Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002708.840ON62562533910.0
NCAS0C004108.840ON62561921270.0
YMR278W (PGM3)8.840ON62261921060.0
Smik_13.4918.840ON62262221020.0
Suva_13.4668.840ON62262020700.0
CAGL0M02981g8.840ON61761420310.0
NDAI0K004108.840ON62662020260.0
TDEL0B005708.840ON63062019890.0
TPHA0I002508.840ON62962619830.0
Skud_13.4508.840ON62262019790.0
Kpol_1068.88.840ON63262319730.0
SAKL0D01474g8.840ON62462319720.0
ZYRO0G14190g8.840ON61061719390.0
TBLA0B032508.840ON64363918940.0
KAFR0B039208.840ON62462018780.0
KLTH0C03872g8.840ON62162718470.0
Kwal_27.102588.840ON62062118260.0
KLLA0D01573g8.840ON60762817800.0
ABL126W8.840ON62462317810.0
Ecym_46118.840ON63062517410.0
TDEL0E00210singletonON5704191252e-06
Suva_13.2822.445ON5694901243e-06
CAGL0K03421g2.445ON5684151216e-06
Smik_13.2912.445ON5693711172e-05
TDEL0A022102.445ON5724871172e-05
NCAS0F014702.445ON5694451153e-05
ZYRO0G02508g2.445ON5694491127e-05
CAGL0K07480g2.445ON5673701119e-05
Skud_13.2632.445ON5694181092e-04
KNAG0E023902.445ON5694881092e-04
KAFR0D030102.445ON5695841073e-04
YMR105C (PGM2)2.445ON5693711073e-04
KNAG0A062802.445ON5702941054e-04
NCAS0A043502.445ON5694861054e-04
TPHA0G029002.445ON5691581046e-04
Kpol_1033.542.445ON5704881037e-04
TBLA0B090102.445ON5694921038e-04
KLTH0D04796g2.445ON5703741020.001
KLLA0B12694g2.445ON568447980.004
SAKL0E03630g2.445ON571375970.004
TBLA0G009806.11ON55895970.005
TPHA0G024702.445ON569128950.008
Smik_5.296.11ON55574940.010
NDAI0H023502.445ON569371930.012
Smik_11.1122.445ON570370930.012
NDAI0K028906.11ON56166920.018
YEL058W (PCM1)6.11ON55773910.020
CAGL0B03597g6.11ON54050910.024
Skud_11.1022.445ON570126910.025
ABL029W2.445ON568262900.028
NCAS0F002006.11ON54928900.029
Suva_11.982.445ON570126900.031
Skud_5.316.11ON55774890.034
TDEL0G046006.11ON52828890.036
Kwal_26.76282.445ON570127880.046
Kpol_1032.26.11ON53977880.048
TBLA0I013802.445ON571371880.048
Suva_5.106.11ON55374880.049
KAFR0L003406.11ON54028870.066
YKL127W (PGM1)2.445ON570378860.095
ZYRO0F00506g6.11ON55048850.12
KNAG0E009406.11ON53821830.20
KLTH0C11506g6.11ON544113830.23
KLLA0D00858g6.11ON54119820.25
Ecym_24752.445ON567427820.25
SAKL0E00902g6.11ON54419820.26
Kwal_56.223556.11ON54120820.29
ACR015W6.11ON55271800.41
TPHA0M002106.11ON54547761.2
Kpol_1018.1612.445ON569125761.3
Ecym_30146.11ON55158761.3
NCAS0B025808.467ON57372752.0
ADR120C1.301ON54283732.8
NDAI0C02220singletonON308308723.8
NDAI0C023205.241ON76474716.2
Skud_3.179singletonON344117699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00270
         (625 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...  1310   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   823   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   815   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   814   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   801   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   786   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   785   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   770   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   768   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   766   0.0  
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...   764   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   764   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   751   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   734   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   728   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   716   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   707   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   690   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   690   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   675   0.0  
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    53   2e-06
Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {...    52   3e-06
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    51   6e-06
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    50   2e-05
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    50   2e-05
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    49   3e-05
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    48   7e-05
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    47   9e-05
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    47   2e-04
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    47   2e-04
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    46   3e-04
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    46   3e-04
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               45   4e-04
NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.4...    45   4e-04
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               45   6e-04
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    44   7e-04
TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa] ...    44   8e-04
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    44   0.001
KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} high...    42   0.004
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    42   0.004
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    42   0.005
TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.4...    41   0.008
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    41   0.010
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    40   0.012
Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127...    40   0.012
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    40   0.018
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    40   0.020
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    40   0.024
Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127...    40   0.025
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    39   0.028
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    39   0.029
Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C...    39   0.031
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    39   0.034
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    39   0.036
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    39   0.046
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    39   0.048
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    39   0.048
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    39   0.049
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    38   0.066
YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}  PGM1Phosp...    38   0.095
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    37   0.12 
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    37   0.20 
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    37   0.23 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.25 
Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}...    36   0.25 
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    36   0.26 
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    36   0.29 
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    35   0.41 
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    34   1.2  
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    34   1.3  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    34   1.3  
NCAS0B02580 Chr2 complement(431287..433008) [1722 bp, 573 aa] {O...    33   2.0  
ADR120C Chr4 complement(917400..919028) [1629 bp, 542 aa] {ON} S...    33   2.8  
NDAI0C02220 Chr3 (494856..495781) [926 bp, 308.666666666667 aa] ...    32   3.8  
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241     32   6.2  
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    31   9.2  

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 1310 bits (3391), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 625/625 (100%), Positives = 625/625 (100%)

Query: 1   MDKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGT 60
           MDKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGT
Sbjct: 1   MDKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGT 60

Query: 61  AGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAV 120
           AGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAV
Sbjct: 61  AGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAV 120

Query: 121 FLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQI 180
           FLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQI
Sbjct: 121 FLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQI 180

Query: 181 IPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGG 240
           IPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGG
Sbjct: 181 IPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGG 240

Query: 241 RKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSF 300
           RKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSF
Sbjct: 241 RKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSF 300

Query: 301 PNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAY 360
           PNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAY
Sbjct: 301 PNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAY 360

Query: 361 QQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLE 420
           QQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLE
Sbjct: 361 QQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLE 420

Query: 421 KKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKY 480
           KKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKY
Sbjct: 421 KKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKY 480

Query: 481 GVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTS 540
           GVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTS
Sbjct: 481 GVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTS 540

Query: 541 DHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQ 600
           DHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQ
Sbjct: 541 DHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQ 600

Query: 601 LAKQMWDTLQEVWFRPQTTGLVTDF 625
           LAKQMWDTLQEVWFRPQTTGLVTDF
Sbjct: 601 LAKQMWDTLQEVWFRPQTTGLVTDF 625

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/619 (62%), Positives = 472/619 (76%), Gaps = 3/619 (0%)

Query: 9   LQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRME 68
           L N PE L+  I  WLRLD+NEETR+EVL LC+ ++W EL+ RF  RI+FGTAGLRSRME
Sbjct: 8   LSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSRME 67

Query: 69  AGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKV 128
           AG +R+NSL+ILQ+TQGLA YI  QFP N  AVVGHDHRFHSKEFA VTA++FLRAGFKV
Sbjct: 68  AGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGFKV 127

Query: 129 LYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNI 188
            YL P D  VHTPLVPF+V +L ASVGVMITASHNPKMDNGYKVY+ N CQIIPPHD NI
Sbjct: 128 FYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDKNI 187

Query: 189 ARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPG 248
           A  I +NLEPW  SWDW    +   + +++V++KD MT+ Y    +  LI    +     
Sbjct: 188 AEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHLSLKDV 247

Query: 249 SGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGA 308
             P+FVYTPMHGVG+EIF+++S ++L + EN DYL V EQ+ PDPSFPTVSFPNPEEKGA
Sbjct: 248 KTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEEKGA 307

Query: 309 LDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKA 368
           L  AI+LA +NG++LVIANDPDADRFS AV + KT  WRQLTGNEIGFL  Y +F++Y+ 
Sbjct: 308 LSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQLYEQ 367

Query: 369 MDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPF 428
            D  F+K HPL ++NSTVSSQMIK+MA++ GFHYEDTLTGFKWIGN+A DL ++G++ PF
Sbjct: 368 QDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYYVPF 427

Query: 429 GYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNG 488
           G+EEAIGYMF  ME DKDGISA+ +FL +Y HW+      P DI+E+G+ K+GVFKEYNG
Sbjct: 428 GFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKEYNG 487

Query: 489 YYIVDNPKIMKETFDYIRNDRKPGT--QYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTL 546
           YYI+ +  I K  FD+IR++  P T  +YP  IG+E  V  FRDLT+G+QS+T D+IP L
Sbjct: 488 YYILKDLSITKTVFDFIRHEY-PSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIPNL 546

Query: 547 PVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMW 606
           PVDP SQMITV AKP+  +     VR T+RGSGTEPKLKVYIEACS SE  A  LA+  W
Sbjct: 547 PVDPTSQMITVEAKPSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLARSTW 606

Query: 607 DTLQEVWFRPQTTGLVTDF 625
           D L+  WFRP+ TGL T F
Sbjct: 607 DILKREWFRPEVTGLTTSF 625

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  815 bits (2106), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/619 (62%), Positives = 473/619 (76%), Gaps = 2/619 (0%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           IL+  P  L+  I  W + D+N +T  EV  LC++ DW+EL+ RF  RI FGTAGLRS+M
Sbjct: 5   ILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLRSQM 64

Query: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127
           +AG +R+N+LV++QA+QGLA Y+  QFP N VAVVGHDHRFHSKEFA  TAA FL  GFK
Sbjct: 65  QAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLKGFK 124

Query: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187
           V YLNP    VHTPLVPF VD L ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD  
Sbjct: 125 VHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDHA 184

Query: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNP 247
           I+ SID NLEPW   WD+  V+  A K+ +++Y +++M +LY +     L+    +    
Sbjct: 185 ISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLKLEV 244

Query: 248 GSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKG 307
            + PWFVYTPMHGVG +IFS I +  L + E +DYLCVPEQ++PDPSFPTV FPNPEEKG
Sbjct: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304

Query: 308 ALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYK 367
           ALD  I LA ++ I+L++ANDPDADRFS+AV D ++  WRQLTGNEIGFLFA+ +++ YK
Sbjct: 305 ALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEYQKYK 364

Query: 368 AMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAP 427
           +MD  FQ  HPL +LNSTVSSQMIKKMAE+EGFHYEDTLTGFKWIGNRA  LEKKG++ P
Sbjct: 365 SMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKGYYVP 424

Query: 428 FGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYN 487
           FG+EEAIGYMF  MEHDKDGISAS++FL +Y  W  D +  PL++LE+G+KKYGVFKEYN
Sbjct: 425 FGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVFKEYN 484

Query: 488 GYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTL 546
           GYY+V NP + K+ FDYIRN   P G  YP +IG E +V+ +RDLT G+QSDT +H PTL
Sbjct: 485 GYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINHKPTL 544

Query: 547 PVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMW 606
           PVDP SQMITV A+P++ + E +H+RFTIRGSGTEPKLKVYIEAC+  E  A  LAK  W
Sbjct: 545 PVDPTSQMITVSARPSNGS-ENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAKLTW 603

Query: 607 DTLQEVWFRPQTTGLVTDF 625
           + L+  WFRP    +VT F
Sbjct: 604 NVLRREWFRPDEMNIVTKF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  814 bits (2102), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/622 (61%), Positives = 471/622 (75%), Gaps = 2/622 (0%)

Query: 5   TLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLR 64
           +L  L+  P  L+  I  W   D+N ET  EV  LC++ DW+EL+ RF  RI FGTAGLR
Sbjct: 2   SLQFLEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLR 61

Query: 65  SRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRA 124
           S+M+AG NR+N+LVI+QA+QGLA Y   QFP N VAVVGHDHRFHSKEFA  TA  FL  
Sbjct: 62  SQMQAGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLK 121

Query: 125 GFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPH 184
           GFKV YLNP    VHTPLVPF VD L ASVGVM+TASHNPKMDNGYKVY++NGCQIIPPH
Sbjct: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 185 DLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVL 244
           D  I+ SID NLEPW   W++  V+    K+ +++Y ++++ +LY       L+G   + 
Sbjct: 182 DHAISDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK 241

Query: 245 RNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPE 304
               + PWFVYTPMHGVG +IFS I +  + + E +DYLCVPEQ+ PDPSFPTV+FPNPE
Sbjct: 242 FEVKAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPE 301

Query: 305 EKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFE 364
           EKGALD  I LA  +GINL+IANDPDADRFS+A+ D ++  WRQLTGNEIGFLFA  +F+
Sbjct: 302 EKGALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQ 361

Query: 365 MYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGF 424
            +K+M+  FQ  HPL +L+STVSSQMIKKMAEVEGFHYE+TLTGFKWIGNRA  LEK+G+
Sbjct: 362 KFKSMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGY 421

Query: 425 FAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFK 484
           + PFG+EEAIGYMF  MEHDKDG+SAS++FL +Y  W  D +  P+ ILEDG+KKYGVFK
Sbjct: 422 YVPFGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFK 481

Query: 485 EYNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHI 543
           EYNGYYIV +P +  E FDYIRN   P G  YP +IG E +V+++RDLT+G+QSDTS+H 
Sbjct: 482 EYNGYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHK 541

Query: 544 PTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAK 603
           PTLP+DP+SQMITV AKP+  N E +H+RFTIRGSGTEPK+KVYIEAC+  E  A  LAK
Sbjct: 542 PTLPIDPSSQMITVSAKPSDGN-EGEHIRFTIRGSGTEPKIKVYIEACADEEQRATFLAK 600

Query: 604 QMWDTLQEVWFRPQTTGLVTDF 625
             W+ L+  WFRP+   +VT F
Sbjct: 601 LTWNVLKREWFRPEKMDIVTHF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  801 bits (2070), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/620 (61%), Positives = 463/620 (74%), Gaps = 2/620 (0%)

Query: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66
            +L+  P  L+  I  W   D+N ET  EV  LC+  DW EL+ RF  RI FGTAGLRS 
Sbjct: 4   QLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLRSE 63

Query: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126
           M+AG +R+N+LVI+QATQGLA YI  QFP N V VVGHDHRFHSKEFA  TA  FL  GF
Sbjct: 64  MQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLKGF 123

Query: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186
           KV YLNP    VHTPLVPF VD L ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 124 KVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDH 183

