Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002608.843ON55055027690.0
NCAS0A02540singletonON53949818010.0
KAFR0B03930singletonON55550217950.0
Suva_13.4678.843ON54352517290.0
NCAS0C004008.843ON51749817110.0
NDAI0E002808.843ON54952216980.0
KNAG0G034308.843ON54249916850.0
NDAI0K004008.843ON55352916740.0
Skud_13.4518.843ON53952416680.0
KAFR0B039408.843ON54752816650.0
Smik_13.4928.843ON54351616500.0
NCAS0B002908.843ON54251716380.0
YML116W (ATR1)8.843ON54251316260.0
YMR279C8.843ON54051316200.0
Suva_13.278.843ON55351416130.0
Skud_13.258.843ON53752416100.0
Kwal_27.102458.843ON51550415770.0
CAGL0M03003g8.843ON55852615810.0
SAKL0D01386g8.843ON52150615700.0
Smik_13.188.843ON54551915710.0
KLTH0C03806g8.843ON52550715310.0
CAGL0B02343g8.843ON53751415120.0
TDEL0B005508.843ON53751215110.0
TPHA0C047908.843ON55653114950.0
Kpol_541.168.843ON52851014820.0
TBLA0D032708.843ON55053014350.0
TBLA0D03280singletonON58052813890.0
KAFR0A028408.843ON52048913750.0
TBLA0C01160singletonON60052011221e-147
YOR378Wna 1ON5154968491e-107
Smik_15.560na 1ON5164608411e-105
Suva_8.435na 1ON5154968301e-104
KLTH0C10560gna 1ON5155148291e-104
Skud_15.545na 1ON5164828291e-104
Kwal_23.6547na 1ON5114417764e-96
KLLA0B00352gna 1ON4984357607e-94
TDEL0G04950singletonON5125097251e-88
KNAG0D00130na 1ON5655485432e-61
KAFR0C04860na 1ON5344074852e-53
SAKL0C06116gsingletonON1851773857e-43
NDAI0K02730singletonON6044814031e-41
NCAS0A05720na 1ON5635413993e-41
CAGL0L02519gna 1ON5294253815e-39
SAKL0F00440gsingletonON5444181912e-14
Smik_6.24na 2ON5444641912e-14
Skud_6.16na 2ON5494631742e-12
Suva_10.11singletonON5404621464e-09
KLLA0C18931gna 3ON5532311384e-08
AGR076C8.272ON6862941351e-07
ZYRO0C01430g8.272ON5902561214e-06
Kwal_34.15746na 3ON5184641181e-05
KLLA0E24113g8.570ON5752641171e-05
Smik_6.22singletonON6361331143e-05
Kpol_416.5singletonON6072201134e-05
Skud_6.14singletonON6361331118e-05
Smik_21.4singletonON6051541119e-05
TDEL0F039908.272ON6312541091e-04
Kpol_543.448.272ON6432661091e-04
Suva_26.1singletonON534671063e-04
Kwal_14.722singletonON611821054e-04
KLTH0H16214gsingletonON5514591054e-04
Suva_10.9singletonON6371541038e-04
KLTH0C10142gsingletonON5732381010.001
ZYRO0G07414gsingletonON707981000.002
TBLA0C01040singletonON669741000.002
TDEL0C045802.241ON557250990.002
TBLA0F030408.272ON9062741000.002
NDAI0D010202.242ON592170990.002
KLTH0G13464g8.272ON593400990.002
Smik_11.368singletonON580416980.003
KAFR0I01560singletonON63290970.004
KLTH0B00110gsingletonON62781970.004
SAKL0A08228gsingletonON569143970.004
NDAI0A02050singletonON617253970.004
TBLA0F00470singletonON732103950.006
Kwal_56.237548.272ON589408950.007
YOL158C (ENB1)singletonON606159950.007
Kpol_358.4na 4ON617134940.009
CAGL0E04092gna 5ON64590940.009
KLTH0D16962gsingletonON571143930.010
KLTH0G09504gna 6ON624134930.011
ZYRO0G03234g2.473ON562271930.011
Smik_11.370singletonON440100920.012
Smik_5.22na 4ON628134930.013
TPHA0G031502.473ON600133930.013
NCAS0A078102.473ON568249910.019
TPHA0K02330singletonON63161910.020
Skud_5.24na 4ON627134910.020
Suva_5.2na 4ON627134910.021
SAKL0A00726gsingletonON598315910.022
Smik_2.434na 7ON474269900.023
KLTH0D00506gsingletonON61689900.023
TDEL0D06610singletonON497403900.024
NDAI0D016805.284ON516128900.024
Kpol_416.6singletonON597145900.025
KLLA0A10439gsingletonON63473900.027
Smik_8.1na 5ON627101890.034
YHR048W (YHK8)5.284ON514260890.034
Suva_4.553na 7ON562270890.037
YKR106W (GEX2)singletonON61560890.037
YKR105C (VBA5)singletonON582347880.038
YCL073C (GEX1)singletonON61560880.039
KAFR0J009302.242ON566163880.043
KLLA0C19272gsingletonON623100880.043
SAKL0D04510gna 8ON53194880.043
KNAG0I019102.242ON598144880.045
Kwal_14.1585na 9ON570252880.046
KLLA0A04631g8.272ON579281870.051
YHL040C (ARN1)na 5ON627101870.052
Kwal_23.5241na 10ON59175870.053
NCAS0D02350na 4ON634172870.054
Skud_18.6singletonON61098870.059
SAKL0E08756g2.242ON565234870.061
Skud_2.423na 7ON560181860.074
KLLA0D19945gsingletonON644118860.078
TPHA0A017508.272ON63671860.087
KNAG0J02980singletonON636148860.087
NDAI0H00140na 5ON63290850.096
SAKL0F00792gsingletonON61760850.10
ZYRO0G21890gsingletonON57685840.12
NCAS0C03460na 11ON630130840.13
SAKL0F00110gsingletonON62083840.13
KLTH0D18150gsingletonON60775840.13
Kpol_467.242.473ON370319830.14
Skud_16.503singletonON543247830.16
Kwal_56.22298singletonON61060830.19
SAKL0E00132gsingletonON620199830.19
KLLA0E14609gsingletonON63963820.20
YBR293W (VBA2)na 7ON474181820.21
TPHA0M00120singletonON619133820.22
TBLA0G025502.242ON613251820.23
SAKL0C05588gsingletonON677322820.24
ZYRO0A00330gsingletonON576272810.27
KLTH0D00110gsingletonON62084810.29
KLTH0B10450gsingletonON62084810.29
YPR198W (SGE1)singletonON543244810.33
SAKL0C12122gna 10ON611131800.35
Skud_8.3na 5ON63190800.37
SAKL0C02178gsingletonON565168800.40
KLLA0F03311g2.242ON542227790.52
Suva_8.12na 5ON633101790.53
KLTH0B10142gsingletonON568317780.64
TDEL0G04740singletonON601130780.64
TDEL0H01600singletonON60456780.73
KNAG0K01020singletonON599253780.77
KLLA0C00220gsingletonON62460770.82
SAKL0E04246gna 12ON565173770.84
TDEL0B019008.446ON68783770.88
TPHA0F012902.242ON562133770.90
Skud_18.3singletonON590418770.90
YIL120W (QDR1)2.242ON563261761.1
Suva_15.2365.284ON514260761.2
ABL210CsingletonON47880761.3
NCAS0I00110na 5ON45258751.4
TDEL0G03260singletonON612130751.4
Kwal_34.15711na 5ON61884751.5
KLLA0F13684g2.473ON571270751.6
Kpol_513.33singletonON626126751.6
SAKL0G03300gsingletonON61686751.7
TDEL0H00130singletonON621156741.9
TDEL0A03210singletonON58476742.1
Kwal_26.7984na 13ON612160742.2
SAKL0H16808g8.272ON657422742.2
Kwal_23.48242.242ON553224732.4
NDAI0I02650na 4ON638135732.5
TDEL0C00120singletonON569301732.5
NCAS0G029902.242ON581282732.8
SAKL0D11000g1.451ON657196733.0
CAGL0J00363g5.284ON498128723.1
KLTH0A07964gsingletonON619124733.1
SAKL0H09328g8.570ON596243723.4
KLTH0G09372g2.242ON551244723.4
YAL067C (SEO1)singletonON593114723.8
KLTH0C10120gsingletonON651127723.9
YCL069W (VBA3)singletonON458147714.0
SAKL0C11066gsingletonON58053714.3
NDAI0B037702.242ON571169714.6
NCAS0A024504.238ON192860714.9
Kwal_23.4853na 6ON60359714.9
YNL065W (AQR1)2.242ON586286715.1
Smik_14.2622.242ON561268715.3
ZYRO0F02178gsingletonON595114705.9
Smik_1.1singletonON594114706.2
TBLA0B044808.570ON608291706.4
TPHA0B00180singletonON633238706.5
SAKL0A02310g6.302ON38961697.1
CAGL0B02079gna 11ON624134707.1
KLLA0F06292g6.302ON38761697.2
Suva_13.208.858ON58458697.7
Skud_14.2672.242ON562274697.9
TPHA0G03780singletonON61264698.1
KAFR0D00930singletonON61497698.2
KLTH0E13222g8.570ON566289698.2
Skud_13.188.858ON58558689.8
YHL047C (ARN2)singletonON620100689.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00260
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...  1071   0.0  
NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {O...   698   0.0  
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...   696   0.0  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...   670   0.0  
NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843      663   0.0  
NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843      658   0.0  
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...   653   0.0  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}               649   0.0  
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...   647   0.0  
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...   645   0.0  
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...   640   0.0  
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843      635   0.0  
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...   630   0.0  
YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON} ...   628   0.0  
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...   625   0.0  
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...   624   0.0  
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...   612   0.0  
CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa] ...   613   0.0  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...   609   0.0  
Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W (...   609   0.0  
KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} simila...   594   0.0  
CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {...   587   0.0  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...   586   0.0  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...   580   0.0  
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...   575   0.0  
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...   557   0.0  
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...   539   0.0  
KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {O...   534   0.0  
TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {O...   436   e-147
YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative...   331   e-107
Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378...   328   e-105
Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W ...   324   e-104
KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} simila...   323   e-104
Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378...   323   e-104
Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR37...   303   4e-96
KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly s...   297   7e-94
TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {O...   283   1e-88
KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}  ...   213   2e-61
KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W     191   2e-53
SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {O...   152   7e-43
NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {...   159   1e-41
NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON}            158   3e-41
CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa] ...   151   5e-39
SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON...    78   2e-14
Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)    78   2e-14
Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)    72   2e-12
Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W (...    61   4e-09
KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON} unip...    58   4e-08
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    57   1e-07
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    51   4e-06
Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W ...    50   1e-05
KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]...    50   1e-05
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...    49   3e-05
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...    48   4e-05
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...    47   8e-05
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)     47   9e-05
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    47   1e-04
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    47   1e-04
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)        45   3e-04
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...    45   4e-04
KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]...    45   4e-04
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...    44   8e-04
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    44   0.001
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...    43   0.002
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}               43   0.002
TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.2...    43   0.002
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    43   0.002
NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {O...    43   0.002
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    43   0.002
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    42   0.003
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C      42   0.004
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...    42   0.004
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    42   0.004
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...    42   0.004
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}               41   0.006
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    41   0.007
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...    41   0.007
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...    41   0.009
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...    41   0.009
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    40   0.010
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...    40   0.011
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    40   0.011
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...    40   0.012
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)    40   0.013
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    40   0.013
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    40   0.019
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}              40   0.020
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)    40   0.020
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)       40   0.021
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    40   0.022
Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W ...    39   0.023
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...    39   0.023
TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa] ...    39   0.024
NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {O...    39   0.024
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...    39   0.025
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...    39   0.027
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...    39   0.034
YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presum...    39   0.034
Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W ...    39   0.037
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...    39   0.037
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    39   0.038
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...    39   0.039
KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2....    39   0.043
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...    39   0.043
SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {...    39   0.043
KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {O...    39   0.045
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    39   0.046
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    38   0.051
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...    38   0.052
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...    38   0.053
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}               38   0.054
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...    38   0.059
SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {...    38   0.061
Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W ...    38   0.074
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...    38   0.078
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    38   0.087
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}              38   0.087
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}       37   0.096
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...    37   0.10 
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    37   0.12 
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    37   0.13 
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...    37   0.13 
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...    37   0.13 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    37   0.14 
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    37   0.16 
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...    37   0.19 
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...    37   0.19 
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...    36   0.20 
YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permea...    36   0.21 
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}                36   0.22 
TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {O...    36   0.23 
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    36   0.24 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    36   0.27 
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...    36   0.29 
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...    36   0.29 
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    36   0.33 
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...    35   0.35 
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...    35   0.37 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    35   0.40 
KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} simila...    35   0.52 
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...    35   0.53 
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    35   0.64 
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...    35   0.64 
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...    35   0.73 
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    35   0.77 
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...    34   0.82 
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    34   0.84 
TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {O...    34   0.88 
TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {O...    34   0.90 
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    34   0.90 
YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multid...    34   1.1  
Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048...    34   1.2  
ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON} Non-s...    34   1.3  
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}         33   1.4  
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               33   1.4  
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...    33   1.5  
KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]...    33   1.6  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...    33   1.6  
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...    33   1.7  
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}       33   1.9  
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}               33   2.1  
Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {O...    33   2.2  
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    33   2.2  
Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W...    33   2.4  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}               33   2.5  
TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON}         33   2.5  
NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {O...    33   2.8  
SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} simila...    33   3.0  
CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly ...    32   3.1  
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...    33   3.1  
SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} simila...    32   3.4  
KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} simila...    32   3.4  
YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}  SEO1...    32   3.8  
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    32   3.9  
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    32   4.0  
SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa] ...    32   4.3  
NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {O...    32   4.6  
NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {...    32   4.9  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...    32   4.9  
YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasm...    32   5.1  
Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065...    32   5.3  
ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} simila...    32   5.9  
Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL0...    32   6.2  
TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON} Anc_8...    32   6.4  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}       32   6.5  
SAKL0A02310g Chr1 complement(215994..217163) [1170 bp, 389 aa] {...    31   7.1  
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    32   7.1  
KLLA0F06292g Chr6 complement(613470..614633) [1164 bp, 387 aa] {...    31   7.2  
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    31   7.7  
Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065...    31   7.9  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...    31   8.1  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...    31   8.2  
KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]...    31   8.2  
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    31   9.8  
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...    31   9.9  

