LFE+ I+T +   Y   +   +DP       R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIID 285
           YV  RPG+ +F +R+  L+E+ ++T +   Y   +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 12/45 (26%), Positives = 26/45 (57%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSL 290
           YV  RPG+ QF + ++ +FE+ ++T +   Y   +  ++D  + +
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDKHRCI 600

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 33.5 bits (75), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%)

Query: 558 HLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLL 604
           H I        A L +A N +I IV P+WI  C ++   V V+ + L
Sbjct: 214 HFICNDEEEEDAELIRAKNSNIPIVRPEWIRACAVEKRIVGVRGFYL 260

>Ecym_7276 Chr7 complement(579526..581307) [1782 bp, 593 aa] {ON}
           similar to Ashbya gossypii AGL051C
          Length = 593

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 29/56 (51%)

Query: 558 HLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSEA 613
           H +     ++   LA+A N +I +V P+WI  C ++   V V+ + L V+    E+
Sbjct: 213 HFVCNDAQSDDKELARAKNGNIPVVRPEWIRACELEKRIVGVRGFYLDVDSSTLES 268

>CAGL0B03289g Chr2 (319012..321624) [2613 bp, 870 aa] {ON} similar
           to uniprot|P38149 Saccharomyces cerevisiae YBR281c
          Length = 870

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 2/40 (5%)

Query: 202 WKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPR 241
           W  DP N  Y  LRD  + A E+EP+  F+  GG  P  R
Sbjct: 785 WLGDPNNHAYRVLRDELALAWEKEPL--FVREGGSIPCLR 822

>NCAS0J00880 Chr10 complement(146472..148172) [1701 bp, 566 aa] {ON}
           Anc_4.156 YLR330W
          Length = 566

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 25/48 (52%)

Query: 565 GTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIVEDPVSE 612
           G     L KA N +I IV P+WI  C ++   V V+ + +  E  VS+
Sbjct: 224 GEEDEELQKAKNNNIPIVKPEWIRACCVEKRIVGVRAFYVGAESTVSD 271

>Smik_14.187 Chr14 complement(340387..345168) [4782 bp, 1593 aa] {ON}
            YNL139C (REAL)
          Length = 1593

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 15/75 (20%)

Query: 453  NRPLATLQKHLHNQKLLVDNDDE-------------LFYLKDRLADLHKRYYSTLKENPQ 499
            N  LAT   HLH    LV+ND+E             +F  ++ + ++ +RY+ TL +NPQ
Sbjct: 1305 NHYLAT--NHLHKAISLVENDNEAWNLKKLSKKNMPIFDYRNSILEIFERYFRTLIQNPQ 1362

Query: 500  DTNIQSIMTQLKTRV 514
            + +    +  LK  +
Sbjct: 1363 NPDFAEKIDTLKRHI 1377

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 4/60 (6%)

Query: 246 YVKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKS----LFGDRILSRDEN 301
           YV  RPG+ +F K +  L+E+ ++T +   Y   +  ++D  +     LF D   + D N
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLDQTQCIHHRLFRDSCYNYDGN 337

>Kpol_1016.19 s1016 complement(46243..48522) [2280 bp, 759 aa] {ON}
           complement(46243..48522) [2280 nt, 760 aa]
          Length = 759

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 37/92 (40%), Gaps = 8/92 (8%)

Query: 521 VFSGLIPLNTNVQAADIVIWTNKFGAXXXXXXXXXXXHLITK-------TPGTNKARLAK 573
           +F G I  N+N    D+V    K G              +TK       T   N AR+  
Sbjct: 124 LFIGRIS-NSNFNIDDLVKKCEKLGVSYCNSTNFIMNFSVTKNKPVLFITDTLNGARVDA 182

Query: 574 AFNPDIKIVHPDWIFECLIKWERVDVKPYLLI 605
           A   ++ +VH  WI +C  +   +D  PY L+
Sbjct: 183 AREKNLPVVHFKWILDCERRNATLDYDPYYLL 214

>KLLA0D12870g Chr4 (1097784..1099538) [1755 bp, 584 aa] {ON} similar
           to uniprot|P38687 Saccharomyces cerevisiae YPL243W SRP68
           Component of the signal recognition particle (SRP)
           ribonucleoprotein (RNP) complex that functions in
           protein targeting to the endoplasmic reticulum (ER)
           membrane
          Length = 584

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 44/84 (52%), Gaps = 6/84 (7%)

Query: 429 TPGQSKE-EWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADLH 487
           +  QS+E  W     +SA++E  +     + L + LHN   L + +D+LF   +R  DL 
Sbjct: 248 SKSQSREISWR---SYSATIEDSKVFEVYSELAE-LHNSSKLSNLNDKLFKW-NRAIDLQ 302

Query: 488 KRYYSTLKENPQDTNIQSIMTQLK 511
           K Y +T  E+  D N Q ++T L+
Sbjct: 303 KEYMTTCSEDDTDENNQILLTYLQ 326

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,395,942
Number of extensions: 2996915
Number of successful extensions: 11097
Number of sequences better than 10.0: 94
Number of HSP's gapped: 11290
Number of HSP's successfully gapped: 95
Length of query: 742
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 625
Effective length of database: 40,065,477
Effective search space: 25040923125
Effective search space used: 25040923125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)