Query: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246
            I+ SID NLEPW   W +  V+  A K+ +++Y +++M  LY+K     L+    +   
Sbjct: 184 AISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLKLE 243

Query: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306
             + PWFVYTPMHGVG  IFS I +  + + E EDYLCVPEQ++PDPSFPTV FPNPEEK
Sbjct: 244 IKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366
           GALD  + LA ++ INL++ANDPDADRFS+AV D++++ WRQLTGNEIGFLFA+ +F+ Y
Sbjct: 304 GALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEFQRY 363

Query: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426
           K  D+ FQ+ HPL +L+STVSSQMIKKMAEVEGF YEDTLTGFKWIGNRA  LEK+G++ 
Sbjct: 364 KNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486
           PFG+EEAIGYMF  MEHDKDGISA+++ L +Y  W  D++  P+DILE+G++KYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVFKEY 483

Query: 487 NGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545
           NGYY+V +P +  E F+YIRN   P G  YP +IG E +VV +RDLT G+QSDT DH P 
Sbjct: 484 NGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDHKPV 543

Query: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605
           LPVDP SQMIT+  KP+  N   +H+RFTIRGSGTEPKLKVYIEAC+ +E  A  LAK  
Sbjct: 544 LPVDPTSQMITLSGKPSDGN-GNEHIRFTIRGSGTEPKLKVYIEACADNEKRASYLAKLT 602

Query: 606 WDTLQEVWFRPQTTGLVTDF 625
           WD L+  WFRP+   + TDF
Sbjct: 603 WDVLRRGWFRPEIMNITTDF 622

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/614 (61%), Positives = 459/614 (74%), Gaps = 4/614 (0%)

Query: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72
           P  L+  I  WL+LDKNEETR EV+ LC  Q+W EL+ RF  RI+FGTAGLR+RMEAGTN
Sbjct: 7   PVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGTN 66

Query: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132
           RLN LVILQA+QGLA YI  +FP+N  AVVGHDHR+HS+EFA VTAA F+RAGFKV YLN
Sbjct: 67  RLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYLN 126

Query: 133 PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSI 192
           P D  VHTP+VP++VDHLNASVGVMITASHNPKMDNGYKVY+ NGCQIIPPHD  IA +I
Sbjct: 127 PHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETI 186

Query: 193 DQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW 252
           + NLEPW   W++  ++  AE + +I YV+ +M   Y  +   QLI  ++    P   PW
Sbjct: 187 NNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLI--QRDFAAPDEKPW 244

Query: 253 FVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKA 312
           FVYTPMHGVG +IFS I  + L +K+N DY+ VPEQK PDPSF TVSFPNPEEKGAL+ A
Sbjct: 245 FVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKGALNLA 304

Query: 313 IELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDI 372
           I LA  NGI LV+ANDP+ADRFS+AV D     W+QLTGNEIG LFA+ +F+MY+   D 
Sbjct: 305 ITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQKAADK 364

Query: 373 FQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGYEE 432
             K  PL +LNSTVS+Q+IK+MAE EGF Y+DTLTGFKWIGN A  LE+KG+F PFGYEE
Sbjct: 365 GIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVPFGYEE 424

Query: 433 AIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYYIV 492
           AIGYMF  MEHDKDG+SA+++FL +Y +W+  +   P+DI+ + Y KYGV  EYNGYYIV
Sbjct: 425 AIGYMFPAMEHDKDGVSAAIVFLQAYANWLQSSSN-PIDIIHECYDKYGVSAEYNGYYIV 483

Query: 493 DNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVDPN 551
            +P    + F+ IR+     G  +PE+IG  F+V  FRDLT+GF S T+D  P LPVD N
Sbjct: 484 SDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLLPVDKN 543

Query: 552 SQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTLQE 611
           SQMIT+ A P+  +   + VRFTIRGSGTEPKLKVYIE  S +E  A+ LAK +W+TL+ 
Sbjct: 544 SQMITITAVPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKSLWETLKH 603

Query: 612 VWFRPQTTGLVTDF 625
            WF+P + GL TDF
Sbjct: 604 EWFKPSSNGLSTDF 617

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/620 (60%), Positives = 474/620 (76%), Gaps = 3/620 (0%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           I  + P  L+  I  WLR DK EETR EV+ LC+  +W EL+ RF  RI+FGTAGLRSRM
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127
           EAG +R+N LVILQA+QGLA+YI +QFP N  AVVGHDHRFHSK+FA +TA+VFLR GFK
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187
           V YLNP D+ VHTPLVPF+V+HLNAS+GVMITASHNPKMDNGYKVY++NGCQIIPPHD N
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR-KVLRN 246
           IA +ID+NLEPW   W+W +  +   KE ++VYV+++MT  Y +  +  L+        N
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306
            G  PWFVYTPMHGVG  IF++IS+++L  +EN DY  V EQ +PDP+FPTVSFPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366
           GAL  A +LA +N I+LVIANDPDADRFS+A  + KT  W+QL+GNEIGFLFA  + E Y
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426
            + D  +++ HPL ++NSTVSSQMIKKMA+VE FHYEDTLTGFKWIGNRA DL+ +G++ 
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486
           PFG+EEAIGYMF  M  DKDG+SA+++FLL+Y +W+ +   +P DILE G+KK+G FKEY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 487 NGYYIVDNPKIMKETFDYIRNDR-KPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545
           NGYYI D+PK  K+ FD++R      G  YP+ IG EF++  FRDLT G+QS+T D++P 
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605
           LPVDP+S+MIT+ A P  D + +  VRFT+RGSGTEPKLK+YIEA + +E  A  LA +M
Sbjct: 548 LPVDPHSEMITIEAVPKQD-IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAYEM 606

Query: 606 WDTLQEVWFRPQTTGLVTDF 625
           W+ L++ W RP  TGL T F
Sbjct: 607 WNVLKKEWIRPDVTGLTTTF 626

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  770 bits (1989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/620 (59%), Positives = 457/620 (73%), Gaps = 2/620 (0%)

Query: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66
            ++ + P  L   +  WL  D N++TR E+L+LC+ +DW EL+ R   RILFGTAGLRSR
Sbjct: 12  EVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTAGLRSR 71

Query: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126
           MEAG +R+N+LV+LQATQGLA++I  QFP    AVVGHDHRF+S+EFA  T A FL+AGF
Sbjct: 72  MEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATFLQAGF 131

Query: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186
           KV++LN GD  VHTP+VPFTV+ + ASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 132 KVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDS 191

Query: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246
            IA+SI++NL  W  +W W  +++       +VY  ++M + YTK     L+    +   
Sbjct: 192 EIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRTTISAE 251

Query: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306
               PWFVYTP+HGVG +IF +I+E+ + +    DYLCV EQ+ PDPSFPTV FPNPEEK
Sbjct: 252 KEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPFPNPEEK 311

Query: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366
           GALD AI +A +NGI+LV+ANDPDADRFS AV D+KT  WRQLTGNEIG LFA+ +F+ Y
Sbjct: 312 GALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAFYEFQKY 371

Query: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426
           +  ++ ++++HPL +LNSTVSSQ+I KMAE+E FHY DTLTGFKWIGNR  DLE   ++ 
Sbjct: 372 QKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLEAMNYYV 431

Query: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486
           PFG+EEAIGYMF  MEHDKDGISA+ +FL  Y  W+  + K  L +LED ++KYGVFKEY
Sbjct: 432 PFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKYGVFKEY 491

Query: 487 NGYYIVDNPKIMKETFDYIRND-RKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545
           NGYY V++PK++KE FD+IRND  +    YP  IG E +V  FRDLTLG+QSDT +  P 
Sbjct: 492 NGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDTVNQRPD 551

Query: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605
           LPVDPNSQMIT   K  +     + VRFTIRGSGTEPKLKVYIEACS SE  A +LA+  
Sbjct: 552 LPVDPNSQMITAWTK-VNGAKPYESVRFTIRGSGTEPKLKVYIEACSKSEERASELAQLT 610

Query: 606 WDTLQEVWFRPQTTGLVTDF 625
           W  L+  WFRP  TGL T F
Sbjct: 611 WRVLKREWFRPDVTGLTTTF 630

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/626 (59%), Positives = 466/626 (74%), Gaps = 3/626 (0%)

Query: 2   DKGTLHILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTA 61
           D+   ++L + PE L+ +I  W R D N+ET  EV +LC  +   EL+ RF QRI+FGTA
Sbjct: 5   DQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIVFGTA 64

Query: 62  GLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVF 121
           GLRSRMEAG NR+N+L +LQ+TQGLA YI SQFP N  AVVGHDHR+HSKEFA +TAAVF
Sbjct: 65  GLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQITAAVF 124

Query: 122 LRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181
           L AGFKV YLNP D  VHTP+VPF ++  +AS+GVMITASHNP+MDNGYKVY+ NGCQII
Sbjct: 125 LNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNGCQII 184

Query: 182 PPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR 241
           PPHD NIA  I++NLEP   +W+   VI  A +  +++Y K+ + Q Y    +  +I   
Sbjct: 185 PPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYIIPKN 244

Query: 242 KVLRN--PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVS 299
             L     G  PWFVYTPMHGVG +IF RIS   L + E+ DY+CV EQ  PDPSFPTVS
Sbjct: 245 ISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSFPTVS 304

Query: 300 FPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFA 359
           FPNPEEKGALD  I+ A ++ I+LV+ANDPDADRFS+AV +  T  ++QLTGNEIGFLFA
Sbjct: 305 FPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIGFLFA 364

Query: 360 YQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDL 419
           Y  +E Y  +   F+ + PL ++NSTVSSQMIKKMAEVEGF+YEDTLTGFKWIGN+AR+L
Sbjct: 365 YFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNKAREL 424

Query: 420 EKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKK 479
           EK+G++ PFG+EEAIGYMF +ME DKDGI+A+++FL +YY W  +  +   DI+E G+KK
Sbjct: 425 EKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIETGFKK 484

Query: 480 YGVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDT 539
           YGVFKEYNGYYIV++  + K  FD IR ++    +Y   IG+EF+V++FRDLTLG+QSDT
Sbjct: 485 YGVFKEYNGYYIVNDLSLTKIIFDNIRENKNDKEKYVSHIGTEFKVITFRDLTLGYQSDT 544

Query: 540 SDHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQ 599
             ++PTLPVDP+SQMIT+   PT    E   VRFTIRGSGTEPKLKVYIEA + +E  A 
Sbjct: 545 IGNVPTLPVDPSSQMITMTIIPT-SLPENGSVRFTIRGSGTEPKLKVYIEANAKTEAEAN 603

Query: 600 QLAKQMWDTLQEVWFRPQTTGLVTDF 625
           +LAK  WD L+  WF  + TGL T+F
Sbjct: 604 RLAKLTWDVLKREWFSSEKTGLTTNF 629

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  766 bits (1979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/620 (60%), Positives = 467/620 (75%), Gaps = 2/620 (0%)

Query: 7   HILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66
             L   P  L+  I  W   D++ ET  EV  LC++ DW EL+ RF  RI FGTAGLRS+
Sbjct: 4   QFLGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQ 63

Query: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126
           M+AG +R+N+LVI+QA+QGLA YI  QFP N VAVVGHDHRFHSK+FA  TA  FL  GF
Sbjct: 64  MQAGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGF 123

Query: 127 KVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDL 186
           KV YLNPG   VHTPLVPF VD LNASVGVMITASHNPKMDNGYKVY++NGCQIIPPHD 
Sbjct: 124 KVHYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 183

Query: 187 NIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRN 246
            I+ +ID NLEPW  +W++  ++    K+ +++Y +++M +LY +     L+    +   
Sbjct: 184 AISNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLKLE 243

Query: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306
             S PWFVYTPMHGVG +IFS I +  + + E +DYLCVPEQ++PDPSFPTV FPNPEEK
Sbjct: 244 VRSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEK 303

Query: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366
           GAL+  + LA ++ I+L+IANDPDADRFS+A+ D ++  W+QLTGNEIGFLFA+ +FE +
Sbjct: 304 GALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKF 363

Query: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426
           K+MD+ FQ+ HPL +L+STVSSQMIK+MAEVEGFHYEDTLTGFKWIGNRA  LEK+G++ 
Sbjct: 364 KSMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYV 423

Query: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486
           PFG+EEAIGYMF  MEHDKDGISAS++FL +Y  W    +  P+++LE+G+KKYGVFKEY
Sbjct: 424 PFGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEY 483

Query: 487 NGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545
           NGYYIV NP + KE F YIR+   P    YP  IG E +V+ +RDLT G+QSDT DH PT
Sbjct: 484 NGYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPT 543

Query: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605
           LPVDP SQMITV A+P +D+   +H+RFTIRGSGTEPKLKVYIE  +  E  A  LAK  
Sbjct: 544 LPVDPTSQMITVFARP-NDSNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKLT 602

Query: 606 WDTLQEVWFRPQTTGLVTDF 625
           WD L+  WFRP+ T + T+F
Sbjct: 603 WDVLRREWFRPEKTNITTNF 622

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/623 (58%), Positives = 459/623 (73%), Gaps = 6/623 (0%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           +L+  P  L+ ++  WL  DKN ET  EV+ LC+    +EL+ RF  RILFGTAGLRS+M
Sbjct: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70

Query: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127
           EAG +R+N+LV+LQATQGLA YI  QFP N  AV+GHDHR+HSKEFA +  +VFL AGF 
Sbjct: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130

Query: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187
           V  LNP  T VHTPLVPFTVD + ASVGVMITASHNPKMDNGYKVY++NGCQIIPP D +
Sbjct: 131 VYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDAS 190

Query: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR-- 245
           IA+ ID+NLEPW  SWD    I+A     +++Y++++M   Y+   +  +I  +K +R  
Sbjct: 191 IAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIID-KKTIREF 249

Query: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305
           +    PWFVYTPMHGVG EIF+ +  + + +KEN DYL V EQ  PDP+FPT+SFPNPEE
Sbjct: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309

Query: 306 KGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEM 365
           KGALD AI LA +N I+LVIANDPDADRFS A+++S +  W+QLTGNEIGFLF Y  F  
Sbjct: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369

Query: 366 YKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFF 425
           Y  MD  F+K HPL +LNSTVSS+M+K MA+ E F + DTLTGFKWIGN+A DL+K+G+ 
Sbjct: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429

Query: 426 APFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKE 485
             FGYEEAIGYMF  MEHDKDGI+AS++FL +Y+ W   +    +DILE G +KYG FKE
Sbjct: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489