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 1071 bits (2769), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/550 (95%), Positives = 526/550 (95%)

Query: 1   MELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDT 60
           MELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDT
Sbjct: 1   MELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDT 60

Query: 61  PWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASF 120
           PWQNPTYFANRWQEYAFISTCM             TAPMNILADAFNSSAKKQTWLMASF
Sbjct: 61  PWQNPTYFANRWQEYAFISTCMLAQLLNQAGQAQATAPMNILADAFNSSAKKQTWLMASF 120

Query: 121 PLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLG 180
           PLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLG
Sbjct: 121 PLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLG 180

Query: 181 IAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIF 240
           IAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIF
Sbjct: 181 IAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIF 240

Query: 241 YAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNK 300
           YAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNK
Sbjct: 241 YAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNK 300

Query: 301 GYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFY 360
           GYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFY
Sbjct: 301 GYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFY 360

Query: 361 YYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIM 420
           YYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIM
Sbjct: 361 YYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIM 420

Query: 421 LSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYST 480
           LSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYST
Sbjct: 421 LSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYST 480

Query: 481 SLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLWIGXXXXXX 540
           SLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLWIG      
Sbjct: 481 SLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLWIGRKKRLE 540

Query: 541 XXXXXTTATC 550
                TTATC
Sbjct: 541 KRKEKTTATC 550

>NCAS0A02540 Chr1 complement(481807..483426) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/498 (65%), Positives = 398/498 (79%)

Query: 36  EEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXX 95
           E+K     E E    S     D+D+PWQNP YF+++++EY FI TCM             
Sbjct: 24  EDKNISHNEKEVYSNSTDSVLDDDSPWQNPNYFSSKYKEYFFIFTCMVANLLNQAGQTQV 83

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
            + MN+++++F+S + KQTWLMASFPLVSGSFIL+SGRIGDIYGLKKT+IGGY+ ++IWS
Sbjct: 84  LSTMNVISESFHSDSGKQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIWS 143

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP 215
           L+CGFA++THND FFI+CRAFQGLGI+FILPNVMGLIGNIYK  TLRKN VIS +G+ AP
Sbjct: 144 LLCGFADFTHNDTFFIVCRAFQGLGISFILPNVMGLIGNIYKVGTLRKNIVISMIGLTAP 203

Query: 216 IGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTG 275
            GA +G +W GLI  EN KQWPWIFYAYA+   +N++MA+YS+P+ +PTN+H F MDW G
Sbjct: 204 TGACMGALWGGLIVTENAKQWPWIFYAYALTGLVNLIMALYSVPNCIPTNVHNFAMDWIG 263

Query: 276 SAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVI 335
           S IGVVG+ILFNFVWNQGP+ GW+K YII LLI+SV  L+AF +YE+K+  SPLLP EV 
Sbjct: 264 SIIGVVGLILFNFVWNQGPVAGWDKAYIIVLLIISVLFLVAFVVYELKYPISPLLPVEVT 323

Query: 336 KNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVA 395
           KN  I  IL  +F+GWG+FGIWTFYY+AFQLNLR YS VW GGT+FMF+IWGTIAA +VA
Sbjct: 324 KNGQILTILSILFLGWGAFGIWTFYYFAFQLNLRDYSPVWVGGTYFMFIIWGTIAALIVA 383

Query: 396 LTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSII 455
            TIK+VGP++LL FS  GFT+G +MLSVTP+HQ YW+MNLGMQIIL FGMDLSFPASSII
Sbjct: 384 FTIKKVGPAILLFFSALGFTMGSLMLSVTPIHQMYWRMNLGMQIILCFGMDLSFPASSII 443

Query: 456 LSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGL 515
           LSD LP QYQGMAGSLVNT++NY+TSLCLG+G+T E Q+NK+G D LKGYR+ALY+ +GL
Sbjct: 444 LSDHLPMQYQGMAGSLVNTVINYATSLCLGMGTTVERQINKSGEDLLKGYRSALYLAVGL 503

Query: 516 GACGMLVAFCYLFEVLWI 533
           G  G  +AF  L   LW+
Sbjct: 504 GGLGSCIAFINLCYTLWM 521

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score =  696 bits (1795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/502 (68%), Positives = 403/502 (80%)

Query: 30  NDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXX 89
           +  T+V EK +  +  E       +F+DN+TPWQNP+YF++RW+EY FI TCM       
Sbjct: 37  DSSTSVSEKTSAISVFEGTSPDAEKFSDNNTPWQNPSYFSSRWKEYLFILTCMLSNLLNQ 96

Query: 90  XXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYL 149
                 T+ MN++  AFN+ +  +TWLMASFPLVSGSFILVSGRIGDIYGLK+T+IGG +
Sbjct: 97  AGQTQATSTMNVIGSAFNADSSSKTWLMASFPLVSGSFILVSGRIGDIYGLKRTMIGGLI 156

Query: 150 VVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISF 209
           V++IWSLICGFANY+ +  FFI+CRAFQGLGIAF+LPNVMGL+GNIYK  +LRKN VIS 
Sbjct: 157 VMIIWSLICGFANYSSSVTFFIICRAFQGLGIAFVLPNVMGLVGNIYKVGSLRKNIVISC 216

Query: 210 VGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF 269
           +GMCAP GAA G  W+GLIA +  KQWPWIFYAYA    +N+V+AIYSIP TVP N+HGF
Sbjct: 217 IGMCAPTGAAFGAFWAGLIATKAEKQWPWIFYAYAFAGILNLVLAIYSIPDTVPVNVHGF 276

Query: 270 GMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPL 329
            MDWTGS +GV+G+ILFNFVWN+ PI GW K YII LLI S+ +++ FFIYEIKFAKSPL
Sbjct: 277 SMDWTGSVVGVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLIIVVFFIYEIKFAKSPL 336

Query: 330 LPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTI 389
           LP  V  N +I MIL A+FMGWGSFGIWTFYYYAF LNLR Y+ + AG +  MF++WGTI
Sbjct: 337 LPQAVTHNHNIIMILSAMFMGWGSFGIWTFYYYAFLLNLRGYTPLEAGASHCMFILWGTI 396

Query: 390 AAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSF 449
           AAF VA TIKRVGPSVLL  SM  FTVG IMLS+TPVHQ+YWKM  GMQIIL+FGMDLSF
Sbjct: 397 AAFTVAFTIKRVGPSVLLFCSMVAFTVGSIMLSITPVHQTYWKMTFGMQIILAFGMDLSF 456

Query: 450 PASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAAL 509
           PASSIILSD LP +YQGMAGSLVNT+VNYSTSLCLG+G+TAE QVNKNGTD LKGYRAAL
Sbjct: 457 PASSIILSDALPMEYQGMAGSLVNTIVNYSTSLCLGMGTTAEIQVNKNGTDLLKGYRAAL 516

Query: 510 YVGIGLGACGMLVAFCYLFEVL 531
           YVGIGLG  G+++A  +LFE L
Sbjct: 517 YVGIGLGVVGVIIAALFLFESL 538

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/525 (60%), Positives = 404/525 (76%), Gaps = 3/525 (0%)

Query: 8   SECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTY 67
            E     ++D   I++ +   ++      E ++ +T + +   ++S    ND+PWQ+PTY
Sbjct: 6   EEKVNVQSKDSPVIDKISMKAEDKVVVSSEDEDVTTVASS---NKSTQVSNDSPWQDPTY 62

Query: 68  FANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSF 127
           F++  +E  FI TCM                MN+L+ +FNS + KQ WLMASFPLV+GSF
Sbjct: 63  FSSFGRELMFIVTCMLAQLLNQAGQTHALTIMNVLSKSFNSESDKQAWLMASFPLVAGSF 122

Query: 128 ILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPN 187
           IL+SGR+GDIYGLKK L+ GY+ +++WSLICG + Y++NDAFFI CRAFQGLGIAFILPN
Sbjct: 123 ILISGRLGDIYGLKKMLMIGYVTIIVWSLICGLSKYSNNDAFFITCRAFQGLGIAFILPN 182

Query: 188 VMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVV 247
           VMGL+G++YK  + RKN VISF+G CAP G   GG++ GLI +E+ +QWPW+FYA+AI  
Sbjct: 183 VMGLVGHVYKVGSTRKNLVISFIGACAPAGGMFGGLFGGLIVNEDSEQWPWVFYAFAIAF 242

Query: 248 AINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALL 307
            +NM++A YSIP+ +PTN+HGF MDWTGS + V+G+ILFNFVWNQ P  GW   YIIALL
Sbjct: 243 FLNMILAWYSIPNNIPTNVHGFSMDWTGSVLAVIGLILFNFVWNQAPTAGWGTAYIIALL 302

Query: 308 IVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLN 367
           I+SVF L+AFF+YE+K+AK PLLP  V KNRH+ MILLAVF+GWGSFGIWTFYY +FQLN
Sbjct: 303 IISVFFLVAFFVYEVKYAKVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYMSFQLN 362

Query: 368 LRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVH 427
           LRHYS VW GGT+F+FVI+GTIAAF+VAL+IKRVGP+ LLCF++  F VG IM SV PV 
Sbjct: 363 LRHYSPVWTGGTYFVFVIFGTIAAFMVALSIKRVGPAFLLCFALVAFDVGSIMFSVLPVK 422

Query: 428 QSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVG 487
           QS+WK+N GMQ IL FGMDLSFPASSIILSD LP +YQGMAGSLVNT++NYS SLCLG+G
Sbjct: 423 QSFWKLNFGMQAILCFGMDLSFPASSIILSDGLPMEYQGMAGSLVNTVINYSASLCLGMG 482

Query: 488 STAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           +T E Q+NKNG D LKGYR A+Y+G+GL + G+L++F Y+ E  W
Sbjct: 483 ATVEHQINKNGKDLLKGYRGAIYLGVGLASLGVLISFTYMLETFW 527

>NCAS0C00400 Chr3 (61257..62810) [1554 bp, 517 aa] {ON} Anc_8.843
          Length = 517

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/498 (64%), Positives = 393/498 (78%)

Query: 35  VEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXX 94
           +E K+   + S+ +  S     +N TPWQN  YF +  +EY FI TCM            
Sbjct: 1   MENKEPIVSSSQKKTLSCDSLLENSTPWQNEQYFQSHLKEYFFIFTCMFANLLNQAGQTQ 60

Query: 95  XTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIW 154
             + MN+++++F+S    QTWLMASFPLVSGSFIL+SGRIGDIYGLKKT+IGGY+ ++IW
Sbjct: 61  VLSTMNVISESFHSDVGTQTWLMASFPLVSGSFILISGRIGDIYGLKKTMIGGYIFMIIW 120

Query: 155 SLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA 214
           +L+CGFA+YTH+D FFI+CRAFQGLGI+FILPN+MGL+GNIYK  TLRKN VIS +G+ A
Sbjct: 121 TLLCGFADYTHSDTFFIVCRAFQGLGISFILPNIMGLVGNIYKVGTLRKNIVISLIGITA 180

Query: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWT 274
           P GA +G +W GLIA E+ +QWPWIFYAYA+   +N++MAIYS+P  VPTN+H F MDW 
Sbjct: 181 PTGACMGALWGGLIATESSRQWPWIFYAYALAAFVNLIMAIYSVPENVPTNVHNFAMDWM 240

Query: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEV 334
           G+ IGVVG+ILFNFVWNQGP++GW K YII LLI+S+  L+AF IYE+KF  SPLLP EV
Sbjct: 241 GAIIGVVGLILFNFVWNQGPVNGWAKPYIIVLLIISIIFLVAFIIYELKFPISPLLPREV 300

Query: 335 IKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLV 394
            KN  I  IL  +F+GWGSFGIWTFYYYAFQLNLR+YS +WAG T FMF+IWG+IAAF+V
Sbjct: 301 TKNGQILTILGILFLGWGSFGIWTFYYYAFQLNLRNYSPLWAGATHFMFIIWGSIAAFIV 360

Query: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454
             TI RVGP+VLL FS  GFT+G +MLSVTP+HQ+YW+MN+GMQIILSFGMDLSFPASSI
Sbjct: 361 GFTINRVGPAVLLFFSALGFTMGSLMLSVTPIHQTYWRMNVGMQIILSFGMDLSFPASSI 420

Query: 455 ILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIG 514
           ILSD LP QYQGMAGSLVNT++NYSTSLCLG+G+T E Q+NK G + L+GYR+ALY+ +G
Sbjct: 421 ILSDHLPMQYQGMAGSLVNTIINYSTSLCLGMGTTVERQINKTGEELLRGYRSALYLAVG 480

Query: 515 LGACGMLVAFCYLFEVLW 532
           LG  G  VAF  L   LW
Sbjct: 481 LGGLGACVAFLNLCYDLW 498

>NDAI0E00280 Chr5 (37676..39325) [1650 bp, 549 aa] {ON} Anc_8.843
          Length = 549

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/522 (61%), Positives = 398/522 (76%), Gaps = 9/522 (1%)

Query: 20  TINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDND---------TPWQNPTYFAN 70
            + +E E T++  + +EE+ +  T+ E    SE E   ++         + WQNP YF N
Sbjct: 12  NVEEEKEITQSTSSIIEEECSSITKEENNEVSEDELPSSEQEDNTIGDHSKWQNPDYFQN 71

Query: 71  RWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
           +WQEY FI +CM              + MNI+ D+F S   K+TWL+ASFPLVSGSFIL+
Sbjct: 72  KWQEYLFIFSCMMSQLLNQAATPQTLSIMNIITDSFKSEGGKETWLIASFPLVSGSFILI 131

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190
           SGRIGDIYGLKKTLIGGYL  +IWSLI GF +Y+HND FFI+ RAFQGLGIAFILPNVMG
Sbjct: 132 SGRIGDIYGLKKTLIGGYLFFIIWSLISGFTDYSHNDIFFIISRAFQGLGIAFILPNVMG 191

Query: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAIN 250
           ++GNIYK +T RKN VIS +G  APIGA +G +++GLI  ENPKQWPW FYA+AI  AIN
Sbjct: 192 IVGNIYKPDTQRKNIVISMIGASAPIGAFMGSLFAGLIGTENPKQWPWAFYAFAIASAIN 251

Query: 251 MVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS 310
           + ++IYSIP+ +PTNIHGF MDW GS + V+G+IL NFVWNQGPI GW K YII LLI+S
Sbjct: 252 LAISIYSIPNNIPTNIHGFAMDWIGSIMAVIGLILLNFVWNQGPIVGWQKAYIIVLLIIS 311

Query: 311 VFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRH 370
           +  L+ FF YEIK+AKSP+LP EV KNRHI MIL A+F+GWGSFGI++FYY++F LNLRH
Sbjct: 312 IIALVLFFTYEIKYAKSPILPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRH 371

Query: 371 YSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSY 430
           YSA+WAG T+FMF IWGT+AA +V   IKR+  SV+L FSM  F +G IMLSVTPV Q+Y
Sbjct: 372 YSALWAGTTYFMFAIWGTVAAVIVGAFIKRISASVILFFSMIAFNIGLIMLSVTPVDQTY 431

Query: 431 WKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTA 490
           ++MNLG  IILSFGMD+SFPA++IILSD L  QYQGMAGSL NTMVNYS SLCLG+G+T 
Sbjct: 432 FRMNLGTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTV 491

Query: 491 EAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           E Q+NK+G + LKGYRAA Y+G+GL   G++++  Y+ EVLW
Sbjct: 492 ERQINKSGKEILKGYRAAEYLGVGLAGLGIVISGIYMAEVLW 533

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/499 (61%), Positives = 384/499 (76%)

Query: 35  VEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXX 94
           VE   +    S  E  +    TD +  WQ+ TYF NRWQEY F+ TCM            
Sbjct: 29  VENTDSDKLGSGNETSTHVATTDPNCKWQDTTYFQNRWQEYIFVGTCMMSQLLNQACIPQ 88

Query: 95  XTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIW 154
             + MNIL  +F+S+AK QTWLMASFPLVSGSFIL+SGR+GDIYGLK +L+GG +  +IW
Sbjct: 89  TLSLMNILTKSFHSNAKNQTWLMASFPLVSGSFILISGRVGDIYGLKWSLVGGNIFFIIW 148

Query: 155 SLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA 214
           +LI GF NYTH+D FFI+ R+FQGLG+AFILPNVMG +GNIYK NT RKN VIS +G CA
Sbjct: 149 ALISGFTNYTHSDTFFIVSRSFQGLGVAFILPNVMGCVGNIYKPNTFRKNIVISLIGACA 208

Query: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWT 274
           P+GA +G  ++GLI  +NP  WPW FYA AI   + ++ A+YSIP+ +PTN+HGF MDW 
Sbjct: 209 PVGAFMGAFFAGLIGTKNPDDWPWSFYAMAIASTLTLLGALYSIPNHIPTNVHGFSMDWI 268

Query: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEV 334
           GS + VVG+IL NFVWNQGPIDGW K YII LLIVSVF+L  FFIYE+ +A SPLLP  +
Sbjct: 269 GSGLAVVGLILLNFVWNQGPIDGWGKAYIIVLLIVSVFVLTLFFIYEVHYAASPLLPRVI 328

Query: 335 IKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLV 394
            +NRH+ MIL+A+F+GWGSFGI++FYY+AF LNLRHYS VWAGGT+FMF IWG +A+ +V
Sbjct: 329 TQNRHMVMILMALFLGWGSFGIFSFYYFAFLLNLRHYSTVWAGGTYFMFAIWGVVASVVV 388

Query: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454
            L+I+++  S++L FSM  F VG IMLSVTPV Q+Y++MNLG  IILSFGMD+SFPA++I
Sbjct: 389 GLSIRKISASIILFFSMIAFDVGIIMLSVTPVKQTYFRMNLGTMIILSFGMDMSFPAAAI 448