Query: 486 YNGYYIVDNPKIMKETFDYIRNDR-KPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIP 544
           YNGYY+V NP++  + F YIRN+  K G QYP+ IG+  +V SFRDLT GFQSDT D+IP
Sbjct: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549

Query: 545 TLPVDPNSQMITVCAKPTHDNVERDH--VRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602
           +LPVDP+SQMIT+ AK   D  ++    VRFT+RGSGTEPKLK+YIE  S     A ++A
Sbjct: 550 SLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIA 609

Query: 603 KQMWDTLQEVWFRPQTTGLVTDF 625
           K  WD L++ W RP+ TG+ T +
Sbjct: 610 KLTWDVLKKEWIRPEVTGVTTSY 632

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/623 (59%), Positives = 460/623 (73%), Gaps = 13/623 (2%)

Query: 11  NAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAG 70
             P+ L+  +  WL  DKN ETR E+L+L + + W EL+ R  +RI FGTAGLRSRMEAG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 71  TNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLY 130
            +R+N+L +LQA+QGLA YI SQFP+N   +VGHDHR+HS EFA VT   FL+ GFKV Y
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 131 LN-----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHD 185
           LN       +T VHTP+VPFT++ LNAS G+MITASHNPKMDNGYKVY++NGCQIIPPHD
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 186 LNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR 245
             I+ +IDQNL PW  +WD   VI+ A +   +  VK+++T  Y KT   +L+   +V  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELV---RVPM 243

Query: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305
                PWFVYTPMHGVG EIF +I+   LG+KE + Y+CVPEQ+ PDP+FPTVSFPNPEE
Sbjct: 244 LDCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPEE 303

Query: 306 KGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEM 365
           KGALD +I LA +  I LVIANDPDADRFS+AV +     W QLTGNEIGFLFAY Q++ 
Sbjct: 304 KGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGD--RWSQLTGNEIGFLFAYYQWQD 361

Query: 366 YKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFF 425
           Y+ + + F+K+HPL ++NSTVSSQMIK +AE E FHYEDTLTGFKW+GNRA +LE +G++
Sbjct: 362 YQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGYY 421

Query: 426 APFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKE 485
            PF YEEAIGYMF ++EHDKDGISA+++FL  Y  W+      PL +L++G+ KYGVFKE
Sbjct: 422 VPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFKE 481

Query: 486 YNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIP 544
           YNGYYIV    + KE FDYIR D  P G  YP AIGSEF V+SFRDLT G+QSDT D++P
Sbjct: 482 YNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNVP 541

Query: 545 TLPVDPNSQMITVCAKPTH--DNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602
            LPVD +SQMIT   +P++  ++   + VRFTIRGSGTEPKLKVYIEA S  E  AQ LA
Sbjct: 542 NLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHLA 601

Query: 603 KQMWDTLQEVWFRPQTTGLVTDF 625
           ++ W  L+  WFRP+ TGL T F
Sbjct: 602 RETWQVLRREWFRPERTGLETKF 624

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  751 bits (1939), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/617 (59%), Positives = 459/617 (74%), Gaps = 12/617 (1%)

Query: 11  NAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAG 70
           N PE L+  I  WL  D+NE+T +E+ +LC  ++WSEL+ R + R+ FGTAGLR+RMEAG
Sbjct: 4   NIPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAG 63

Query: 71  TNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLY 130
            +R+N+LV++QATQGLA+YI  QFP + VAVVGHDHRF+S +FA  TA V L+AGF+V Y
Sbjct: 64  FSRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHY 123

Query: 131 LNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIAR 190
           LN GD+ VHTP+VPFTVD + ASVGVMITASHNPK+DNGYKVY+ANGCQIIPPHD  IAR
Sbjct: 124 LNQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIAR 183

Query: 191 SIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSG 250
           SI+ NLEP    WDW   +Q A  E +++Y +D+M + Y    +   +     L  P   
Sbjct: 184 SIESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSFVTELDSL--PKGK 241

Query: 251 PWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALD 310
           PWFVYTPMHGVG ++F +I+  +L ++ N D+L V EQ +PDP FPTV FPNPEEKGALD
Sbjct: 242 PWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGALD 301

Query: 311 KAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMD 370
            AI+LA  +GI LVIA+DPDADRFS+A        W+QL+GN+IGFLFAY + + Y+  D
Sbjct: 302 LAIKLAENHGIKLVIASDPDADRFSVAF--KGPHGWQQLSGNDIGFLFAYYELQKYRGFD 359

Query: 371 DIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGY 430
             +QK HPL +LNSTVSSQMI  MA +EGFH+EDTLTGFKWIGNRA +LE +G++ PFG+
Sbjct: 360 AEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPFGF 419

Query: 431 EEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYNGYY 490
           EEAIGYMF   EHDKDGISA+++FL +Y+ W+    K PLDIL++   KYGVF+EYNGYY
Sbjct: 420 EEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQG-KSPLDILDEASAKYGVFREYNGYY 478

Query: 491 IVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLPVD 549
           +VD P +  +TF YIR D  P G  YP  IG + QV +FRDLT G+QSDT ++IP L VD
Sbjct: 479 LVDEPSLTNKTFAYIREDYTPKGENYPRTIG-DLQVKTFRDLTTGYQSDTPNNIPNLHVD 537

Query: 550 PNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQMWDTL 609
           P+SQMIT+ A+P       +HVRFT+RGSGTEPKLKVYIEA + S+  A++LA+Q WD L
Sbjct: 538 PSSQMITIVAQPKGGG-SGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQTWDIL 596

Query: 610 QEVWF-RPQTTGLVTDF 625
           +E WF RP   GL T F
Sbjct: 597 REEWFNRP---GLTTKF 610

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  734 bits (1894), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/639 (57%), Positives = 460/639 (71%), Gaps = 26/639 (4%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           ++++ PE LQ ++L WL  DK++ TR+E++DLC+  +  EL+ RF  RI FGTAGLRS M
Sbjct: 10  LIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITFGTAGLRSTM 69

Query: 68  EAGTNRLNSLVILQATQGLARYI---ASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRA 124
           EAG +R+N+L +LQA+QGLA Y+   A    +  +AV+GHDHR+HSKEFA + A VFL A
Sbjct: 70  EAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAKIAATVFLIA 129

Query: 125 GFKVLYLN------PGDT-LVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANG 177
           GFKV YLN      P D   VHTP+VPFTV +L ASVGVM+TASHNPKMDNGYKVY++NG
Sbjct: 130 GFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDNGYKVYYSNG 189

Query: 178 CQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQM-----TQLYTKT 232
           CQIIPPHD  I++ ID NLEPWE SW++  ++  AE +  ++Y +D M     TQL  K 
Sbjct: 190 CQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLNDYITQLEEKL 249

Query: 233 AELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPD 292
               +I   K + +  S PWFVYTPMHGVG EIF++IS ++L +KE ED++ V EQKHPD
Sbjct: 250 TSKDIIHLSKKI-DVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIVVEEQKHPD 308

Query: 293 PSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKT-ANWRQLTG 351
           P FPTVSFPNPEEKGA+D  I+LA  NGI+LVIANDPDADRFS+AV    +   W Q TG
Sbjct: 309 PGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQGTWHQFTG 368

Query: 352 NEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKW 411
           NEIG+LFAY +F+ YK      Q  H L ++NSTVSSQMIKKMAE+EGF+YE+TLTGFKW
Sbjct: 369 NEIGYLFAYFEFQKYKISK---QDLHRLYMVNSTVSSQMIKKMAEIEGFNYEETLTGFKW 425

Query: 412 IGNRARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLD 471
           IGNRA DL  KG   PFGYEEAIGYMF  ME DKDGI+A+++F+ ++ +W       P +
Sbjct: 426 IGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQIDKMDPYE 485

Query: 472 ILEDGYKKYGVFKEYNGYYIVDNPKIMKETFDYIRNDRKPGT-----QYPEAIGSEFQVV 526
           I++ G+KKYGVF EYNGYY   +  I K+ FDY+R D   G      +YP+ IG EF+++
Sbjct: 486 IIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDHIGEEFKII 545

Query: 527 SFRDLTLGFQSDTSDHIPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKV 586
            +RDLT G+QSDT D+ P LPVDP+SQMITV   PT DN     +R TIRGSGTEPKLKV
Sbjct: 546 KYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPT-DNESDGSIRLTIRGSGTEPKLKV 604

Query: 587 YIEACSGSETGAQQLAKQMWDTLQEVWFRPQTTGLVTDF 625
           YIEACS S T A  LAKQ W+ L+  W RP+ TG+ T F
Sbjct: 605 YIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/620 (57%), Positives = 442/620 (71%), Gaps = 8/620 (1%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           I +  PE L+     WLR D+NEETR E+L +  R+DW EL +R   RI FGTAGLR RM
Sbjct: 11  IDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIPFGTAGLRGRM 70

Query: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127
           EAG  R+NSLVILQ +QGLA+YI  +FP+N   VVGHDHR+HSKEFA +T A FL AGFK
Sbjct: 71  EAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADITVATFLNAGFK 130

Query: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187
           V YLN  +  VHTPLVP++VD L ++ GVMITASHNPK DNGYKVY++NGCQIIPPHD N
Sbjct: 131 VFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNGCQIIPPHDKN 190

Query: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTK-TAELQLIGGRKVLRN 246
           IA +I++NL PW   W+W  +    E+   + +  ++M   Y +         G  +L+ 
Sbjct: 191 IALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYVFTNGSPMLKT 250

Query: 247 PGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEK 306
               PWFVYTPMHGVG +IF +I++ VLG+ EN DY  VPEQ  PDPSFPTVSFPNPEEK
Sbjct: 251 --GKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFPTVSFPNPEEK 308

Query: 307 GALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMY 366
           GALD AI+LA + G+ L+IANDPDADRFS AV D ++  WRQL+GNEIG LFA  + + +
Sbjct: 309 GALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGSLFAIFKLQEH 368

Query: 367 KAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFA 426
           K   +      PL +LNSTVSSQM+KKMA+VEGFHYE+TLTGFKWIGNRA  LE++G+  
Sbjct: 369 K---EKAASRKPLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRALQLEQQGYDV 425

Query: 427 PFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEY 486
            FGYEEAIGYMF  MEHDKDGI AS++FL  Y  W+      PLD+L+  ++KYGVF EY
Sbjct: 426 CFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLCFEKYGVFSEY 485

Query: 487 NGYYIVDNPKIMKETFDYIRNDRKPGTQ-YPEAIGSEFQVVSFRDLTLGFQSDTSDHIPT 545
           NGYY V+ P +++  F YIR++  P  + YPE +G EF + SFRDLTLG+QSDT D  PT
Sbjct: 486 NGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGYQSDTIDFKPT 545

Query: 546 LPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQM 605
           LPVD +SQMIT   KP    V  + +RFTIRGSGTEPKLKVYIE+ + ++  A  LA   
Sbjct: 546 LPVDASSQMITATLKPER-TVGHEEIRFTIRGSGTEPKLKVYIESHAANKEAAANLAHLT 604

Query: 606 WDTLQEVWFRPQTTGLVTDF 625
           W+ L+  WFRP+ TGL T F
Sbjct: 605 WNVLRREWFRPEITGLKTSF 624

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/627 (57%), Positives = 440/627 (70%), Gaps = 19/627 (3%)

Query: 9   LQNA--PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSR 66
           L NA  PE L+  +  WL+ DKNE+TR +++ L + + W+EL +R + RI FGTAGLRSR
Sbjct: 4   LTNAEVPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSR 63

Query: 67  MEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGF 126
           MEAG NR+N+L +LQA+QGLA+YIAS FP N   VVGHDHRF+SK+FA VT   FL+ GF
Sbjct: 64  MEAGFNRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGF 123

Query: 127 KVLYLN-----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181
           KV  L        D +VHTP+VPF +DHL AS G+MITASHNPKMDNGYKVY++NGCQII
Sbjct: 124 KVYDLGFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQII 183

Query: 182 PPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGR 241
           PPHD  I++SI  NLEPW+ +WD   V   A + + ++  K  +   Y  T    L+   
Sbjct: 184 PPHDQRISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLVITN 243

Query: 242 KVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFP 301
               N    PWFVYTP+HGVG EIF +I      + +  DYLCV EQK+PDP+FPTVSFP
Sbjct: 244 V---NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFP 300

Query: 302 NPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQ 361
           NPEEKGALDKAIELA ++ I  V+ NDPDADRFS+A        WRQLTGNEIGFLFA  
Sbjct: 301 NPEEKGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQY 358

Query: 362 QFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEK 421
           ++E Y+   D F+  +PL ++NSTVSSQMIKKMAEVEGFHYEDTLTGFKW+GNRAR+LE 
Sbjct: 359 KWETYRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELEN 418

Query: 422 KGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYG 481
            G+F PF YEEAIGYMF+ + HDKDGISA+++FL   + W   A   P D+L+  Y+KYG
Sbjct: 419 AGYFVPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSWKAQALT-PFDVLQRAYQKYG 477

Query: 482 VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSD 541
           VFKEYNGYYIV +  +  + F  IR+     +  P  IG EF+V S+ DLT G+QS+T D
Sbjct: 478 VFKEYNGYYIVPDLSLTDKVFSGIRSGF---SLQPTHIGQEFRVESYTDLTTGYQSNTPD 534

Query: 542 HIPTLPVDPNSQMITVCAKPTHDNVER---DHVRFTIRGSGTEPKLKVYIEACSGSETGA 598
             P LPVDP+SQMIT    PT     +   + VRFT RGSGTEPKLKVYIEA S SE  A
Sbjct: 535 SEPRLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELA 594

Query: 599 QQLAKQMWDTLQEVWFRPQTTGLVTDF 625
             LAK+ WD L+  WF+P+ TGL T+F
Sbjct: 595 SALAKKAWDVLRREWFKPEQTGLATNF 621

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  707 bits (1826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/621 (57%), Positives = 431/621 (69%), Gaps = 17/621 (2%)

Query: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72
           P  L+  +  W   DKNEETR E+L L   Q+W+EL+ R  QRI FGTAGLRS+MEAG +
Sbjct: 9   PADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRSKMEAGFS 68

Query: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132
           R+N+L +LQA+QGLA+YIA +FP+NK   VGHDHRF+S++FA VT+  FL+  FKV  L 
Sbjct: 69  RMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLRFKVYSLG 128

Query: 133 -----PGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187
                  D  VHTP+VPF +D L AS GVMITASHNPKMDNGYKVY++NGCQIIPPHD  
Sbjct: 129 FNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQIIPPHDRL 188