Query: 455 ILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIG 514
           ILSD LP+QYQGMAGSL NTMVNYS SLCLG+GST E+Q+N+NG D LKGYRAA Y+GIG
Sbjct: 449 ILSDSLPNQYQGMAGSLANTMVNYSMSLCLGMGSTVESQINQNGKDLLKGYRAAEYLGIG 508

Query: 515 LGACGMLVAFCYLFEVLWI 533
           + +  ++++  Y+ E LWI
Sbjct: 509 IASLAVILSLIYMCERLWI 527

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/529 (60%), Positives = 400/529 (75%), Gaps = 10/529 (1%)

Query: 13  TITRDHITINQEAEYTKNDQT---NVEEKKNCSTESEAE------WCSESEFTDNDTPWQ 63
           T  ++ +++N EA   ++  T      E+K    E + E        S S   +N++ WQ
Sbjct: 6   TEIKEPVSVN-EANLLESQSTIDCTSSERKTAIKEQDDEIGSDSTTTSSSSLQENNSSWQ 64

Query: 64  NPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLV 123
           NP YF++ ++EY F++TCM              + MN+++D+F+SS   QTWLMASFPLV
Sbjct: 65  NPDYFSSSFKEYIFVATCMIANLLNQAGQSQVLSAMNVISDSFHSSTGGQTWLMASFPLV 124

Query: 124 SGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAF 183
           SGSFIL+SGR+GDIYGLK+ +IGG++ ++IWSLICGF NY H+D FFI+ RAFQGLGI+F
Sbjct: 125 SGSFILISGRLGDIYGLKRMMIGGFIFMIIWSLICGFTNYAHSDTFFIVARAFQGLGISF 184

Query: 184 ILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAY 243
           ILPNVMGL+GNIYK  TLRKN VIS +G+ AP G+  G +W GLI  ENPKQWPWIFYAY
Sbjct: 185 ILPNVMGLVGNIYKVGTLRKNVVISLIGIMAPTGSCFGALWGGLIVTENPKQWPWIFYAY 244

Query: 244 AIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYI 303
           A+  A+ +VM  Y++P  +PTN++GF MDW GS +GV+G+ILFNFVWNQGPI GW K YI
Sbjct: 245 AVAAAVCLVMGYYTVPDNIPTNVNGFTMDWIGSVLGVIGLILFNFVWNQGPIVGWEKAYI 304

Query: 304 IALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYA 363
           I LLIVSV  LIAFF+YEIK+AK PLLP  V +N HI  IL  +F+GWGSFGIWTFYY+A
Sbjct: 305 IVLLIVSVIFLIAFFVYEIKYAKVPLLPKAVTQNGHILTILTVLFLGWGSFGIWTFYYFA 364

Query: 364 FQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSV 423
           FQLNLR YS VW+GGTFF+F+I+GT+AA  VALTIK+VGP++LL FS  GFT G I++SV
Sbjct: 365 FQLNLREYSPVWSGGTFFVFIIFGTVAATTVALTIKKVGPAILLFFSAIGFTCGSIIMSV 424

Query: 424 TPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLC 483
           TPVHQ+YW+   GMQIIL FGMDL FPASSIILSD+LP QYQGMA SLVNT+VNYSTSLC
Sbjct: 425 TPVHQTYWRNTFGMQIILVFGMDLPFPASSIILSDYLPMQYQGMAVSLVNTIVNYSTSLC 484

Query: 484 LGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           LG+G+T E Q+NK+G D LKGYRAALY G+G+   G  +AF  +   +W
Sbjct: 485 LGMGTTVERQINKSGDDLLKGYRAALYFGVGIAGLGACIAFLNVCHDIW 533

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score =  647 bits (1668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/524 (58%), Positives = 397/524 (75%), Gaps = 9/524 (1%)

Query: 9   ECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYF 68
           + T +   D I++ +E      D+  V   +  +T + +   S+S    ND+PWQ+PTYF
Sbjct: 12  QGTSSPVNDKISMKEE------DKVIVSTDEEVTTVASS---SKSNQISNDSPWQDPTYF 62

Query: 69  ANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFI 128
           ++  +E  FI TCM                MN+L+ +F S +  Q WLMASFPL +GSFI
Sbjct: 63  SSFGKELMFIGTCMLAQLLNQAGQTHALCIMNVLSKSFGSESNNQAWLMASFPLAAGSFI 122

Query: 129 LVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNV 188
           L+SGR+GDIYGLKK L+ GY+++++WS+I G + Y++ND+FFI CRAFQG+GIAFILPN+
Sbjct: 123 LISGRLGDIYGLKKMLMIGYVIIIVWSIISGLSKYSNNDSFFITCRAFQGVGIAFILPNI 182

Query: 189 MGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVA 248
           MGL+G++YK  +LRKN VIS +G C P GA  GGV+ GLI  E+P QWPW+FYA+ I   
Sbjct: 183 MGLVGHVYKVGSLRKNLVISVIGACGPTGALFGGVFGGLIVTEDPNQWPWVFYAFGIATF 242

Query: 249 INMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLI 308
           I+M+MA YSIP+ VPTN+HG  MDWTGS + V+G+ILFNFVWN+ PI GW+K YII LL+
Sbjct: 243 ISMLMAWYSIPNNVPTNVHGLSMDWTGSVLAVIGLILFNFVWNEAPIAGWDKAYIIVLLV 302

Query: 309 VSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNL 368
           VSVF L+AFF+YEIK+A+ PLLP  V KNRH+ MILLAVF+GWGSFGIWTFYY +FQLNL
Sbjct: 303 VSVFFLVAFFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFVGWGSFGIWTFYYVSFQLNL 362

Query: 369 RHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQ 428
           RHYS VW GGT+F+F I+GTIAAF VA +IKR+GP++LLCF++  F  G IM SV PV Q
Sbjct: 363 RHYSPVWTGGTYFVFAIFGTIAAFFVAFSIKRLGPALLLCFALMAFDAGSIMFSVLPVEQ 422

Query: 429 SYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGS 488
           SYWK+N  MQ +L FGMDLSFPASSIILSD LP QYQGMAGSLVNT++NYS SLCLG+G+
Sbjct: 423 SYWKLNFAMQAVLCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGA 482

Query: 489 TAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           T E Q+NK+G + L+GYRAA+Y+GIGL + G+L++  Y+ E +W
Sbjct: 483 TVEHQINKSGKNVLEGYRAAVYLGIGLASLGVLISVTYMLETVW 526

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/528 (58%), Positives = 381/528 (72%), Gaps = 5/528 (0%)

Query: 6   SESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNP 65
            + E  K    D  T    A+ + +  ++  +K   S   +     +     N++ WQ+P
Sbjct: 10  KQQEEEKNPIEDFQTTTVTAQTSLDVLSDSVKKDQISITDD-----DVSSISNNSKWQDP 64

Query: 66  TYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSG 125
           TYF + WQEY FI TCM              + MN+LAD+ NS    +TWLMASF L SG
Sbjct: 65  TYFKSSWQEYTFIGTCMLANLLNQAGQTQTLSTMNVLADSLNSDGAAKTWLMASFTLASG 124

Query: 126 SFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFIL 185
           SFILVSGRIGDIYGLK T IGG ++  IWS++CG + YT N  FFI+CRAFQGLG+AF+L
Sbjct: 125 SFILVSGRIGDIYGLKATFIGGNIIFCIWSILCGVSKYTENVTFFIICRAFQGLGVAFVL 184

Query: 186 PNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAI 245
           PNVMGL+GNIY   ++RKN VISF+G  AP+G   GG+W GLI   N  QWPWIF+A AI
Sbjct: 185 PNVMGLVGNIYNVGSMRKNIVISFIGCMAPVGQTFGGMWGGLIVDSNKDQWPWIFFATAI 244

Query: 246 VVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIA 305
            V IN++M IYSIP+ VPTNI+   MDW GS +GV+G+IL NFVWNQ PI GW+K YII 
Sbjct: 245 AVFINLIMGIYSIPNHVPTNIYNLKMDWIGSLLGVIGLILMNFVWNQAPISGWSKAYIIV 304

Query: 306 LLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQ 365
           +LIV+VF L+AFFIYE+K A+SPLLPPEV KNRHI  I++++F+GWG+FGIWTFYYYAF 
Sbjct: 305 ILIVAVFFLVAFFIYELKKAESPLLPPEVTKNRHIVTIIISLFLGWGAFGIWTFYYYAFN 364

Query: 366 LNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTP 425
           LNLRH+S +WAG T F+F+I+G++ A  VA TI +VGPSVL C S  GFT G I+ SVT 
Sbjct: 365 LNLRHFSPLWAGSTHFVFIIFGSLTAITVAFTINKVGPSVLFCLSSIGFTCGNIIFSVTS 424

Query: 426 VHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLG 485
             Q+YW+ +LGMQIIL+ GMDLSFP SSIILSD LP QYQGM+GSLVNT+ NY+TSLCLG
Sbjct: 425 PDQTYWRNSLGMQIILALGMDLSFPGSSIILSDLLPMQYQGMSGSLVNTITNYATSLCLG 484

Query: 486 VGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLWI 533
           +G+TAE Q N  G D LKGYRAALYV IGLGA G   +F Y+ E LWI
Sbjct: 485 MGTTAEVQYNNGGKDVLKGYRAALYVAIGLGALGFAFSFSYMAEDLWI 532

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/516 (61%), Positives = 396/516 (76%), Gaps = 6/516 (1%)

Query: 23  QEAEYTKNDQT--NVEEKKNCSTESE----AEWCSESEFTDNDTPWQNPTYFANRWQEYA 76
           Q  +Y  +D+T   V++K   STE E        +ES    ND+PWQ+P YF++  +E  
Sbjct: 12  QGTDYQIHDKTIMKVDDKVVISTEDEEVTTVTSSNESNQVTNDSPWQDPIYFSSFGKELM 71

Query: 77  FISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGD 136
           FI+TCM                MN+L+ +FNS +  Q WLMASFPL +GSFIL+SGR+GD
Sbjct: 72  FIATCMLAQLLNQAGQTHALCIMNVLSKSFNSESNNQAWLMASFPLAAGSFILISGRLGD 131

Query: 137 IYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIY 196
           IYGLKK L+ GY++++IWS+I G + Y+++DAFFI CRAFQGLGIAFILPN+MGL+G++Y
Sbjct: 132 IYGLKKMLLIGYVIIIIWSIISGLSKYSNSDAFFITCRAFQGLGIAFILPNIMGLVGHVY 191

Query: 197 KANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIY 256
           K  +LRKN VIS +G CAP G   GGV+ GLI  E+P+QWPW+FYA++I   I+++MA Y
Sbjct: 192 KVGSLRKNLVISVIGACAPAGGMFGGVFGGLIVTEDPEQWPWVFYAFSIATFISLLMAWY 251

Query: 257 SIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIA 316
           SIP+ VPTN+HG  MDWTGS + V+G+ILFNFVWNQ PI GW + YII LLI+SVF LIA
Sbjct: 252 SIPNNVPTNVHGLSMDWTGSTLAVLGLILFNFVWNQAPIAGWGEAYIIVLLILSVFFLIA 311

Query: 317 FFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWA 376
           FF+YEIK+A+ PLLP  V KNRH+ MILLAVF+GWGSFGIWTFYY +FQLNLRHYS VW 
Sbjct: 312 FFVYEIKYAEVPLLPHAVTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWT 371

Query: 377 GGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLG 436
           GGT+F+FVI+G+IAAF VA +IKR+GP++LLCF++  F  G IM SV PV QSYWK+N  
Sbjct: 372 GGTYFVFVIFGSIAAFFVAFSIKRLGPAILLCFALMAFDAGSIMFSVLPVEQSYWKLNFA 431

Query: 437 MQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNK 496
           MQ IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT++NYS SLCLG+G T E Q+NK
Sbjct: 432 MQAILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGVTVERQINK 491

Query: 497 NGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           +G + LKGYRAA+Y+GIGL + G+L++  Y+ E  W
Sbjct: 492 SGQNLLKGYRAAIYLGIGLASLGLLISVTYMLENFW 527

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/517 (58%), Positives = 386/517 (74%), Gaps = 6/517 (1%)

Query: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP------WQNPTYFANRWQEY 75
           ++  E  ++  +++ E+ +     + E   +   +  +TP      WQNP YF N+WQEY
Sbjct: 10  HRSEEIMESAASSITEETSIIKHGDIEEIEKDVISQTETPQLEHSKWQNPDYFQNQWQEY 69

Query: 76  AFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIG 135
            FI +CM              + MNI+ D+FNS   K+TWL+ASFPLVSGSFIL+SGRIG
Sbjct: 70  LFIFSCMMSQLLNQAATPQTLSIMNIITDSFNSEGGKETWLIASFPLVSGSFILISGRIG 129

Query: 136 DIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNI 195
           DIYGLKKTL+GGY+  +IWS+I G   Y+H+D FFI+ RAFQGL IAFILPNVMG++GNI
Sbjct: 130 DIYGLKKTLVGGYIFFIIWSIISGLTKYSHSDTFFIVSRAFQGLSIAFILPNVMGIVGNI 189

Query: 196 YKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAI 255
           YK ++ RKN VIS +G  APIGA  G +++GLI  E+P QWPW FYA+AI  A N+ ++I
Sbjct: 190 YKPDSNRKNIVISMIGASAPIGAFFGSLFAGLIGTEDPDQWPWAFYAFAIASAFNLAISI 249

Query: 256 YSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           YSIP++VPTN+HGF MDW GS + V+G+IL NFVWNQGPI GW   YIIALL+VSVF L 
Sbjct: 250 YSIPNSVPTNVHGFAMDWIGSVLAVIGLILLNFVWNQGPIVGWQTAYIIALLVVSVFFLA 309

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVW 375
            FF YE+K+A+SPLLP EV KNRHI MIL A+F+GWGSFGI++FYY++F LNLRHYSA+W
Sbjct: 310 LFFTYEVKYAESPLLPVEVTKNRHIIMILAALFLGWGSFGIFSFYYFSFLLNLRHYSALW 369

Query: 376 AGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNL 435
           AG T+FMF IWGT+AA +V   IK++  + +L  SM  F +G IMLSVTPV Q+Y++MNL
Sbjct: 370 AGTTYFMFAIWGTVAAVIVGAFIKKISAAFILFMSMVAFNIGIIMLSVTPVDQTYFRMNL 429

Query: 436 GMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVN 495
           G  IILSFGMD+SFPA++IILSD L  QYQGMAGSL NTMVNYS SLCLG+G+T E Q+N
Sbjct: 430 GTMIILSFGMDMSFPAAAIILSDGLTMQYQGMAGSLANTMVNYSMSLCLGMGTTVERQIN 489

Query: 496 KNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           K+G D LKGYR A Y+GIGL   G+++   YL E+LW
Sbjct: 490 KSGNDLLKGYRGAEYLGIGLAGLGIIITAIYLGEILW 526

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score =  630 bits (1626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/513 (60%), Positives = 380/513 (74%), Gaps = 7/513 (1%)

Query: 24  EAEYTKNDQTNVEEKKNCSTESEAEWC-------SESEFTDNDTPWQNPTYFANRWQEYA 76
           E++    ++T +  KK+    +  E         SE E  D++  WQNP YF   WQEY 
Sbjct: 11  ESKGEYENETELPVKKSSRDNNIGESLTATAFTQSEDEMVDSNQKWQNPNYFKYAWQEYL 70

Query: 77  FISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGD 136
           FI TCM              + MNIL+D+F S    ++WLMASFPLVSGSFIL+SGR+GD
Sbjct: 71  FIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILISGRLGD 130

Query: 137 IYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIY 196
           IYGLKK L+ GY++V+IWSLICG   Y+ +D FFI+ RAFQGLGIAF+LPNV+G+IGNIY
Sbjct: 131 IYGLKKMLLVGYVLVIIWSLICGITKYSGSDTFFIISRAFQGLGIAFVLPNVLGIIGNIY 190

Query: 197 KANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIY 256
              T RKN VISFVG  APIGA LG +++GLI  E+PKQWPW FYAY+I   IN V++IY
Sbjct: 191 VGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTEDPKQWPWAFYAYSIAAFINFVLSIY 250

Query: 257 SIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIA 316
           +IPST+PTNIH F MDW GS +GV+G+IL NFVWNQ PI GWN+ YII +LI+SV  L+ 
Sbjct: 251 AIPSTIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWNQAYIIVILIISVIFLVV 310

Query: 317 FFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWA 376
           F IYEI+FAK+PLLP  VIK+RH+  I+LA+F GWGSFGI+TFYY+ FQLN+R Y+A+WA
Sbjct: 311 FIIYEIRFAKTPLLPRAVIKDRHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRQYTALWA 370

Query: 377 GGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLG 436
           GGT+FMF+IWG IAA LV  TIK V PSV L FSM  F VG IM SVTPVH++Y++  LG
Sbjct: 371 GGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFNVGSIMASVTPVHETYFRTQLG 430

Query: 437 MQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNK 496
             IILSFGMDLSFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG+G+T E QVN 
Sbjct: 431 TMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVETQVNS 490

Query: 497 NGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
           +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 491 DGKHLLKGYRGAQYLGIGLASLACMISGLYMVE 523

>YMR279C Chr13 complement(824729..826351) [1623 bp, 540 aa] {ON}
           Putative boron transporter involved in boron efflux and
           resistance; overexpression mutant but not null mutant
           displays boron tolerance phenotype; identified as a
           heat-induced gene in a high-throughout screen; YMR279C
           is not an essential gene; paralog of the efflux pump
           ATR1
          Length = 540

 Score =  628 bits (1620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/513 (59%), Positives = 391/513 (76%), Gaps = 4/513 (0%)

Query: 24  EAEYTKNDQTNVEEKKNCSTESEAEW----CSESEFTDNDTPWQNPTYFANRWQEYAFIS 79
           ++E  +      ++K   STE E        ++S    ND+PWQ+PTYF++  +E  FI+
Sbjct: 15  DSEIDEKITVKAKDKVVVSTEDEEVTTIVSSTKSTQVTNDSPWQDPTYFSSFGKELMFIA 74

Query: 80  TCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYG 139
           TCM                MN+L+ +FNS A  Q WLMASFPL +GSFIL+SGR+GDIYG
Sbjct: 75  TCMLAQLLNQAGQTHALCIMNVLSKSFNSEANNQAWLMASFPLAAGSFILISGRLGDIYG 134

Query: 140 LKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKAN 199
           LKK LI GY++V++WS+I G + Y+++DAFFI  RAFQG+GIAFILPN+MGL+G++YK  
Sbjct: 135 LKKMLIVGYVIVIVWSIISGLSKYSNSDAFFITSRAFQGVGIAFILPNIMGLVGHVYKVG 194

Query: 200 TLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIP 259
           + RKN VISF+G CAP G   GG++ GLI  E+P QWPW+FYA+ I   ++++MA YSIP
Sbjct: 195 SFRKNIVISFIGACAPTGGMFGGLFGGLIVTEDPNQWPWVFYAFGIATFLSLLMAWYSIP 254

Query: 260 STVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFI 319
           + VPTNIHG  MDWTGSA+ ++G+ILFNFVWNQ PI GW+K YII LLI+SV  L+AFF+
Sbjct: 255 NNVPTNIHGLSMDWTGSALAIIGLILFNFVWNQAPIVGWDKPYIIVLLIISVIFLVAFFV 314

Query: 320 YEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGT 379
           YE K+A+ PLLP  + KNRH+ MILLAVF+GWGSFGIWTFYY +FQLNLRHYS VW GGT
Sbjct: 315 YESKYAEVPLLPRAMTKNRHMIMILLAVFLGWGSFGIWTFYYVSFQLNLRHYSPVWTGGT 374

Query: 380 FFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQI 439
           +F+FVI+G++AAF VA +IKR+GP++LLCFS+  F  G IM SV PV QSYWK+N  MQ 
Sbjct: 375 YFVFVIFGSMAAFFVAFSIKRLGPALLLCFSLMAFDAGSIMFSVLPVEQSYWKLNFAMQA 434

Query: 440 ILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGT 499
           IL FGMDLSFPASSIILSD LP QYQGMAGSLVNT++NYS SLCLG+G T E Q+NK+G 
Sbjct: 435 ILCFGMDLSFPASSIILSDGLPMQYQGMAGSLVNTVINYSASLCLGMGGTVEHQINKSGN 494

Query: 500 DKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           D LKGYRAA+Y+G+GL + G++++  Y+ E LW
Sbjct: 495 DLLKGYRAAVYLGVGLASLGVVISVTYMLENLW 527

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/514 (57%), Positives = 373/514 (72%), Gaps = 1/514 (0%)

Query: 16  RDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEY 75
            D++ I  E      D +    K+   T +     SE E       WQNP YF   WQEY
Sbjct: 22  EDYLEIENEVALEAEDSSPRNNKEGALT-TIVLTNSEDEVMKTKQKWQNPNYFKYPWQEY 80

Query: 76  AFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIG 135
            FI TCM              + MNILAD+F S A  ++WLMASFPLVSGSFIL+SGR+G
Sbjct: 81  LFIFTCMISQLLNQSGTTQTLSIMNILADSFGSDANSRSWLMASFPLVSGSFILISGRMG 140