Query: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNP 247
           IA+SI  NL PWE +WD   VI  A ++   V +K  M   Y K    +L+      R  
Sbjct: 189 IAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSSDIGDR-- 246

Query: 248 GSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKG 307
            S PWFVYTP+HGVG EIF RI+ +VLG+ E  DY CV E K PDP+FPTVSFPNPEE G
Sbjct: 247 -SKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVSFPNPEEAG 305

Query: 308 ALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYK 367
           ALD AI LA +NGI+ V+ NDPDADRFS AV       WRQLTGNEIGFLFA   +E Y+
Sbjct: 306 ALDLAIALADKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFAQFVWEKYQ 363

Query: 368 AMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFFAP 427
                F+ E+PL L+NSTVSSQMIKK+A VE FHYEDTLTGFKW+GNRAR LE  G++ P
Sbjct: 364 KESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQLESSGYYVP 423

Query: 428 FGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKEYN 487
           F YEEAIG+MF+ + HDKDG+SA+++FL   + W   A   P+D+L+  + KYGVFKEYN
Sbjct: 424 FAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQALS-PIDVLQSAFGKYGVFKEYN 482

Query: 488 GYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIPTLP 547
           GYY V +  +    F  IR+       YP+ IG++F VVSF DLT GFQSDT+D+ P LP
Sbjct: 483 GYYTVPDLSLTDRIFSDIRSSYD---SYPKHIGNQFDVVSFTDLTKGFQSDTADNTPRLP 539

Query: 548 VDPNSQMITVCAKPTH---DNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLAKQ 604
           VDP+SQMI     P+         + VRFT RGSGTEPKLKVYIEA S  ET A  LA+ 
Sbjct: 540 VDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEETRASDLART 599

Query: 605 MWDTLQEVWFRPQTTGLVTDF 625
            W+ L++ WF+P+ TGL T F
Sbjct: 600 TWNVLRDEWFKPKETGLSTKF 620

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/628 (56%), Positives = 441/628 (70%), Gaps = 37/628 (5%)

Query: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67
           ++++ P  LQ ++  WL+ DK EETR E+L LC + D +EL+ R    I FGTAGLR RM
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127
           EAG NR+N+L + QA+QGLA+YI  QFP+N   VVGHDHR +S+ F  VT   FL+ GFK
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125

Query: 128 VLYLNPGD--TLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHD 185
           V +LN  +  +LVHTPLVPFTV+   ASVG+MITASHNPKMDNGYKVY+ NGCQIIPPHD
Sbjct: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 186 LNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR 245
             IA SI  NLEP+           ++ +   I+  K++MT+ Y       LI G   + 
Sbjct: 186 KLIAESIIHNLEPF-----------SSPQTGTIIDCKEKMTKKYIDAIGSTLIDG--AVN 232

Query: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305
              + PWFVYTPMHGVG EIF  IS+ +L ++E +DYL V EQK+PD  FPTVSFPNPEE
Sbjct: 233 KKTNEPWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPEE 292

Query: 306 KGALDKAIELASQNG-INLVIANDPDADRFSLAVFD---SKTANWRQLTGNEIGFLFAYQ 361
           KGALD A+E   +N  ++L+IANDPDADRFS+AV D   + T  WRQLTGNEIGFLFAY 
Sbjct: 293 KGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAYY 352

Query: 362 QFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEK 421
           ++E YK        + PL +LNSTVSSQMIK+MAE+EGFHYEDTLTGFKW+GNRA +LE+
Sbjct: 353 EWERYKHS----PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELEQ 408

Query: 422 KGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYG 481
           +G++ PF YEEAIGYMF+ + HDKDGISA+++FL +Y  W        LDIL     KYG
Sbjct: 409 EGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKWRASGQTV-LDILATASLKYG 467

Query: 482 VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSD 541
            FKE+NGYYIV +  I K+ FD IR+   P   YP+ +GS F+++ FRDLT G+QSDT D
Sbjct: 468 HFKEFNGYYIVPDLAITKQVFDAIRSIESP---YPKKLGSSFEIIKFRDLTNGYQSDTPD 524

Query: 542 HIPTLPVDPNSQMIT----VCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETG 597
           HIP L  DP+SQMIT    +  +PT        VRFTIRGSGTEPKLKVYIEA + +E  
Sbjct: 525 HIPELASDPSSQMITCEMLLVEQPT------SRVRFTIRGSGTEPKLKVYIEARTNTEPN 578

Query: 598 AQQLAKQMWDTLQEVWFRPQTTGLVTDF 625
           +  LAK  WD L++ WF+P+ TGL+T F
Sbjct: 579 SIALAKFTWDVLRQEWFKPELTGLLTPF 606

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  690 bits (1781), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/623 (54%), Positives = 433/623 (69%), Gaps = 17/623 (2%)

Query: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72
           P  L+  ++EWL  DKN ET+ E+ +L     W EL  R   RI FGTAGLR+RMEAG +
Sbjct: 9   PSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEAGFS 68

Query: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132
           R+N+L ++QA+QGLARYI SQFP +   V+GHDHRFHS+EFA  T A FL+  + + YLN
Sbjct: 69  RMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIYYLN 128

Query: 133 ---PG---DTLVHTPLVPFTVDHLNA---SVGVMITASHNPKMDNGYKVYFANGCQIIPP 183
              PG   D  VHTP+VPF ++++     S GVMITASHNPKMDNGYKVY+ANGCQIIPP
Sbjct: 129 YVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQIIPP 188

Query: 184 HDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKV 243
           HD  I R ID NLEPW  +WD   +I+ A K  ++  V+ +M Q Y  + +  L+  +  
Sbjct: 189 HDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLV-KQSN 247

Query: 244 LRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNP 303
           L+  G GPWFVYTPMHGVG E F      VLGI+E++DY+ VPEQK+PDP FPTVSFPNP
Sbjct: 248 LKFAG-GPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVSFPNP 306

Query: 304 EEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQF 363
           EE+GALD A+++A  NGI +V+ANDPDADRFS+AV       W QLTGN+IG LFA  + 
Sbjct: 307 EERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFAQAEM 364

Query: 364 EMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKG 423
           + Y     + +K+  L +L S VSSQ+++KMAE EGF   +TLTGFKW+GNRAR+LE +G
Sbjct: 365 QSYFKEPKLDRKQ--LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRARELELEG 422

Query: 424 FFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVF 483
           ++ PF YEEAIGYMF+Q+ HDKDGI+A+ +FL   Y W   A K   ++L++ Y+KYG F
Sbjct: 423 YYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVA-KSSQEVLQECYEKYGYF 481

Query: 484 KEYNGYYIVDNPKIMKETFDYIRNDRKP-GTQYPEAIGSEFQVVSFRDLTLGFQSDTSDH 542
            +YNGYYI   P + KE FDY RN+  P G  YP  IG EF+V   RDLT+G+QSDT+ +
Sbjct: 482 VDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSDTATN 541

Query: 543 IPTLPVDPNSQMITVCAKPTHDNVERDHVRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602
           IP LPVD NSQMIT   KP     + + VRFT RGSGTEPKLKVYIE+C+ +   A  L+
Sbjct: 542 IPDLPVDHNSQMITCVLKPVKMETDCESVRFTARGSGTEPKLKVYIESCAANHQRASHLS 601

Query: 603 KQMWDTLQEVWFRPQTTGLVTDF 625
              WD L+  WFRP  TGL T+F
Sbjct: 602 HLAWDVLKREWFRPTETGLQTNF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/625 (54%), Positives = 429/625 (68%), Gaps = 20/625 (3%)

Query: 13  PEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRMEAGTN 72
           P+ L+ +I +W + DKN +T  E+  L   Q+W+EL  R  QRI FGTAGLR+RMEAG  
Sbjct: 14  PDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEAGFA 73

Query: 73  RLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFKVLYLN 132
           R+N+L ++QA+QGLA YI SQFP N   VVGHDHR++SK FA V  A FL+ GF+V YLN
Sbjct: 74  RMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVYYLN 133

Query: 133 --PGD----TLVHTPLVPFTVDHL--NASVGVMITASHNPKMDNGYKVYFANGCQIIPPH 184
             P +    + VHTP+VPFTV ++   AS G+MITASHNPKMDNGYKVY++NGCQI PPH
Sbjct: 134 YVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQITPPH 193

Query: 185 DLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVL 244
           D  IA  ID NL PW+ +WD   +I+ A   +R+  VK ++ + Y +  +  L+     L
Sbjct: 194 DKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLVTTNS-L 252

Query: 245 RNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPE 304
            + G   WFVYTPMHGVG EIF+ I  + L +KE+E YL V  QK PDP F TVSFPNPE
Sbjct: 253 ADCGKN-WFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSFPNPE 311

Query: 305 EKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFE 364
           E+GAL+ AIELA+++G  LV+ANDPDADRFS AV D     W+QLTGN++G+LFA  Q E
Sbjct: 312 EEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAVGQLE 369

Query: 365 MYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGF 424
            +   +   + + PL +L STVSSQMI KMA+VEGF + +TLTGFKW+ NRA DLE  GF
Sbjct: 370 KFSNQN---ENKKPLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLENDGF 426

Query: 425 FAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFK 484
           + PF YEEAIGYMF+ + HDKDG+SA+  FL     W  +  K PLD+L  GY+KYG F 
Sbjct: 427 YVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEG-KTPLDVLNAGYEKYGNFV 485

Query: 485 EYNGYYIVDNPKIMKETFDYIRNDRKPG-TQYPEAIGSEFQVVSFRDLTLGFQSDTSDHI 543
           EYNGYY V +  I+ + F YIRN        YP  IG+EF V SFRDLT+G+QSDT +HI
Sbjct: 486 EYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDTGNHI 545

Query: 544 PTLPVDPNSQMITVCAKPTHDNVER---DHVRFTIRGSGTEPKLKVYIEACSGSETGAQQ 600
           P LPV P S MIT   KP      +   D+VRFTIRGSGTEPKLKVYIE+ +  +  A +
Sbjct: 546 PNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKEYATK 605

Query: 601 LAKQMWDTLQEVWFRPQTTGLVTDF 625
           LAK  WD L+  WFRP+ TGL T F
Sbjct: 606 LAKLTWDVLKREWFRPEVTGLQTKF 630

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 94/419 (22%), Positives = 164/419 (39%), Gaps = 55/419 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +     N +        T+   + I    P   K+ + VVG D R+++ +   
Sbjct: 17  GTSGLRKKTAVFMNNV------HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTV------DHLNASVGVMITASHN---PKM 166
           + AA+    G + L +     L+ TP     +      D    + G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIGQ-HGLLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 167 DNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR-------IV 219
           D G K   +NG    P    N    I + L  ++    +P +  + + E         +V
Sbjct: 130 DIGIKYNLSNGGP-APESVTNAIWDISKKLTHYKIVKGFPEINLSVKGEKSYGSLVIDVV 188

Query: 220 YVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKE 278
               +         +  LI  + V     +  W  ++  ++GV       I  D LG+ E
Sbjct: 189 DTTQEYVDFLKGIFDFDLI-KKFVDTQRSTKNWKLLFDGLNGVTGPYGRAIFVDELGLPE 247

Query: 279 NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAV 338
           NE    V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  
Sbjct: 248 NE----VLQNCHPKPDFGGI-HPDPNLTYA-RTLVDRVDKEKIEFGAASDGDGDRNMIYG 301

Query: 339 FDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVE 398
           +     +     G+ +  +  Y     Y A + I+       L  S  +S  I ++A+ +
Sbjct: 302 YGPAFVS----PGDSVAIIAEYASEIPYFAQNGIYG------LARSFPTSTAIDRVAKAK 351

Query: 399 GFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL 455
           G +     TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L
Sbjct: 352 GLNCYVVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAVIAWL 402

>Suva_13.282 Chr13 complement(457565..459274) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 114/490 (23%), Positives = 191/490 (38%), Gaps = 65/490 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   ++         T+   + +    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFKDQP------HYTENFIQSVLDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHN---PKMDNGY 170
             AA+    G K L +     L+ TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLVIGQ-HGLLSTPAASHIMRTYEDKCTGGIILTASHNPGGPENDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   +NG    P    N    I + L  ++   D+P +      +DR        I+ V 
Sbjct: 132 KYNLSNGGP-APESVTNAIWEISKKLTSYKIVKDFPELDLQTIGKDRKYGPLLIDIIDVT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGP-W-FVYTPMHGVGSEIFSRISEDVLGIKENE 280
               +L  +  +  LI  +K + N  S   W  ++  M+GV       I  D  G+   E
Sbjct: 191 KAYVELMEEIFDFNLI--KKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDKFGLPAEE 248

Query: 281 DYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFD 340
               V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  + 
Sbjct: 249 ----VLQNWHPSPDFGGMH-PDPNLTYA-SSLVKRVDREQIEFGAASDGDGDRNMIYGYG 302

Query: 341 SKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGF 400
               +     G+ +  +  Y     Y A   I+       L  S  +S  I ++A+  G 
Sbjct: 303 PSFVS----PGDSVAIIAEYAAEIPYFAKQGIYG------LARSFPTSAAIDRVAKAHGL 352

Query: 401 HYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL--L 456
           +  +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L  L
Sbjct: 353 NCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAIMAWLNIL 404

Query: 457 SYYHWVYDAHKFPLDILEDGY-KKYG--VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGT 513
           + Y+  +   +  +  ++D +  KYG   F  Y      D  K+  E  + I +     T
Sbjct: 405 AIYNKHHPEKEASIKTIQDEFWAKYGRTFFTRY------DFEKVESEKANEIVDQLGAFT 458

Query: 514 QYPEAIGSEF 523
             P  IGS F
Sbjct: 459 SKPGVIGSPF 468

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 94/415 (22%), Positives = 163/415 (39%), Gaps = 50/415 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   ++ N +      +   + +    P   K  V VVG D R+++     
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLN--ASVGVMITASHN---PKMDNGY 170
             AA+    G K L +   + L+ TP     +       + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIGQ-NGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   +NG    P    N    I + L  ++   D+P +      E++        ++   
Sbjct: 131 KYNLSNGGP-APEPVTNKIWEISKKLTHYKIVKDFPELDLTKLVENKKYGPLLVDVIDTT 189

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDY 282
           D   QL  +  + +LI      +    G   +   M+GV       I  D  G+   E  
Sbjct: 190 DAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEFGLDSKE-- 247