Query: 136 DIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNI 195
           DI+GLK  L+ GY++++IWSLICG   Y+ +D FFI+ RAFQGLGIAF+LPNV+G+IGN+
Sbjct: 141 DIFGLKNMLLIGYVMIIIWSLICGLTKYSGSDTFFIVSRAFQGLGIAFVLPNVLGIIGNV 200

Query: 196 YKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAI 255
           Y   T RKN VISF+G  APIGA LG  ++GLI   NP QWPW FYAY I   IN++++I
Sbjct: 201 YVGGTFRKNIVISFIGAMAPIGATLGCFFAGLIGTMNPNQWPWAFYAYTITAVINLILSI 260

Query: 256 YSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           Y+IP+ +PTN+H F MDW GS +GV+G++L N VWNQ PI GWN+ YII LLI+SV  L+
Sbjct: 261 YAIPNNIPTNVHRFSMDWIGSGLGVIGLVLLNLVWNQAPISGWNQAYIIVLLIISVLFLV 320

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVW 375
            F +YEI FAKSPLLP  V+K+RH+  I+L++F GWGSFGI+TFYY+ FQLN+RHY+ +W
Sbjct: 321 LFGVYEIHFAKSPLLPQAVMKDRHMIQIMLSLFFGWGSFGIFTFYYFQFQLNIRHYTPLW 380

Query: 376 AGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNL 435
           AGG++FMF+IWG IAA LV  +IKRV PSV L F+M  F VG IM SVTPVH++Y++M +
Sbjct: 381 AGGSYFMFLIWGIIAALLVGFSIKRVSPSVFLFFAMVAFNVGSIMASVTPVHETYFRMQM 440

Query: 436 GMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVN 495
           G  IILSFGMDLSFPASSII SD+LP +YQGMAGSLVNT+VNYS SLCLG+G+T E Q++
Sbjct: 441 GTMIILSFGMDLSFPASSIIFSDYLPMEYQGMAGSLVNTVVNYSMSLCLGMGATVEMQLD 500

Query: 496 KNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
            +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 501 PDGKHILKGYRGAQYLGIGLASLACIISGLYMVE 534

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/524 (57%), Positives = 375/524 (71%), Gaps = 1/524 (0%)

Query: 6   SESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNP 65
           +E    K+      +   E E     + +     N  T + +    E E T +   WQNP
Sbjct: 2   NEKSLVKSAESRQDSFEAENESVSAVKKSSRHDGNEETVTISTDHGE-EMTVDKQRWQNP 60

Query: 66  TYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSG 125
            YF N W EY FI TCM              + MNI+A++F S+   +TWLMASFPLVSG
Sbjct: 61  NYFKNSWHEYLFIFTCMISQLLNQAGTTQTLSIMNIIANSFGSNENSRTWLMASFPLVSG 120

Query: 126 SFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFIL 185
           SFIL+SGR+GDIYGLKK L  GY+V++IWSLICG   Y+ +D FFI+ RAFQGLGIAF+L
Sbjct: 121 SFILISGRLGDIYGLKKMLTIGYVVIIIWSLICGLTKYSGSDTFFIISRAFQGLGIAFVL 180

Query: 186 PNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAI 245
           PNV+G+IGNIY + T RKN VIS VG  AP+GA LG +++GLI  +NPKQWPW FYAY I
Sbjct: 181 PNVLGIIGNIYVSGTFRKNIVISLVGAMAPVGATLGCLFAGLIGTKNPKQWPWAFYAYTI 240

Query: 246 VVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIA 305
              IN+ +++YSIP+ +PTNI  F MDW GSA+GV+G++L NFVWNQ PI GW++ YII 
Sbjct: 241 TSIINLALSVYSIPNNIPTNIQHFSMDWIGSALGVIGLVLMNFVWNQAPISGWDQAYIIV 300

Query: 306 LLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQ 365
           LL++SV  L+ F IYE +FAKSPLLP  V+K+RH+  I+LA+F GWGSFGI+TFYY+ FQ
Sbjct: 301 LLVISVVFLVVFIIYENRFAKSPLLPRAVLKDRHMIQIMLALFFGWGSFGIFTFYYFQFQ 360

Query: 366 LNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTP 425
           LN+RHYSAVWAGGT+FMF+IWG IAA LV + IK+V PSV L  SM  F +G IM SVTP
Sbjct: 361 LNIRHYSAVWAGGTYFMFLIWGIIAALLVGIYIKKVSPSVFLFLSMMAFNIGSIMASVTP 420

Query: 426 VHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLG 485
           VH++Y++  LG  IILSFGMD SFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG
Sbjct: 421 VHETYFRTQLGTMIILSFGMDFSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLG 480

Query: 486 VGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
           +G+T E  V+ +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 481 MGATVETHVDPDGKHVLKGYRGAQYLGIGLASLACIISGLYMVE 524

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/504 (59%), Positives = 370/504 (73%), Gaps = 1/504 (0%)

Query: 29  KNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXX 88
           +ND     EK   S+ +  E   ++E     +  QNP YF   W+EY F+ + M      
Sbjct: 5   ENDDEENWEKLQSSSAAGEERDGQTEAIGPKSRLQNPDYFDKPWKEYIFVLSSMLSQLLN 64

Query: 89  XXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGY 148
                      ++L+   N+   +Q WLMASFPLVSGSFILVSG++GDIYGLKKTL+GGY
Sbjct: 65  QAATTQTNPLFDVLSKDLNAKVSQQPWLMASFPLVSGSFILVSGKVGDIYGLKKTLLGGY 124

Query: 149 LVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVIS 208
           +VV+IWSLICG ++Y HN  FF++ R+FQGLGIAF+LPNVMG++GNIYK NT  KN V S
Sbjct: 125 VVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGIVGNIYKPNTEAKNLVFS 184

Query: 209 FVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHG 268
            +G CAPIGA LG V+SGLI       W W FYAYAI  A+N ++A++ IP+ +PTN++ 
Sbjct: 185 LIGACAPIGATLGCVFSGLIGART-DLWGWTFYAYAITAALNGLVALWIIPNNIPTNVNE 243

Query: 269 FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSP 328
           + MDW GSAIGV G+ILFNFVWNQ PI GW   YII LLIV+V  LIAF  YEI+FAK P
Sbjct: 244 YKMDWIGSAIGVFGLILFNFVWNQAPIAGWGSAYIIVLLIVAVVALIAFITYEIRFAKQP 303

Query: 329 LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGT 388
           LLP  V+ NR + MIL ++F GWGSFGIWTFYY +F LNLRHYS +WAGGT+FMF IWG 
Sbjct: 304 LLPHSVLFNRKLMMILSSLFFGWGSFGIWTFYYMSFMLNLRHYSPLWAGGTYFMFAIWGI 363

Query: 389 IAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLS 448
           +A+ LV  TI + GP+V+L  SM  F  GCIML+VTPVHQ+Y++M LG+ IILSFGMDLS
Sbjct: 364 VASLLVGYTIHKTGPAVILFLSMVAFDCGCIMLAVTPVHQTYFRMTLGIMIILSFGMDLS 423

Query: 449 FPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAA 508
           FPA+SIILSD LPSQYQGMAGSLV+TM++YS SLCLG+  TAE QVNKNG D LKGY+AA
Sbjct: 424 FPAASIILSDQLPSQYQGMAGSLVSTMISYSMSLCLGISGTAEHQVNKNGIDLLKGYQAA 483

Query: 509 LYVGIGLGACGMLVAFCYLFEVLW 532
           LYVGIGL + G++++  ++ E  W
Sbjct: 484 LYVGIGLASLGVVISGAFMIEDWW 507

>CAGL0M03003g Chr13 complement(337942..339618) [1677 bp, 558 aa]
           {ON} similar to uniprot|Q03263 Saccharomyces cerevisiae
           YMR279c or uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1
          Length = 558

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/526 (61%), Positives = 402/526 (76%), Gaps = 6/526 (1%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP 61
           E ++ +   TK+I  D     +E   +   Q+N ++    S  S+   CS  +  +ND+P
Sbjct: 19  EKTNYDGVVTKSIAFDGC---EECSSSDECQSNSDQ---LSVTSKGCICSVDDCHENDSP 72

Query: 62  WQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFP 121
           +QNP YF   ++E  FI +CM              + MN+LAD F S++ KQ WLMASFP
Sbjct: 73  FQNPEYFETGFKEVMFIISCMVAQLLNQAGQTQSLSTMNVLADYFKSNSSKQPWLMASFP 132

Query: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181
           LVSGSFIL+SGR+GDIYGLKK L  GY+++ +WS+ICG A YT++DAFFI+CR+FQGLGI
Sbjct: 133 LVSGSFILISGRLGDIYGLKKALSVGYIIMTLWSIICGLAKYTNSDAFFIVCRSFQGLGI 192

Query: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241
           AFILPN+MGL+GNIYK  TLRKN VIS +G  AP GAALG ++ GLI  E+ +QWPW+FY
Sbjct: 193 AFILPNIMGLVGNIYKVGTLRKNIVISCIGCMAPAGAALGALFGGLIVTEDAEQWPWVFY 252

Query: 242 AYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKG 301
           A+ I   +NM++A+YSIP+ VPTN++   MDW GS +GV G++L N VWNQ PI GW + 
Sbjct: 253 AFGIASFVNMLLALYSIPNNVPTNLNNLNMDWIGSLLGVSGLLLLNIVWNQAPIVGWGEA 312

Query: 302 YIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYY 361
           YII LLI+S+ LL+ F +YEIK+A SPLLPP V++N+ I MIL A+F GWGSFGIWT+YY
Sbjct: 313 YIIVLLIISIILLLIFVVYEIKYATSPLLPPSVLENKKILMILAALFFGWGSFGIWTYYY 372

Query: 362 YAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIML 421
           YAFQLNLR Y+ +WAGGT FMFVIWGT+AAF+VALTIK+VGP+VLLCFSM  F  G IML
Sbjct: 373 YAFQLNLRKYTPLWAGGTHFMFVIWGTVAAFVVALTIKKVGPAVLLCFSMVAFDCGSIML 432

Query: 422 SVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTS 481
           SVTPVHQ+YW+MN+GMQIILSFGMDLSFPASSIILSDFLP QYQGMAGSLVNT+VNYSTS
Sbjct: 433 SVTPVHQTYWRMNVGMQIILSFGMDLSFPASSIILSDFLPMQYQGMAGSLVNTVVNYSTS 492

Query: 482 LCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYL 527
           LCLG+G+T E Q N +G D LKGYR+ALY+ IGL + G+ V+  +L
Sbjct: 493 LCLGMGNTVEQQYNAHGADLLKGYRSALYLAIGLASAGVCVSLVFL 538

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/506 (58%), Positives = 374/506 (73%), Gaps = 4/506 (0%)

Query: 27  YTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPW---QNPTYFANRWQEYAFISTCMX 83
           + +++++   + K   T+S   +   S+   +D  W   Q+PTYF+  W+EY FI   M 
Sbjct: 3   FKRSNESVSSQSKELGTQSATAFTEHSDVQVDDKKWPSIQDPTYFSAPWKEYLFIFASMM 62

Query: 84  XXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKT 143
                        + +NIL+  F+SS  +QTWLMASFPLVSGSFILVSG+IGDIYGLKKT
Sbjct: 63  SQLLNQAGTTQTLSLINILSKNFDSSTSQQTWLMASFPLVSGSFILVSGKIGDIYGLKKT 122

Query: 144 LIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRK 203
           L+ GY+V +IWSLICG  +YT +  FFI+ RAFQGLGIAFILPN+MG++GNIY A T RK
Sbjct: 123 LLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGIVGNIYVAGTTRK 182

Query: 204 NFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVP 263
           N VIS +G CAPIGA +G ++SGLI   + ++W W FYAY I  AINM ++I+ IP+T+P
Sbjct: 183 NMVISLIGACAPIGATMGVLFSGLIGTLS-ERWAWTFYAYTITAAINMGLSIWVIPNTIP 241

Query: 264 TNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIK 323
           TN+ G  MDW GS IG++GMILFNFVWNQGPI GW+  YII LLIVSV  ++AFF+YE K
Sbjct: 242 TNVRGSSMDWIGSGIGLLGMILFNFVWNQGPIVGWDTAYIIVLLIVSVAAIVAFFLYETK 301

Query: 324 FAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMF 383
           +A  PL+P   + N  + M LLAVF GWGSFGIWTFYY+ F LNLR Y+ +WAGG++FMF
Sbjct: 302 YANDPLIPRPAMHNHRLLMTLLAVFFGWGSFGIWTFYYFCFVLNLREYTPLWAGGSYFMF 361

Query: 384 VIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSF 443
           +IWG IAA  V  TIKR+ PS++L  SM  F  GCIMLSVTPV Q+Y++M LGM IILSF
Sbjct: 362 LIWGIIAAISVGYTIKRIPPSLILFLSMLAFDCGCIMLSVTPVDQTYFRMILGMMIILSF 421

Query: 444 GMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLK 503
           GMDLSFPASSIILSD LP + QGMAGSLV+TM+NYS S+CLG+  T E Q+NKNG D LK
Sbjct: 422 GMDLSFPASSIILSDELPMENQGMAGSLVSTMINYSMSMCLGIAGTVEHQINKNGDDLLK 481

Query: 504 GYRAALYVGIGLGACGMLVAFCYLFE 529
           GYRAALY+GIGL + G+ ++  ++ E
Sbjct: 482 GYRAALYLGIGLASLGVFISALFMLE 507

>Smik_13.18 Chr13 (34422..36059) [1638 bp, 545 aa] {ON} YML116W
           (REAL)
          Length = 545

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/519 (58%), Positives = 377/519 (72%), Gaps = 13/519 (2%)

Query: 24  EAEYTKNDQTNVEEK-----KNCSTESEAEWCS--------ESEFTDNDTPWQNPTYFAN 70
           E+E   +D   VE +     K  S ++ +E           E E  + +  WQNP YF  
Sbjct: 8   ESEEKNDDCMEVENEAVFPPKKSSRDNGSEETLRGTAFTNLEDEMVECNQKWQNPKYFKY 67

Query: 71  RWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
            WQEY FI TCM              + MNIL+D+F S    ++WLMASFPLVSGSFIL+
Sbjct: 68  AWQEYLFIFTCMISQLLNQAGTTQTLSIMNILSDSFGSEGNSKSWLMASFPLVSGSFILI 127

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190
           SGR+GDIYGLKK L+ GY++V+IWSLICG  NY+ +D FFI+CRAFQGLGIAF+LPNV+G
Sbjct: 128 SGRLGDIYGLKKMLLVGYVLVIIWSLICGITNYSGSDTFFIICRAFQGLGIAFVLPNVLG 187

Query: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAIN 250
           +IGNIY   T RKN VISFVG  APIGA LG +++GLI  ENP QWPW FYA++I   IN
Sbjct: 188 IIGNIYVGGTFRKNIVISFVGAMAPIGATLGCLFAGLIGTENPNQWPWAFYAFSIASLIN 247

Query: 251 MVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS 310
             ++IY+IP+ +PTNIH F MDW GS +GV+G+IL NFVWNQ PI GW++ YII +LI+S
Sbjct: 248 FGLSIYAIPNNIPTNIHHFSMDWIGSVLGVIGLILLNFVWNQAPISGWSQAYIIVILIIS 307

Query: 311 VFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRH 370
           V  L  F IYE+ FAKSPLLP  VIK+ H+  I+LA+F GWGSFGI+TFYY+ FQLN+RH
Sbjct: 308 VIFLAVFIIYEMWFAKSPLLPHAVIKDYHMIQIMLALFFGWGSFGIFTFYYFQFQLNIRH 367

Query: 371 YSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSY 430
           Y+A+WAGGT+FMF+IWG IAA LV  TIK V PSV L FSM  F VG IM SVTPVH++Y
Sbjct: 368 YTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVYLFFSMVAFNVGSIMASVTPVHETY 427

Query: 431 WKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTA 490
           ++  LG  IILSFGMDLSFPASSII SD LP +YQGMAGSLVNT+VNYS SLCLG+G+T 
Sbjct: 428 FRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGSLVNTVVNYSMSLCLGMGATV 487

Query: 491 EAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
           E Q++ +G   LKGYR A Y+GIGL +   +++  Y+ E
Sbjct: 488 ETQLDPDGKHLLKGYRGAQYLGIGLASLACMISGLYMVE 526

>KLTH0C03806g Chr3 (332195..333772) [1578 bp, 525 aa] {ON} similar
           to uniprot|P13090 Saccharomyces cerevisiae YML116W ATR1
           Multidrug efflux pump of the major facilitator
           superfamily required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 525

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/507 (58%), Positives = 372/507 (73%), Gaps = 5/507 (0%)

Query: 30  NDQTNVEEKKNCSTESEAEWCSESEFTD----NDTPWQNPTYFANRWQEYAFISTCMXXX 85
           N +     K+   ++   +     E +D    + +  QNP YF  +W+EY F+ + M   
Sbjct: 2   NSEYTPVSKQRTGSDISRKVVDNHEDSDMLLASRSRLQNPDYFDKQWKEYLFVISSMLSQ 61

Query: 86  XXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLI 145
                         ++L++   + A +Q WLMASFPLVSGSFILVSG++GDIYGLKKTL+
Sbjct: 62  LLNQAAALQANPLFDLLSEDLKAKASQQAWLMASFPLVSGSFILVSGKVGDIYGLKKTLL 121

Query: 146 GGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNF 205
           GGY VV+IWSLICG ++Y HN  FFI+ R+FQGLGIAF+LPNV G++GNIYK NT  KN 
Sbjct: 122 GGYAVVVIWSLICGLSSYAHNVDFFIVARSFQGLGIAFVLPNVTGIVGNIYKPNTKAKNM 181

Query: 206 VISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTN 265
           V S +G CAPIGA LG ++SGLI  E+ + W W FYAY IV A+N ++A Y IP  +PTN
Sbjct: 182 VFSMIGACAPIGATLGCLFSGLIGTES-EAWAWTFYAYTIVAALNGLIAWYVIPDNIPTN 240

Query: 266 IHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFA 325
           +H F MDW GS +GV G+I+FNFVWNQ P DGW+  YII LL++SV LL+ F I+E +FA
Sbjct: 241 VHKFKMDWLGSFLGVCGLIMFNFVWNQAPTDGWDSAYIIVLLVISVILLLIFIIFEARFA 300

Query: 326 KSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVI 385
           K PLLP  V+ NR + MIL ++F+GWGSFGIWT+YY AF LNLRHY+ +WAGG++FMF I
Sbjct: 301 KEPLLPRAVLFNRKLMMILASLFLGWGSFGIWTYYYMAFVLNLRHYTPLWAGGSYFMFAI 360

Query: 386 WGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGM 445
           +GTIAAFLV  TI + GP+++L  S+  F VGCIMLSVTPV Q+Y++M+LG  +ILSFGM
Sbjct: 361 FGTIAAFLVGHTIHKTGPAIILLASVIAFDVGCIMLSVTPVDQTYFRMSLGTMVILSFGM 420

Query: 446 DLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGY 505
           DLSFPASSIILSD LPSQYQGMAGSLVNTM+NYS SLCLGV  TAE QVNK+GTD LKGY
Sbjct: 421 DLSFPASSIILSDQLPSQYQGMAGSLVNTMINYSMSLCLGVSGTAERQVNKDGTDLLKGY 480

Query: 506 RAALYVGIGLGACGMLVAFCYLFEVLW 532
           RAALYVGIGL + G+ V+  Y  E  W
Sbjct: 481 RAALYVGIGLASVGIFVSGAYAIEDWW 507

>CAGL0B02343g Chr2 complement(222130..223743) [1614 bp, 537 aa] {ON}
           similar to uniprot|P13090 Saccharomyces cerevisiae
           YML116w ATR1 Aminotriazole resistance protein or
           uniprot|Q03263 Saccharomyces cerevisiae YMR279c
          Length = 537

 Score =  587 bits (1512), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/514 (55%), Positives = 374/514 (72%), Gaps = 11/514 (2%)

Query: 11  TKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFAN 70
           T ++ ++ ++ +      K D  ++ ++K C T++           D +  WQNP YF +
Sbjct: 9   TDSVQQETLSSSSSGSSFKQDNNDIVDEKQCDTQA----------IDGNQKWQNPEYFDS 58

Query: 71  RWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
             +EY F+ +C                 MNI+AD+ +S   KQ WLMA+FPL+SGSFIL+
Sbjct: 59  TLKEYLFLCSCFVSQLLNQAGAIQTQPIMNIVADSLDSQNGKQAWLMAAFPLISGSFILI 118

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190
           SGRIGDIYGLKKTL+ GYL +++WSLICG   Y H+D+FFI+ RAFQGLGI+ ILPN++G
Sbjct: 119 SGRIGDIYGLKKTLLVGYLFLIVWSLICGLTKYAHSDSFFIVSRAFQGLGISLILPNILG 178

Query: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAIN 250
           ++G+IY A + RKN VIS +G  APIGA LG V+SGLI  E+  QWPW FY+YAI  AIN
Sbjct: 179 IVGSIYIAGSKRKNMVISLIGCMAPIGATLGAVFSGLIGTEDANQWPWAFYSYAITAAIN 238

Query: 251 MVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS 310
            V++I+ IP+T+PTN+HG  MDW GS +GVVG+I+ NFVWNQ PIDGW+  Y+I LLI+S
Sbjct: 239 FVLSIWLIPNTIPTNVHGHKMDWIGSGLGVVGLIMLNFVWNQAPIDGWDSAYLIVLLIIS 298