Query: 283 LCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSK 342
             V +  HP P F  +  P+P    A    +E  ++  I    A+D D DR  +  +   
Sbjct: 248 --VLQNWHPQPDFGGLH-PDPNLTYA-HTLVERVNKEKIEFGAASDGDGDRNMIYGYGPA 303

Query: 343 TANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHY 402
             +     G+ +  +  Y     Y      F+K+    L  S  ++  I ++A+  G + 
Sbjct: 304 FVS----PGDSVAIIAEYANEIPY------FKKQGIYGLARSFPTASAIDRVAKKHGLNC 353

Query: 403 EDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL 455
            +  TG+K+      A+ L   G       EE+ G     +  +KDGI A + +L
Sbjct: 354 YEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGIWAIMAWL 400

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 84/371 (22%), Positives = 147/371 (39%), Gaps = 44/371 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   ++ N       T+   + I    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHN---PKMDNGY 170
             AA+    G K L +     L+ TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   +NG    P    N+   I + L  ++   D+P +  A   +++        I+ + 
Sbjct: 132 KYNLSNGGP-APESVTNVIWDISKKLTSYKIIKDFPELDLATIGKNKKYGPLLVDIIDIT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGP-W-FVYTPMHGVGSEIFSRISEDVLGIKENE 280
                   +  + +LI  +K + N  S   W  ++  M+GV       I  D  G+  +E
Sbjct: 191 KDYVDFLKEIFDFKLI--KKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE 248

Query: 281 DYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFD 340
               V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  + 
Sbjct: 249 ----VLQNWHPSPDFGGMH-PDPNLTYA-STLVKRVDREKIEFGAASDGDGDRNMIYGYG 302

Query: 341 SKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGF 400
               +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  G 
Sbjct: 303 PSFVS----PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHGL 352

Query: 401 HYEDTLTGFKW 411
           +  +  TG+K+
Sbjct: 353 NCYEVPTGWKF 363

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 107/487 (21%), Positives = 195/487 (40%), Gaps = 62/487 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +    +         T+   + I    P   K+   VVG D R+++ +   
Sbjct: 19  GTSGLRKKTKVFMEKP------HYTENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTV----DHLNASV--GVMITASHN---PKM 166
           + A++    G   L +     L+ TP     +    D     V  G+++TASHN   P  
Sbjct: 73  IIASISAANGVGKLVIGQ-HGLLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 167 DNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR-------IV 219
           D G K   +NG    P    N    I + L  ++   + P +  + + E +       +V
Sbjct: 132 DIGIKYNLSNGGP-APESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEIDVV 190

Query: 220 YVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKE 278
            V     +   +  +  LI  + V     +  W  ++  ++GV       I  D LG+ E
Sbjct: 191 DVTQAYVEFLKEIFDFDLI-KKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDELGLPE 249

Query: 279 NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAV 338
           NE    V +  HP P F  +  P+P    A    +E   +  I    A+D D DR  +  
Sbjct: 250 NE----VLQNCHPKPDFGGI-HPDPNLTYA-RTLVERVDKEKIEFGAASDGDGDRNMIYG 303

Query: 339 FDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVE 398
           +     +     G+ +  +  Y +   Y      F K+    L  S  +S  I ++A  +
Sbjct: 304 YGPAFVS----PGDSVAIIAEYAKEIPY------FAKQGIYGLARSFPTSSAIDRVAAEQ 353

Query: 399 GFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL- 455
           G +  +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L 
Sbjct: 354 GLNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAIIAWLN 405

Query: 456 -LSYYHWVYDAHKFPLDILEDGY-KKYG--VFKEYNGYYIVDNP--KIMKETFDYIRNDR 509
            L+ Y+  +   +  +  ++D +  KYG   F  Y+  ++      +I+K    ++ +  
Sbjct: 406 ILAIYNKHHPQKEASIKTIQDEFWLKYGRTFFTRYDFEHVTTEKANEIVKHLDSFVNSPN 465

Query: 510 KPGTQYP 516
             G+++P
Sbjct: 466 VVGSKFP 472

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 105/445 (23%), Positives = 177/445 (39%), Gaps = 55/445 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   +  N       T+   + I    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASV--GVMITASHNP---KMDNGY 170
             AA+    G K L +     L+ TP     +         G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQ-RGLLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTV-IQAAEKEDR-------IVYVK 222
           K   +NG    P    N    I + +  ++   D+P + ++   K  +       ++   
Sbjct: 132 KFNLSNGGP-APEPVTNKIWEISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENED 281
               +   +  +  LI  + V +   +  W  ++  M+GV       I  D LG+  +E 
Sbjct: 191 KAYVEFVKQIFDFDLI-KKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE- 248

Query: 282 YLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDS 341
              V +Q HP P F  V  P+P    A    ++   +  I    A+D D DR    ++ +
Sbjct: 249 ---VLQQWHPSPDFGGVH-PDPNLTYA-KALVDRVDRENIEFGAASDGDGDRN--MIYGA 301

Query: 342 KTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFH 401
             A      G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  G +
Sbjct: 302 GPAFVS--PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSSAIDRVAKAHGLN 353

Query: 402 YEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMF--LLS 457
             +  TG+K+      A+ L   G       EE+ G     +  +KDGI A L +  LL+
Sbjct: 354 CYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHVR-EKDGIWAILAWLNLLA 405

Query: 458 YYHWVYDAHKFPLDILEDGY-KKYG 481
            Y+  +      + I++D +  KYG
Sbjct: 406 IYNKHHPDRDVSIKIIQDEFWNKYG 430

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 104/449 (23%), Positives = 174/449 (38%), Gaps = 63/449 (14%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR R +      N       T+   + I    P   K+ V +VG D R+++     
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTV---DHLNASVGVMITASHNPKMDN---G 169
             AA+    G K L +   + ++ TP     +        + G+++TASHNP   N   G
Sbjct: 73  KIAAIGAANGVKRLVVGQ-NGILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 170 YKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKE-----------DRI 218
            K   ANG    P +  N      + L  ++   D+P V  +A  E           D  
Sbjct: 132 IKYNLANGGP-APENVTNAMWEASKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 219 VYVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIK 277
               D +  ++        +  ++  +N     W  ++  ++GV       I  D LG+ 
Sbjct: 191 KAYVDFLKTIFDFPLIKSFVNHQRETKN-----WKLLFDGLNGVTGPYGRAIFADELGLP 245

Query: 278 ENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLA 337
           E+E    V +  HP P F  +  P+P    A    ++   +  I    A+D D DR    
Sbjct: 246 EDE----VLQNCHPKPDFGGLH-PDPNLTYA-RTLVDRVDRENIAFGAASDGDGDRN--M 297

Query: 338 VFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEV 397
           ++ +  A      G+ +  +  Y     Y      FQ+E    L  S  +SQ I  +A+ 
Sbjct: 298 IYGAGPAFVS--PGDSVAIIAEYASEIPY------FQREGIYGLARSFPTSQAIDLVAKH 349

Query: 398 EGFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL 455
                 +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L
Sbjct: 350 HNLSCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHI-REKDGLWAIIAWL 401

Query: 456 --LSYYHWVYDAHKFPLDILEDGY-KKYG 481
             L+ YH         +  ++D +  KYG
Sbjct: 402 NILAIYHKRNPEKDVSIKTIQDEFWDKYG 430

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 149/370 (40%), Gaps = 42/370 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +      N       T+   + I    P   K+ V VVG D RF++     
Sbjct: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHNP---KMDNGY 170
             AA+    G + L +   + L+ TP     +       + G+++TASHNP   + D G 
Sbjct: 71  KIAAIGAANGVRKLIIGQ-NGLLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   ANG    P    N    + + L  ++   D+P V  +   +D+        I+   
Sbjct: 130 KYNLANGGPA-PEPVTNKMWEVSKQLTHYKIIKDFPQVDFSKIGKDQQYGPLLVDIIDTT 188

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENED 281
           +   +   +  + +LI    + +   +  W  ++  ++G+       I  D   +  +E 
Sbjct: 189 EDYVKFMKEIFDFKLIK-EFIHKQREAKNWKLLFDSLNGITGPYGKAIFVDEFDLPADE- 246

Query: 282 YLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDS 341
              V +  HP P F  +  P+P    A    +E   +  I    A+D D DR    ++ +
Sbjct: 247 ---VLQNWHPQPDFGGLH-PDPNLTYA-HTLVERVDREKIEFGAASDGDGDRN--MIYGA 299

Query: 342 KTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFH 401
             A      G+ +  +  Y +   Y      FQK+    L  S  +S  I ++A+ +G +
Sbjct: 300 GPAFVS--PGDSVAIIAEYAKEIPY------FQKQGIYGLARSFPTSGAIDRVAKAQGLN 351

Query: 402 YEDTLTGFKW 411
             +  TG+K+
Sbjct: 352 CYEVPTGWKF 361

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 99/418 (23%), Positives = 165/418 (39%), Gaps = 56/418 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   ++ N       T+   + I    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDQPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLN--ASVGVMITASHN---PKMDNGY 170
             AA+    G K L +     L+ TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQ-YGLLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWE-----PSWDWPTVIQAAEKEDRIVYVKDQM 225
           K   +NG    P    N    I + L  ++     P  D  T+ +  +    ++ V D +
Sbjct: 132 KYNLSNGGP-APESVTNAIWDISKKLTNYKIVKDFPELDLKTIGKNKKYGPLLIDVID-I 189

Query: 226 TQLYT----KTAELQLIGGRKVLRNPGSGP-W-FVYTPMHGVGSEIFSRISEDVLGIKEN 279
           T+ Y     K  +  LI  +K + N  S   W  ++  M+GV       I  D  G+   
Sbjct: 190 TKAYVDFLKKIFDFDLI--KKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPAE 247

Query: 280 EDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVF 339
           E    V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  +
Sbjct: 248 E----VLQNWHPSPDFGGMH-PDPNLTYA-SSLVKRVDREKIEFGAASDGDGDRNMIYGY 301

Query: 340 DSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEG 399
                +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  G
Sbjct: 302 GPSFVS----PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSAAIDRVAKAHG 351

Query: 400 FHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL 455
            +  +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L
Sbjct: 352 LNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAVMAWL 401

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 112/488 (22%), Positives = 193/488 (39%), Gaps = 61/488 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +    TN  +       T+   + +    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTAVFTNEPHY------TENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLN--ASVGVMITASHN---PKMDNGY 170
             AA+    G + L +   + L+ TP     +       + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIGQ-NGLLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 171 KVYFANGCQIIPPHDLNI---ARSIDQ-NLEPWEPSWDWPTVIQAAEKEDRIVYVKDQM- 225
           K   +NG     P    I   ++ +D   + P  P     T+ +  +    +V V D   
Sbjct: 132 KYNLSNGGPAPEPVTNKIWEVSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTTR 191

Query: 226 --TQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENEDY 282
              +   +  +  LI    + +      W  ++  M+GV       I  D   +   E  
Sbjct: 192 DYVEFLKEIFDFPLIKSF-IHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPAEE-- 248

Query: 283 LCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSK 342
             V +  HP P F  +  P+P    A    ++   +  I    A+D D DR    ++ + 
Sbjct: 249 --VLQNWHPQPDFGGIH-PDPNLTYA-RSLVDRVDRENIEFGAASDGDGDRN--MIYGAG 302

Query: 343 TANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHY 402
            A      G+ +  +  Y     Y A   I+       L  S  ++  I ++AE  G   
Sbjct: 303 PAFVSP--GDSVAIIAEYAAEIPYFAKQGIYG------LARSFPTASAIDRVAEKHGLKC 354

Query: 403 EDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMF--LLSY 458
            +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +  LL+ 
Sbjct: 355 YEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAIIAWLNLLAI 406

Query: 459 YHWVYDAHKFPLDIL-EDGYKKYG--VFKEYNGYYIVDNPKIMKETFDYIRNDRKPGTQY 515
           Y+  +      + I+ E+ +KKYG   F  Y+  ++  N    K+  D +R+     T+ 
Sbjct: 407 YNRRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSNS--AKKVIDNLRSY----TEK 460

Query: 516 PEAIGSEF 523
           P  +GS+F
Sbjct: 461 PGVVGSKF 468

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 126/584 (21%), Positives = 226/584 (38%), Gaps = 99/584 (16%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNK---VAVVGHDHRFHSKEFAT 115
           GT+GLR +     +  N       T+   + I    P+       VVG D R+++     
Sbjct: 19  GTSGLRKKTVIFKDEPN------YTENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMDNGY 170
             A +    G K L +   + L+ TP     +   H   + G+++TASHN   PK D G 
Sbjct: 73  KIAKIGAANGVKKLVVGQ-NGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQN---LEPWEPSWDWPTVIQAAEKEDR--------IV 219
           K   ANG     P   ++   I +N   L  ++   D PT+  +   E++        ++
Sbjct: 132 KYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDVI 187

Query: 220 YVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKE 278
            V     +   +  + +LI  + +     +  W  ++  ++G+       I  D   + E
Sbjct: 188 DVTKAYVEFLKEIFDFELI-KKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELPE 246

Query: 279 NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAV 338
           NE    V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  
Sbjct: 247 NE----VLQNYHPQPDFGGLH-PDPNLTYA-RSLVDRVDKEKIEFGAASDGDGDRNMIYG 300

Query: 339 FDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVE 398
           +     +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  
Sbjct: 301 YGPAFVS----PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAIDRVAKAH 350

Query: 399 GFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL- 455
           G    +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L 
Sbjct: 351 GLECYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGLWAIVAWLN 402

Query: 456 -LSYYHWVYDAHKFPLDILEDGY-KKYG--VFKEYNGYYIV--DNPKIMKETFDYIRNDR 509
            L+ ++  +   +  +  ++D +  KYG   F  Y+  ++   D  K++    ++  N +
Sbjct: 403 VLAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYEHVTSEDANKVVDLLTEFTSNSK 462

Query: 510 KPGTQYPEAIGSEFQVV------SFRDLTLGFQSDTSDHIPTLPVDPNSQMITVCAKPTH 563
                +P   G E   V      S+ DL     S               Q ++V      
Sbjct: 463 TKNAPFP---GDESLTVTDCGNFSYTDLDGSVSS--------------KQGLSVKLS--- 502

Query: 564 DNVERDHVRFTIRGSGTEPK---LKVYIEACSGSETGAQQLAKQ 604
                D  RF +R SGT      +++Y+E  SG ++   Q A++
Sbjct: 503 -----DGSRFVLRLSGTGSSGATIRLYVEKYSGDKSTYGQTAEE 541

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 83/371 (22%), Positives = 143/371 (38%), Gaps = 44/371 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   +  N       T+   + I    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFKDEPN------YTENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHN---PKMDNGY 170
             AA+    G K L +     L+ TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQ-HGLLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   +NG    P    N    I + L  ++   D+P +      +++        I+ + 
Sbjct: 132 KYNLSNGGP-APESVTNAIWEISKKLTSYKIIKDFPELDLGTIGKNKKYGPLLVDIIDIT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGP-W-FVYTPMHGVGSEIFSRISEDVLGIKENE 280
                   +  +  LI  +K + N  S   W  ++  M+GV       I  D  G+  +E
Sbjct: 191 KDYVNFLKEIFDFDLI--KKFIDNQRSTKNWKLLFDSMNGVTGPYGKAIFVDEFGLPADE 248

Query: 281 DYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFD 340
               V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  + 
Sbjct: 249 ----VLQNWHPSPDFGGMH-PDPNLTYA-SSLVKRVDREKIEFGAASDGDGDRNMIYGYG 302

Query: 341 SKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGF 400
               +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  G 
Sbjct: 303 PSFVS----PGDSVAIIAEYAAEIPY------FAKQGIYGLARSFPTSGAIDRVAKAHGL 352

Query: 401 HYEDTLTGFKW 411
           +  +  TG+K+
Sbjct: 353 NCYEVPTGWKF 363

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 66/294 (22%), Positives = 114/294 (38%), Gaps = 36/294 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQA---TQGLARYIASQFP---KNKVAVVGHDHRFHSKE 112
           GT+GLR +         + V ++    T+   + I    P   K+   V+G D RF++  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 113 FATVTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLN--ASVGVMITASHN---PKMD 167
                AA+    G + L +   + L+ TP   + +      A+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIGQ-NGLLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 168 NGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IV 219
            G K   ANG    P    N    I + L  ++   D+PT+  +    D+        I+
Sbjct: 130 MGIKYNLANGGP-APESVTNAMWEISKKLTSYKIIKDFPTLDLSKIGNDQKYGPLLVDII 188

Query: 220 YVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKEN 279
               +  +      +  LI      +   +    ++  ++G+       I  D  G+   
Sbjct: 189 DTTKEYVEFLKTIFDFPLIKAFITKQRETNNWKLLFDSLNGITGPYGKAIFVDEFGLPAE 248

Query: 280 EDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADR 333
           E      +  HP P F  +  P+P    A    +E   +  I    A+D D DR
Sbjct: 249 EAL----QNWHPQPDFGGLH-PDPNLTYA-KTLVERVDREKIQFGAASDGDGDR 296

>NCAS0A04350 Chr1 (878688..880397) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 108/486 (22%), Positives = 190/486 (39%), Gaps = 63/486 (12%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +     N  N       T+   + +    P   ++   VVG D RF++     
Sbjct: 19  GTSGLRKKTAIFMNEPNY------TENFIQAMLDAIPEGSQDATLVVGGDGRFYNDVIMN 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASV--GVMITASHN---PKMDNGY 170
             AA+    G K L +   + L+ TP     +      V  G+++TASHN   P+ D G 
Sbjct: 73  KIAAISAANGVKKLIIGQ-NGLLSTPAASHIIRSYEEKVTGGIILTASHNPGGPENDLGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVK 222
           K   ANG    P    N    + + L  ++   ++P +  +   +D+        I+ V 
Sbjct: 132 KYNLANGGP-APESVTNAIWEVSKKLTHYKIIKNFPPLDLSKMGKDQKYGPLLVDIIDVT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENED 281
                   +  + +LI  + + +   +  W  ++  ++G+       I  D   +  NE 
Sbjct: 191 KDYVDFLKEIFDFELI-KKFIHKQRETKNWKLLFDSLNGITGPYGKAIFVDEFDLPANE- 248

Query: 282 YLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDS 341
              V +  HP P F  +  P+P    A    +E   +  I    A+D D DR    ++ +
Sbjct: 249 ---VLQNWHPKPDFGGLH-PDPNLTYA-KTLVERVDREKIEFGAASDGDGDRN--MIYGA 301

Query: 342 KTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFH 401
             A      G+ +  +  Y     Y      F K+    L  S  +S  I ++A+  G  
Sbjct: 302 GPAFVSP--GDSVAIIAEYASEIPY------FVKQGIYGLARSFPTSAAIDRVAKAHGLS 353

Query: 402 YEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFLLSYY 459
             +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L    
Sbjct: 354 CYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHI-REKDGLWAIVAWLNVLA 405

Query: 460 HWVYDAHKFPLD-----ILEDGYKKYG--VFKEYNGYYIV--DNPKIMKETFDYIRNDRK 510
             +Y+ H    D     I E+ + KYG   F  Y+  +I   D  K++    +++     
Sbjct: 406 --IYNKHNPEKDASIKTIQEEFWNKYGRTFFTRYDYEHISNEDASKVVDLLNNFVSKPNV 463

Query: 511 PGTQYP 516
            G+ +P
Sbjct: 464 IGSAFP 469

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 66/158 (41%), Gaps = 16/158 (10%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPK---NKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   N  N       T+   + I    P+   N   VVG D RF++     
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMDNGY 170
           + A +    G + L +     L  TP     +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIGQAGIL-STPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTV 208
           K   ANG    P    N      +NL  ++   D+P +
Sbjct: 132 KYNLANGGP-APESVTNAIWEASKNLTTYKTMKDFPKI 168

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 107/488 (21%), Positives = 195/488 (39%), Gaps = 64/488 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   +  N       T+   + I +  P   KN   VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASV---GVMITASHN---PKMDNG 169
               +    G + L +   + ++ TP   + + +   S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIGQ-NGILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 170 YKVYFANGCQIIPPHDLNIARSI---DQNLEPWE-----PSWDWPTVIQAAEKEDRIVYV 221
            K   +NG     P   +I   I    ++L  ++     P  D   V +  +    +V +
Sbjct: 132 IKYNLSNGG----PAPESITDEIWEASKHLTHYKIIENLPQLDTTKVSENVKYGPLLVDI 187

Query: 222 KDQM---TQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKE 278
            D      +L  +  +  LI      +   +    ++  ++GV       I  D LG+  
Sbjct: 188 IDSTKSYVELMKEIFDFPLIRNFIHTQREKNNWKLLFDSLNGVTGPYGKTIFVDELGLLA 247

Query: 279 NEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAV 338
           +E      +  HP P F  +  P+P    A    +E   +  IN   A+D D DR  +  
Sbjct: 248 DETL----QNWHPLPDFGGLH-PDPNLTYA-HTLVERVDREMINFGAASDGDGDRNMIYG 301

Query: 339 FDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVE 398
           +     +     G+ +  +  Y     Y      F K+    +  S  +S  I ++A+ +
Sbjct: 302 YGPSFVS----PGDSLAIISEYADEIPY------FAKQGMFGVARSFPTSSAIDRVAKAK 351

Query: 399 GFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL- 455
           G +  +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L 
Sbjct: 352 GLNCYEVPTGWKFFCALFDAQKLSICG-------EESFGTGSNHI-REKDGLWAIVAWLN 403

Query: 456 -LSYYHWVYDAHKFPL-DILEDGYKKYG----VFKEYNGYYIVDNPKIMKETFDYIRNDR 509
            L+ Y+      +  + +I  D + KYG       +Y      D  K++K   DY+ + +
Sbjct: 404 ILAIYNKRNPEKESSIKNIQMDFWLKYGRTFFTRYDYENLSSEDAEKVVKLLKDYVSDPQ 463

Query: 510 KPGTQYPE 517
              +++PE
Sbjct: 464 TLNSRFPE 471

>TBLA0B09010 Chr2 complement(2135961..2137670) [1710 bp, 569 aa]
           {ON} Anc_2.445 YKL127W
          Length = 569

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 110/492 (22%), Positives = 186/492 (37%), Gaps = 69/492 (14%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   +  N       T+   + I    P   K+   VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMDEPNY------TENFIQAIMDAIPEGSKDATLVVGGDGRFYNDVIMN 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASV--GVMITASHN---PKMDNGY 170
             AA+    G K L +   + ++ TP     +      V  G+++TASHN   P  D G 
Sbjct: 73  KIAAIGAANGVKKLIIGQ-NGILSTPAASHIIRTYKDKVTGGIILTASHNPGGPTNDLGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWE-----PSWDWPTVIQAAEKEDRIVYVKDQM 225
           K    NG    P    +      + L  ++     P  D  T+++  +  + +V + D  
Sbjct: 132 KYNLGNGAP-APEAVTDAIWEASKKLTDYKIVNDFPELDLATIVENKKYGNLLVDIIDS- 189

Query: 226 TQLYTKTA----ELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENE- 280
           T+ Y K      +  LI    V +        ++  ++GV       I  D  G+  +E 
Sbjct: 190 TEAYVKYMKEIFDFPLIKKFIVSQRETKNWKLLFDSLNGVTGPYGKAIFADEFGLPADEV 249

Query: 281 --DYLCVPE--QKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSL 336
             +Y+  P+    HPDP+                  +    +  I    A+D D DR  +
Sbjct: 250 LQNYVPKPDFGGLHPDPNLTYAK-----------TLVSRVDKEKIEFGAASDGDGDRNMI 298

Query: 337 AVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAE 396
             +     +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+
Sbjct: 299 YGYGPTFVS----PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSSAIDRVAK 348

Query: 397 VEGFHYEDTLTGFKWIGNRARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL- 455
               +  +  TG+K+   +  D  K         EE+ G     +  +KDG+ A + +L 
Sbjct: 349 EHNLNCYEVPTGWKFF-CKLFDENKLSICG----EESFGTGSNHV-REKDGVWAIMAWLN 402

Query: 456 -LSYYHWVYDAHKFPLDILEDGY-KKYG--VFKEYNGYYIVDNPKIMKETFDYIRNDRKP 511
            L+ Y+  +      L  ++D +  KYG   F  Y      D   I  ET + I +  K 
Sbjct: 403 ILAIYNKKHPERDASLKTIQDEFWAKYGRTFFTRY------DFENIKSETANEIVDILKN 456

Query: 512 GTQYPEAIGSEF 523
                +AIGS F
Sbjct: 457 FISKSDAIGSVF 468

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 80/374 (21%), Positives = 151/374 (40%), Gaps = 50/374 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   N          T+   + I    P   ++ V VVG D R+++ E   
Sbjct: 19  GTSGLRKKTKVFMNEP------HYTENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHN---PKMDNGY 170
               +    G K L +   + L+ TP     +      ++ G+++TASHN   P+ D G 
Sbjct: 73  KIGEIGAANGVKKLIVGQ-NGLLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSI---DQNLEPWEPSWDWPTVIQAAEKEDR--------IV 219
           K   +NG     P   ++  SI    + L  ++   ++P +  +   +++        ++
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVI 187

Query: 220 YVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPWF--VYTPMHGVGSEIFSRISEDVLGIK 277
            V  +  +L  +  +  LI  +K + +  S   F  ++  ++G+       I  D LG+ 
Sbjct: 188 DVTAEYVKLMKEIFDFDLI--KKFIDHQRSTKGFKILFDALNGITGPYGKAIFADELGLP 245

Query: 278 ENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLA 337
             E    V +   P P F  +  P+P    A    +E   +  I    A+D D DR  + 
Sbjct: 246 AEE----VLQNYEPKPDFGGLH-PDPNLTYA-HTLVERVDKEQIAFGAASDGDGDRNMIY 299

Query: 338 VFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEV 397
                  +     G+ +  +  Y     Y      F+K+    L  S  +S  I ++A+ 
Sbjct: 300 GCGPAFVS----PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTSAAIDRVAKA 349

Query: 398 EGFHYEDTLTGFKW 411
           +G +  +  TG+K+
Sbjct: 350 QGLNCYEVPTGWKF 363

>KLLA0B12694g Chr2 (1107696..1109402) [1707 bp, 568 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 568

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 100/447 (22%), Positives = 180/447 (40%), Gaps = 61/447 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +      N       T+   + I    P   +    V+G D R+++     
Sbjct: 19  GTSGLRKKTKVFEETPNY------TENFIQAIMEAIPEGSQGATLVIGGDGRYYNDVVIQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMDNGY 170
             AA+    G + + +   + ++ TP     +   H   + G+++TASHN   P  D G 
Sbjct: 73  KIAAIGSANGVRKIVIGH-NGILSTPAASHIIRAYHEKCTGGIILTASHNPGGPTNDFGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSI---DQNLEPWE-----PSWDWPTVIQAAEKEDRIVYVK 222
           K   ANG     P   ++  SI    + L  ++     P+ D   + Q  +  D +V + 
Sbjct: 132 KYNLANGG----PAPESVTNSIWHKSRELTHYKIVESFPAIDLTKIGQDQKYGDLLVDIV 187

Query: 223 DQMT---QLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKEN 279
           D      +L  +  +  LI    +     +G   ++  M+GV       +    LG+ E+
Sbjct: 188 DSTAAYVELMKEIFDFPLIKSF-IDTQAKNGFKILFDAMNGVTGPYGEALFVKELGLPES 246

Query: 280 EDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVF 339
                  +  HP P F  +  P+P    A    +E   + GI    A+D D DR    ++
Sbjct: 247 S-----LQNYHPKPDFGGLH-PDPNLTYA-HTLVERVDKYGIQFGAASDGDGDRN--MIY 297

Query: 340 DSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEG 399
            +  A      G+ +  +  Y     Y      F+K+    L  S  +S  I ++A+ +G
Sbjct: 298 GAGPAFVSP--GDSVAIIAEYASAIPY------FKKQGIYGLARSFPTSSAIDRVAKEQG 349

Query: 400 FHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHDKDGISASLMFL-- 455
            +  +  TG+K+      A+ L   G       EE+ G     +  +KDG+ A + +L  
Sbjct: 350 LNCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHV-REKDGVWAIMAWLNI 401

Query: 456 LSYYHWVYDAHKFPL-DILEDGYKKYG 481
           L+ Y+  +   +  +  I  D ++KYG
Sbjct: 402 LAIYNQRFPNKEASIKSIQTDFWQKYG 428

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 78/375 (20%), Positives = 141/375 (37%), Gaps = 51/375 (13%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +      N       T+   + +    P   ++   VVG D RF++     
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPF---TVDHLNASVGVMITASHNP---KMDNG 169
             AA+    G   L +   + ++ TP       T  H   + G+++TASHNP   K D G
Sbjct: 73  KIAAIGAANGVHKLVIGQ-NGILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 170 YKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYV 221
            K   +NG    P    N      + L  ++   ++P +  + +  D+        I+  
Sbjct: 132 IKYNLSNGGP-APESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDIIDS 190

Query: 222 KDQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENE- 280
            +   +L     +  LI      +    G   ++  ++GV       +  D LG+   E 
Sbjct: 191 TEAYVKLMKSIFDFDLIKKFIKTQKETVGFKLLFDSLNGVTGPYGKALFVDELGLSAEES 250

Query: 281 --DYLCVPE--QKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSL 336
             +Y+  P+    HPDP+                  +E   ++ I    A+D D DR  +
Sbjct: 251 LQNYVPKPDFGGLHPDPNLTYAH-----------TLVERVDKDKIAFGAASDGDGDRNMI 299

Query: 337 AVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAE 396
             +     +     G+ +  +  Y     Y      F K+    L  S  +S  I ++A+
Sbjct: 300 YGYGPAFVS----PGDSVAIIAEYASEIPY------FAKQGIYGLARSFPTSAAIDRVAK 349

Query: 397 VEGFHYEDTLTGFKW 411
             G +  +  TG+K+
Sbjct: 350 AHGLNCYEVPTGWKF 364

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 45/95 (47%), Gaps = 16/95 (16%)

Query: 146 TVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP-SWD 204
           ++ H   +VGVM+TASHNP +DNG K+   NG  +                + WEP + D
Sbjct: 54  SLSHDGKAVGVMVTASHNPPVDNGVKIVEPNGSMLS---------------QDWEPIATD 98

Query: 205 WPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIG 239
              +    + ++ + +V  ++ +L +      ++G
Sbjct: 99  LANLASQGKIDELVQFVNAKLIELNSNKVPTLIVG 133

>TPHA0G02470 Chr7 (507445..509154) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 55/128 (42%), Gaps = 15/128 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPK---NKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   N  N       T+   + I    P+   +   VVG D RF++     
Sbjct: 19  GTSGLRKKTKIFMNEPNY------TENFIQAILDAIPEGSEDSTLVVGGDGRFYNDVILQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMDNGY 170
           + A +    G + L +     L  TP     +   H   + G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIGQAGIL-STPATSHVIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 171 KVYFANGC 178
           K   ANG 
Sbjct: 132 KYNLANGA 139

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180
           AGF+ L  N  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 28  AGFRTLAKNL-DTVMFTTGILAILRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

Query: 181 IP---PHDLNIARS 191
           +    P+ + +A +
Sbjct: 87  LATWEPYAMQLANT 100

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 82/371 (22%), Positives = 146/371 (39%), Gaps = 44/371 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +     ++         T+   + I    P   K    VVG D R+++     
Sbjct: 19  GTSGLRKKTRVFKDKP------HYTENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHNP---KMDNGY 170
             AA+    G K L +     L+ TP     +       + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQ-HGLLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTV-IQAAEKEDR-------IVYVK 222
           K   +NG    P    N    I + +  ++   D+P + ++   K  +       ++ + 
Sbjct: 132 KYNLSNGGP-APEPVTNKIWEISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDIT 190

Query: 223 DQMTQLYTKTAELQLIGGRKVLRNPGSGP-W-FVYTPMHGVGSEIFSRISEDVLGIKENE 280
                   +  + +LI  +K + N      W  ++  M+GV       I  D  G+  +E
Sbjct: 191 KAYVDFLKEIFDFELI--KKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPADE 248

Query: 281 DYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFD 340
               V +Q HP P F  V  P+P    A    ++  ++  I    A+D D DR    ++ 
Sbjct: 249 ----VLQQWHPQPDFGGVH-PDPNLTYA-KALVDRVNREKIEFGAASDGDGDRN--MIYG 300

Query: 341 SKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGF 400
           +  A      G+ +  +  Y     Y      F+K+    L  S  ++  I ++A+  G 
Sbjct: 301 AGPAFVSP--GDSVAIIAEYASEIPY------FKKQGIYGLARSFPTASSIDRVAKAHGL 352

Query: 401 HYEDTLTGFKW 411
           +     TG+K+
Sbjct: 353 NCYQVPTGWKF 363

>Smik_11.112 Chr11 (189511..191223) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 140/370 (37%), Gaps = 41/370 (11%)

Query: 59  GTAGLRSRMEAGTNRLN-SLVILQATQGLARYIAS--QFPKNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +     + L+ +   +QAT      I S    P     VVG D RF++     
Sbjct: 19  GTSGLRKKTRVFMDELHYTENFIQAT------IESIPNGPGGVTLVVGGDGRFYNDVIMN 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPL---VPFTVDHLNASVGVMITASHN---PKMDNG 169
             AAV    G + L +  G  L+ TP    V  T +   +  G+++TASHN   P+ D G
Sbjct: 73  KIAAVGAANGVRKLVIGQGG-LLSTPAASHVIRTYEDKCSGGGIILTASHNPGGPENDLG 131

Query: 170 YKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTV-IQAAEKEDR-------IVYV 221
            K    NG    P    N      + L  ++   D+P + +    K  R       I+  
Sbjct: 132 IKYNLPNGGP-APESVTNAIWEASKKLTHYKIIKDFPELNLNKLGKNQRYGPLLVDIIEP 190

Query: 222 KDQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENED 281
                QL  +  +  LI G    +    G   ++  ++G+       +  D  G+   E 
Sbjct: 191 AKAYVQLLKEIFDFDLIRGFLKEQRRVKGWKLLFDSLNGITGPYGKALFVDEFGLPAEE- 249

Query: 282 YLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDS 341
              V +  HP P F  +  P+P    A    ++   +  I    A+D D DR  +  +  
Sbjct: 250 ---VLQNWHPLPDFGGLH-PDPNLTYA-HTLVDRVDREKIEFGAASDGDGDRNMIYGYGP 304

Query: 342 KTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFH 401
              +     G+ +  +  Y     Y      F K     L  S  +S  I ++A   G  
Sbjct: 305 AFVS----PGDSVAIIAQYAPDIPY------FVKHGIYGLARSFPTSSAIDRVAAKNGLK 354

Query: 402 YEDTLTGFKW 411
             +  TG+K+
Sbjct: 355 CYEVPTGWKF 364

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 30/66 (45%), Gaps = 15/66 (22%)

Query: 152 ASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQA 211
           +++GVM+TASHNP  DNG K+   NG  +               L+ WEP       I A
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSML---------------LQEWEPKATQFANIAA 110

Query: 212 AEKEDR 217
            E  D 
Sbjct: 111 NESFDE 116

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 5/73 (6%)

Query: 124 AGFKVLYLNPGDTLVHTPLVPF--TVDHLNASVGVMITASHNPKMDNGYKVYFANGCQII 181
           AGF+ L  N    +  T ++    ++      VGVMITASHNP  DNG K+   +G  ++
Sbjct: 28  AGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

Query: 182 P---PHDLNIARS 191
               P+ + +A +
Sbjct: 88  ATWEPYAMQLANA 100

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 15/50 (30%)

Query: 152 ASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP 201
           A VGVMITASHNP  DNG K+  ++G  +               L+ WEP
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSML---------------LQDWEP 86

>Skud_11.102 Chr11 (190406..192118) [1713 bp, 570 aa] {ON} YKL127W
           (REAL)
          Length = 570

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTA 118
           GT+GLR + +   N  +        Q +   I +  P     VVG D RF++       A
Sbjct: 19  GTSGLRKKTKVFMNEPH--YTENFIQAMMESIPNG-PDGATLVVGGDGRFYNDVIMNKIA 75

Query: 119 AVFLRAGFKVLYLNPGDTLVHTPLVPFTV----DHLNASVGVMITASHN---PKMDNGYK 171
           AV    G + L +  G  L+ TP     +    D  N   G+++TASHN   P+ D G K
Sbjct: 76  AVGAANGIRKLIIGQGG-LLSTPAASHIIRTYEDRCNGG-GIILTASHNPGGPENDLGIK 133

Query: 172 VYFANG 177
               NG
Sbjct: 134 YNLRNG 139

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 64/262 (24%), Positives = 105/262 (40%), Gaps = 38/262 (14%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQA---TQGLARYIASQFPK---NKVAVVGHDHRFHSKE 112
           GT+GLR + +         V  Q    T+   + I    P+   N V V+G D R+++  
Sbjct: 19  GTSGLRKKTK---------VFEQTEHYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDA 69

Query: 113 FATVTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMD 167
                A V    G + L +   + L+ TP     +   H   + G+++TASHN   P  D
Sbjct: 70  VMQKIAEVGSANGVRKLIIGQ-NGLLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDND 128

Query: 168 NGYKVYFANGCQIIPPHDLNIARSIDQNLEPWE-----PSWDWPTVIQAAEKEDRIVYVK 222
            G K   ANG    P    N      +NL  ++     P  D   + +  +  + +V V 
Sbjct: 129 FGIKYNLANGAP-APEKVTNSMFERSRNLTHYKITRGMPKLDLGKIGENQQYGNLLVDVI 187

Query: 223 D---QMTQLYTKTAELQLIGGRKVLRNPGS--GPWFVYTPMHGVGSEIFSRISEDVLGIK 277
           D      +L  +  +  LI  +K L +     G   ++  ++G+       I  D LG+ 
Sbjct: 188 DPTEAYVRLMKEIFDFPLI--KKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDELGLS 245

Query: 278 ENEDYLCVPEQK----HPDPSF 295
           E+     VP+      HPDP+ 
Sbjct: 246 EDSLQNFVPKPDFGGLHPDPNL 267

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 17/28 (60%), Positives = 20/28 (71%)

Query: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181
           VGVM+TASHNP +DNG KV    G  +I
Sbjct: 60  VGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>Suva_11.98 Chr11 (189966..191678) [1713 bp, 570 aa] {ON} YMR105C
           (REAL)
          Length = 570

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 54/126 (42%), Gaps = 12/126 (9%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTA 118
           GT+GLR + +   N  +        Q +   I  + P     VVG D RF++       A
Sbjct: 19  GTSGLRKKTKVFMNEPH--YTENFIQAMMECIP-EGPSGATLVVGGDGRFYNDVIMNKIA 75

Query: 119 AVFLRAGFKVLYLNPGDTLVHTPLVPFTV----DHLNASVGVMITASHN---PKMDNGYK 171
           AV    G K L +     L+ TP     +    D+ N   G+++TASHN   P+ D G K
Sbjct: 76  AVGAANGIKKLVIGQAG-LLSTPAASHIIRTYEDNCNGG-GIILTASHNPGGPENDLGIK 133

Query: 172 VYFANG 177
               NG
Sbjct: 134 YNLPNG 139

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180
           AGF+ L  +  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 28  AGFRTLAKDL-DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

Query: 181 IP---PHDLNIARS 191
           +    P+ + +A +
Sbjct: 87  LASWEPYAMQLANA 100

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 20/28 (71%)

Query: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181
           VGVMITASHNP  DNG KV   +G  +I
Sbjct: 57  VGVMITASHNPSGDNGVKVVEPDGSMLI 84

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 57/127 (44%), Gaps = 15/127 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFPK---NKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +   +  +       T+   + I    P+   N   VVG D R+++ E   
Sbjct: 19  GTSGLRKKTKVFKDEPHY------TENFIQAILEAIPEGSENATLVVGGDGRYYNNEVMQ 72

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL--NASVGVMITASHN---PKMDNGY 170
           +  A+    G + + L   + ++ TP     +       + G+++TASHN   P+ D G 
Sbjct: 73  IIGAIAAANGVRKMILGQ-NGILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDFGI 131

Query: 171 KVYFANG 177
           K   +NG
Sbjct: 132 KYNLSNG 138

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 39/77 (50%), Gaps = 16/77 (20%)

Query: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP-SWDWPTVIQA 211
           +VGVMITASHNP  DNG K+   NG              +DQ+   WEP + +   +   
Sbjct: 53  AVGVMITASHNPPEDNGVKIVEPNGAM------------LDQS---WEPMATELANIAAN 97

Query: 212 AEKEDRIVYVKDQMTQL 228
           +  +D   YV++++ + 
Sbjct: 98  STFDDLKAYVEEKVKKF 114

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 38.5 bits (88), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 81/371 (21%), Positives = 140/371 (37%), Gaps = 43/371 (11%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR +        N       T+   + I    P   K    VVG D R+++     
Sbjct: 20  GTSGLRKKTAIFEKEPNY------TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHL---NASVGVMITASHN---PKMDNG 169
             AA+    G K L +   + L+ TP     +        + G+++TASHN   PK D G
Sbjct: 74  NIAAIGAANGVKKLIVGQ-NGLLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 170 YKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYV 221
            K    NG     P    I  +  + L+ ++   D+P +      +++        ++  
Sbjct: 133 IKYNIQNGAPAPEPVTEAIWEA-SKKLQNYKIIKDFPELELKTLGKNKQYGPLLVDVIDT 191

Query: 222 KDQMTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENE 280
            +   Q   +  +  LI  + V     +  W  ++  M+GV       I  D LG+  +E
Sbjct: 192 CEAYVQFIKEIFDFPLI-KKFVDTQRKTKNWKLLFDGMNGVTGPYGKAIFVDELGLPADE 250

Query: 281 DYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFD 340
               V +  HP P F     P+P    A    ++   +  I    A+D D DR  +  + 
Sbjct: 251 ----VLKDWHPSPDFGG-HHPDPNLTYA-KSLVDRVDKEKIEFGAASDGDGDRNMIYGYG 304

Query: 341 SKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGF 400
               +     G+ +  +  Y     Y      F+K     L  S  ++  I ++A+  G 
Sbjct: 305 PAFVS----PGDSVAIIAEYASDIPY------FKKNGIYGLARSFPTASSIDRVAKAHGL 354

Query: 401 HYEDTLTGFKW 411
              +  TG+K+
Sbjct: 355 KAYEVPTGWKF 365

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 7/74 (9%)

Query: 124 AGFKVLYLNPGDTLVHTPLVPFTVDHLNAS---VGVMITASHNPKMDNGYKVYFANGCQI 180
           AGF+ L  +  DT++ T  +   +  L      VGVMITASHNP  DNG K+   +G  +
Sbjct: 28  AGFRTLAKDL-DTVMFTTGILAVLRSLKLQGQYVGVMITASHNPYQDNGVKIVEPDGSML 86

Query: 181 IP---PHDLNIARS 191
           +    P+ + +A +
Sbjct: 87  LAAWEPYAMQLANA 100

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 20/28 (71%)

Query: 154 VGVMITASHNPKMDNGYKVYFANGCQII 181
           +GVMITASHNP  DNG K+   +G  +I
Sbjct: 59  IGVMITASHNPPQDNGVKIVEPSGAMLI 86

>YKL127W Chr11 (203541..205253) [1713 bp, 570 aa] {ON}
           PGM1Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate, which is a key step in hexose
           metabolism
          Length = 570

 Score = 37.7 bits (86), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 85/378 (22%), Positives = 142/378 (37%), Gaps = 44/378 (11%)

Query: 101 VVGHDHRFHSKEFATVTAAVFLRAGFKVLYLNPGDTLVHTPLVPF---TVDHLNASVGVM 157
           VVG D RF++       AAV    G + L +  G  L+ TP       T +      G++
Sbjct: 58  VVGGDGRFYNDVIMNKIAAVGAANGVRKLVIGQGG-LLSTPAASHIIRTYEEKCTGGGII 116

Query: 158 ITASHN---PKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTV-IQAAE 213
           +TASHN   P+ D G K    NG    P    N      + L  ++   ++P + +    
Sbjct: 117 LTASHNPGGPENDLGIKYNLPNGGP-APESVTNAIWEASKKLTHYKIIKNFPKLNLNKLG 175

Query: 214 KEDR-------IVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIF 266
           K  +       I+       Q   +  +  LI      +    G   ++  ++G+     
Sbjct: 176 KNQKYGPLLVDIIDPAKAYVQFLKEIFDFDLIKSFLAKQRKDKGWKLLFDSLNGITGPYG 235

Query: 267 SRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIA 326
             I  D  G+   E    V +  HP P F  +  P+P    A    ++   +  I    A
Sbjct: 236 KAIFVDEFGLPAEE----VLQNWHPLPDFGGLH-PDPNLTYA-RTLVDRVDREKIAFGAA 289

Query: 327 NDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTV 386
           +D D DR  +  +     +     G+ +  +  Y     Y A   I+       L  S  
Sbjct: 290 SDGDGDRNMIYGYGPAFVS----PGDSVAIIAEYAPEIPYFAKQGIYG------LARSFP 339

Query: 387 SSQMIKKMAEVEGFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEHD 444
           +S  I ++A  +G    +  TG+K+      A+ L   G       EE+ G     +  +
Sbjct: 340 TSSAIDRVAAKKGLRCYEVPTGWKFFCALFDAKKLSICG-------EESFGTGSNHI-RE 391

Query: 445 KDGISASLMFL--LSYYH 460
           KDG+ A + +L  L+ YH
Sbjct: 392 KDGLWAIIAWLNILAIYH 409

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 15/48 (31%)

Query: 154 VGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP 201
           +GVM+TASHNP +DNG KV   +G  ++P              E WEP
Sbjct: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMP--------------ESWEP 91

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 16/21 (76%), Positives = 17/21 (80%)

Query: 152 ASVGVMITASHNPKMDNGYKV 172
           A VGVM+TASHNP  DNG KV
Sbjct: 56  AQVGVMVTASHNPPEDNGVKV 76

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 27/113 (23%)

Query: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEPSWD-WPTVIQA 211
           +VGVMITASHNP  DNG K+                   +D   E  E SW+ + T +  
Sbjct: 57  TVGVMITASHNPPEDNGVKI-------------------VDPKGEMLEQSWESYATDLAN 97

Query: 212 AEKED---RIVYVKDQMTQLYTKTAELQLIGGRKVLRNPG-SGPWFVYTPMHG 260
           +  +     + Y+++ +++L   T  L   G   V R+   SGP  ++  ++G
Sbjct: 98  SATQSFTAFLAYLQNLVSELGLDTDAL---GSLAVARDSRESGPRLLHALLNG 147

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 154 VGVMITASHNPKMDNGYKV 172
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>Ecym_2475 Chr2 complement(927999..929702) [1704 bp, 567 aa] {ON}
           similar to Ashbya gossypii ABL029W
          Length = 567

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 102/427 (23%), Positives = 165/427 (38%), Gaps = 76/427 (17%)

Query: 59  GTAGLRSRMEAGTNRLNSLVILQATQGLARYIASQFP---KNKVAVVGHDHRFHSKEFAT 115
           GT+GLR + +              T+   + I    P   ++ + VVG D R+++     
Sbjct: 19  GTSGLRKKTKVFQQE-------HYTENFIQAILEAIPEGCQDAILVVGGDGRYYNDVVMQ 71

Query: 116 VTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASV--GVMITASHN---PKMDNGY 170
             A V    G K L +   + L+ TP     +      V  G+++TASHN   P  D G 
Sbjct: 72  KIAEVGSANGVKKLIIGQ-NGLMSTPAASHLIRTYAEKVTGGIILTASHNPGGPDNDLGI 130

Query: 171 KVYFANGCQIIPPHDLNIARSIDQNL------EPWEPSWDWPTVIQAAEKEDRIVYVKDQ 224
           K   ANG    P    +    I + L      EP+ P  D   +    +  D +V + D 
Sbjct: 131 KYNLANGAP-APEKVTSAMYEISKKLTHYKIVEPF-PKLDLSRIGTDQKYGDLLVDIIDT 188

Query: 225 M---TQLYTKTAELQLIGGRKVLRNPGSGPWF--VYTPMHGVGSEIFSRISEDVLGIKEN 279
                +L  +  +  LI  +  L+   S   F  ++  ++G+       I  D LG+ E+
Sbjct: 189 TAAYVKLVKEIFDFDLI--KSFLQKAQSEYDFKILFDALNGITGPYGRAIFVDELGLPEH 246

Query: 280 EDYLCVPEQK----HPDPSFPTVSFPNPEEKGALDKAIELAS---QNGINLVIANDPDAD 332
               C P       HPDP+              L  A +L S   +  I    A+D D D
Sbjct: 247 FLQHCTPLPDFGGLHPDPN--------------LTYAHDLVSRVDEEQIAFGAASDGDGD 292

Query: 333 RFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIK 392
           R    ++ +  A      G+ +  +  Y Q   Y A + I        L  S  +S  I 
Sbjct: 293 RN--MIYGAGPAFVS--PGDSVAIIAEYAQEIPYFAKNGIHG------LARSFPTSGAID 342

Query: 393 KMAEVEGFHYEDTLTGFKWIGN--RARDLEKKGFFAPFGYEEAIGYMFTQMEH--DKDGI 448
            +A+  G +  +  TG+K+  N   ++ L   G       EE+ G   T  +H  +KDG+
Sbjct: 343 LVAKEHGLNCYEVPTGWKFFCNLFDSKKLSICG-------EESFG---TGSDHIREKDGL 392

Query: 449 SASLMFL 455
            A + +L
Sbjct: 393 WAIIAWL 399

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 154 VGVMITASHNPKMDNGYKV 172
           VGVMITASHNP  DNG K+
Sbjct: 58  VGVMITASHNPPQDNGVKI 76

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 17/20 (85%)

Query: 153 SVGVMITASHNPKMDNGYKV 172
           +VGVMITASHNP  DNG K+
Sbjct: 57  TVGVMITASHNPPEDNGVKI 76

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 35.4 bits (80), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 31/71 (43%), Gaps = 18/71 (25%)

Query: 107 RFHSKEFATVTAAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKM 166
           R  ++  A V  A  L A  + LYL                    A VGVM+TASHNP  
Sbjct: 29  RSRAEVLAPVVFATGLLACLRSLYLG------------------GAYVGVMLTASHNPPE 70

Query: 167 DNGYKVYFANG 177
           DNG K+   +G
Sbjct: 71  DNGVKLVDPHG 81

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 12/47 (25%)

Query: 153 SVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPW 199
           +VGVMITASHN   DNG K+   +G              +DQ+ EP+
Sbjct: 57  AVGVMITASHNQPCDNGVKIVEPDGSM------------LDQSWEPF 91

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 54/125 (43%), Gaps = 11/125 (8%)

Query: 59  GTAGLRSRMEAGTNRLN-SLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVT 117
           GT+GLR + +      N +   +QAT         +  K    VVG D R+++       
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATMDAI----PEGCKGATLVVGGDGRYYNDVIMNKI 74

Query: 118 AAVFLRAGFKVLYLNPGDTLVHTPLVPFTVDHLN--ASVGVMITASHN---PKMDNGYKV 172
            ++    G + L +   + ++ TP     +       + G+++TASHN   PK D G K 
Sbjct: 75  VSIAGANGVRKLIIGH-NGILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKNDIGIKY 133

Query: 173 YFANG 177
             ANG
Sbjct: 134 NLANG 138

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 28/58 (48%), Gaps = 11/58 (18%)

Query: 126 FKVLYLNPG--------DTLVHTP--LVPFTVDHLNAS-VGVMITASHNPKMDNGYKV 172
           FK +Y   G        DT++ T   L      HL    VG MITASHNP  DNG K+
Sbjct: 19  FKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVGAMITASHNPPQDNGVKL 76

>NCAS0B02580 Chr2 complement(431287..433008) [1722 bp, 573 aa] {ON}
           Anc_8.467
          Length = 573

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 35/72 (48%), Gaps = 7/72 (9%)

Query: 213 EKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLRNPGSGPWFVYTPMHGVGSEIFSRISED 272
           E + +I+Y +D+MTQ  T + ++ +   RK + N     W        + S+  +R+  D
Sbjct: 3   EVQLQILYAEDKMTQSMTDSWQITVSKKRKQVLNNIPTEWI-------LDSKTIARLKSD 55

Query: 273 VLGIKENEDYLC 284
             G+  N D LC
Sbjct: 56  KTGLSHNIDQLC 67

>ADR120C Chr4 complement(917400..919028) [1629 bp, 542 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL071W
           (ARG2)
          Length = 542

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 5/83 (6%)

Query: 126 FKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVM---ITASHNPKMDNGYKVYFANGCQI 180
           F +++   GD LV        V+  +   SVGV+   I   H PK DN +K+++  G + 
Sbjct: 457 FNLMFKKFGDELVWRSRRENVVNNWYFQRSVGVLDLSIDIGHGPKKDNIFKLFYYGGKKG 516

Query: 181 IPPHDLNIARSIDQNLEPWEPSW 203
              +D +  R     +   EPSW
Sbjct: 517 TQFYDFDRLREYITYVRDIEPSW 539

>NDAI0C02220 Chr3 (494856..495781) [926 bp, 308.666666666667 aa]
           {ON} 
          Length = 308

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 68/308 (22%), Positives = 120/308 (38%), Gaps = 33/308 (10%)

Query: 118 AAVFLRAGFKVLYLNPGDTLVHTPLVPFTVD--HLNASVGVMITASHN---PKMDNGYKV 172
           AA+    G K L +   + L+ TP     +   H   + G+++TASHN   P+ D G K 
Sbjct: 5   AAIGAANGVKKLIIGQ-NGLLSTPAASHIIRSYHEKVTGGIILTASHNPGGPENDLGIKY 63

Query: 173 YFANGCQIIPPHDLNIARSIDQNLEPWEPSWDWPTVIQAAEKEDR--------IVYVKDQ 224
             ANG    P    N    + + L  ++   D P +  +    D+        I+ V   
Sbjct: 64  NLANGGP-APESVTNAIWEVSKKLTSYKIVKDLPKLNLSKIGNDQKYGPLLVDIIDVTKA 122

Query: 225 MTQLYTKTAELQLIGGRKVLRNPGSGPW-FVYTPMHGVGSEIFSRISEDVLGIKENEDYL 283
             +L  +  +  LI    + +   +  W  ++  ++G+       I  +  G+  +E   
Sbjct: 123 YVELLKEIFDFDLI-KNFIQKQRETKNWKLLFDSLNGITGPYGHAIFVEEFGLPADE--- 178

Query: 284 CVPEQKHPDPSFPTVSFPNPEEKGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKT 343
            V +  HP P F  +  P+P    A    +E   +  I    A+D D DR    ++ +  
Sbjct: 179 -VLQNWHPKPDFGGLH-PDPNLTYA-KTLVERVDKEKIEFGAASDGDGDRN--MIYGAGP 233

Query: 344 ANWRQLTGNEIGFLFAYQQFEMYKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYE 403
           A      G+ +  +  Y     Y      F+K+    L  S  +S  I ++A   G    
Sbjct: 234 AFVS--PGDSVAIIAEYASEIPY------FKKQGIYGLARSFPTSAAIDRVAAKHGLKCY 285

Query: 404 DTLTGFKW 411
           +  TG+K+
Sbjct: 286 EVPTGWKF 293

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 37/74 (50%), Gaps = 5/74 (6%)

Query: 263 SEIFSRISEDVLGIKENEDYLCVPEQKHP--DPSFPTVSFP--NPEEKGALDKAIELASQ 318
           SE +  I++      E+ED++ V  Q H   +   P ++ P  N  +K AL K   L+++
Sbjct: 547 SEHYLNITQSQAAADEDEDFMTVKRQDHQLNEEELPALTVPTSNRGQKKALSKKASLSTK 606

Query: 319 -NGINLVIANDPDA 331
            N   LV  +D +A
Sbjct: 607 GNATKLVFDDDGEA 620

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 52/117 (44%), Gaps = 19/117 (16%)

Query: 226 TQLYTKTAELQLIGGRK-------------VLRNPGSGPWFVYTPMHGVGSEIFSRISED 272
           + L T+ AELQ I  ++             +L          +   HG+G   +S  +  
Sbjct: 181 SMLATEFAELQFIAEKRDWTKFICSQSCYSLLYREDERELIPFAKKHGIGLIPWSPNARG 240

Query: 273 VLGIKENEDYLCVPEQKHPDPSFPTVSFPNPE--EKGALDKAIELASQNGINLVIAN 327
           +L    N+      ++K+ DP+F  + F   E  EKG +++  ELA + GI++ + +
Sbjct: 241 ILTRPLNQ----ATDRKNSDPTFKRLKFDCLESHEKGIVNRVEELAKKKGISMAMVS 293

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,587,210
Number of extensions: 3134840
Number of successful extensions: 7191
Number of sequences better than 10.0: 79
Number of HSP's gapped: 7273
Number of HSP's successfully gapped: 80
Length of query: 625
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 509
Effective length of database: 40,180,143
Effective search space: 20451692787
Effective search space used: 20451692787
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)