Query: 311 VFLLIAFFIYEIKFAK-SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLR 369
           V LLIAFFIYE+ F   +PLLP EV+K+    ++L A+F GWGSFGI++FYY+ FQLNLR
Sbjct: 299 VLLLIAFFIYELHFVNGNPLLPKEVLKSPKTIIVLFALFFGWGSFGIFSFYYFTFQLNLR 358

Query: 370 HYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQS 429
           HY+ +WAGGT+FMF+IWG +AA +V  TIK+V PS++L  SM  F  G I++SVTP+HQ+
Sbjct: 359 HYTPLWAGGTYFMFLIWGIVAALVVGFTIKKVYPSIILFLSMVAFNCGSIIMSVTPIHQT 418

Query: 430 YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGST 489
           Y++ +LGM IILSFGMDLSFPASSI+LSD LP QYQGMAGSLVNTMVNYS S CLGV   
Sbjct: 419 YFRNHLGMMIILSFGMDLSFPASSILLSDKLPLQYQGMAGSLVNTMVNYSMSFCLGVAGV 478

Query: 490 AEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVA 523
            E  VN +G D LKGYR A Y+GIGL +   +++
Sbjct: 479 VEQHVNNHGKDVLKGYRGAFYLGIGLASMACIIS 512

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/512 (54%), Positives = 368/512 (71%), Gaps = 4/512 (0%)

Query: 18  HITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAF 77
            +T  + +   + ++    E K  +TE EA    E    + ++PWQ+P YF  +W E  F
Sbjct: 11  QVTALKSSHENEIERNLSREDKMLTTEKEAPVFVE----EPESPWQDPNYFKGKWDEVLF 66

Query: 78  ISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDI 137
           + +CM              + M +L    +SS+ K +WLMASFPLVSGSFIL+SGR+GDI
Sbjct: 67  VLSCMMGQLLNQAGSTMTLSTMKVLERELDSSSAKSSWLMASFPLVSGSFILISGRLGDI 126

Query: 138 YGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYK 197
           YGLKK L+ GY+ + IWSLICG ++++HND FFI  RAFQGLGI+F+LPN++G++GNIYK
Sbjct: 127 YGLKKMLLLGYIWLTIWSLICGLSSFSHNDTFFITSRAFQGLGISFVLPNLLGIVGNIYK 186

Query: 198 ANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYS 257
             T RKN VIS +GMCAPIGA  GG+++G++       WPW FYAY I   +  +++ + 
Sbjct: 187 PGTRRKNIVISLIGMCAPIGATFGGLFAGVVVIRKDSDWPWAFYAYTIAAFLTTIISYFV 246

Query: 258 IPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAF 317
           IP+++P N++ F MDW GSA+GV G++LFNFVWNQ  + GW  GYIIALLIVS+FL+  F
Sbjct: 247 IPNSIPVNVNKFAMDWIGSALGVSGLVLFNFVWNQSTVVGWATGYIIALLIVSIFLIALF 306

Query: 318 FIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAG 377
           FI+EIK+AK PLLP EV ++R I MIL ++  GWGSFGIW FYY+ F L LR+YS VWAG
Sbjct: 307 FIFEIKYAKVPLLPKEVTESRSIIMILASLMAGWGSFGIWIFYYFQFVLTLRNYSPVWAG 366

Query: 378 GTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGM 437
           GTFFM  I G IAA  V  +IKRVGP+VLL FSM  FT G I+LSVTPVH++Y++  LG 
Sbjct: 367 GTFFMVSIVGCIAALTVGFSIKRVGPAVLLFFSMIAFTCGSIILSVTPVHETYFRSCLGA 426

Query: 438 QIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKN 497
            +ILSFGMDLSFPA+SIILSD L  QYQGMAGSLVNT+VNYS SL LG+G T E Q+NK+
Sbjct: 427 MVILSFGMDLSFPAASIILSDELSMQYQGMAGSLVNTVVNYSMSLFLGIGGTIERQINKS 486

Query: 498 GTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
           G   L+G+RAALY  IG+G+ G+L++  ++ +
Sbjct: 487 GDRLLEGFRAALYFAIGVGSLGILISGVFVLQ 518

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/531 (51%), Positives = 367/531 (69%), Gaps = 13/531 (2%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP 61
           E+  S+S+       D+ T+N   +   ++Q          T+SE  + +          
Sbjct: 18  EIGRSDSDS------DNSTVNSSQKIDSSEQV-------VPTDSEKYFATVRSSESLSVS 64

Query: 62  WQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFP 121
            Q P YF+++  E+AFI TC+              + MNI+A+ F S   KQ WL ASFP
Sbjct: 65  SQKPQYFSSKLHEWAFIFTCLMGQLLNQAGTTQSMSIMNIIAEDFGSETSKQAWLFASFP 124

Query: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181
           LVSGSFILV GR GDIYGLKK L+ GY ++ IWS+ICG  +YTH+D FFI+ +AFQGLG+
Sbjct: 125 LVSGSFILVGGRFGDIYGLKKMLLLGYAILTIWSIICGLTHYTHSDDFFIVAKAFQGLGV 184

Query: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241
           +FILPN++GL+G IY+  +++KN  ISF+G  AP+GA  GG++SG++  ++ K WPW FY
Sbjct: 185 SFILPNIIGLVGTIYEPGSMKKNITISFIGAMAPLGATFGGLFSGIVVVKDDKNWPWTFY 244

Query: 242 AYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKG 301
           A+AIV  +  V   + +P  VPTN +   MDW GSA+GVVG++LF+FVWNQ P+DGW+K 
Sbjct: 245 AFAIVSFLVGVTCYFFVPDNVPTNTNNLKMDWIGSAVGVVGLLLFSFVWNQAPMDGWDKA 304

Query: 302 YIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYY 361
           YII LL++SV L+IAFFIYEI +A+ PLLP  +  NRHI MILLA+FMGWG+FGIW+FYY
Sbjct: 305 YIIVLLVISVILIIAFFIYEINYAEVPLLPKAITGNRHIIMILLAIFMGWGTFGIWSFYY 364

Query: 362 YAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIML 421
           ++F LNLRH+S VW GG +F F++ G   A  V   IK + PS++L  S+TGFT+G ++ 
Sbjct: 365 FSFSLNLRHFSPVWTGGAYFAFILSGFTIASCVGFLIKIIRPSIILVISITGFTMGNLIF 424

Query: 422 SVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTS 481
           +VTP  Q+YW+   GM ++L  GMDLSFPASSIILSD LP +YQGMAGSLVNTMVNYS S
Sbjct: 425 AVTPADQTYWRNTFGMMLLLPLGMDLSFPASSIILSDQLPPEYQGMAGSLVNTMVNYSQS 484

Query: 482 LCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
            CLGV +T E Q+N +G D LKGYRAA Y G+G+G  G+ +A  Y+FE  W
Sbjct: 485 FCLGVATTVEKQINSSGDDLLKGYRAAFYTGVGIGTLGISIASLYMFETFW 535

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score =  575 bits (1482), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/510 (55%), Positives = 363/510 (71%), Gaps = 5/510 (0%)

Query: 28  TKNDQTNVEEKKNCSTESEAEWCSESEFTD-----NDTPWQNPTYFANRWQEYAFISTCM 82
           T   + N+E     + E+    CS++          ++  +NP YF +  QEYAFI +CM
Sbjct: 3   TDLKKKNIEVSSYIAEETIRSDCSDANDESPSMELKNSSLRNPDYFNSTTQEYAFIFSCM 62

Query: 83  XXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKK 142
                         + MN+L    +SS   + WL+ASFPLVSGSFILVSGR+GDIYGLKK
Sbjct: 63  LSQLLNLAGTTQTLSIMNVLTRQLHSSDSLKVWLVASFPLVSGSFILVSGRLGDIYGLKK 122

Query: 143 TLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLR 202
            LI GY++++IWSLI G + Y+H+  FFI+ RAFQGLGI+ +LPNV+GLIG IYK  TL+
Sbjct: 123 MLILGYVILVIWSLITGLSGYSHSGIFFIIARAFQGLGISLVLPNVLGLIGMIYKPGTLK 182

Query: 203 KNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTV 262
           KN VIS VG  +PIGA LGG++SGL+A E+   WPW FYAY +   IN  ++ YSIP+ +
Sbjct: 183 KNMVISIVGAMSPIGATLGGLFSGLVATESEGSWPWAFYAYTLAAFINTFISYYSIPNNI 242

Query: 263 PTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEI 322
           PTN++   MDW GS  GV+G+ILFNFVWNQ P DGWN  Y+I LL++SV  LIAF IYE+
Sbjct: 243 PTNVNRLSMDWIGSFTGVLGLILFNFVWNQAPADGWNSAYLIVLLVISVIALIAFGIYEL 302

Query: 323 KFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFM 382
           ++A++PLLP E+I+NR + MIL A+  GWGSFGIWTFYY++F LNLR+YS +WAGG++F+
Sbjct: 303 RYAENPLLPSEIIRNRQLIMILTAMTFGWGSFGIWTFYYFSFVLNLRNYSPLWAGGSYFI 362

Query: 383 FVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILS 442
           FVI GTI A      +K++ P+VLL FSM GF +GCI+ SVTPVHQ+Y++  LG  IIL 
Sbjct: 363 FVISGTITAISCGFLMKKIRPAVLLTFSMVGFNLGCIIFSVTPVHQTYFRNILGTMIILP 422

Query: 443 FGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKL 502
            GMDLSFPASSIILSD LP+Q+QGMAGSLVNT++NYS SL LG+  T E   NKNGTD L
Sbjct: 423 LGMDLSFPASSIILSDNLPNQHQGMAGSLVNTVINYSNSLFLGIAGTVEQHCNKNGTDLL 482

Query: 503 KGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           +GYR ALY GI      +L+A  Y+ E ++
Sbjct: 483 RGYRGALYFGIACSGVAVLIAGLYMVETIF 512

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/530 (49%), Positives = 364/530 (68%), Gaps = 1/530 (0%)

Query: 4   SDSESECTKTITRDHITINQEAEYTKNDQ-TNVEEKKNCSTESEAEWCSESEFTDNDTPW 62
           S  E+    TI   + T N++ +  +     N++ + + ++       +++   D  + +
Sbjct: 3   SMEENPSDNTINEINYTNNEDCKNPEQQSLKNIDSRSSLNSSLTQVLSTDTADNDESSSY 62

Query: 63  QNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPL 122
           QNP YF N++QE+ FI + M              + MN+LA   +S++ +Q WLM+SFPL
Sbjct: 63  QNPDYFKNKYQEFGFIFSGMIGQLLSQAGLTQTLSIMNVLAKELDSTSSRQAWLMSSFPL 122

Query: 123 VSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIA 182
             GSFILVSGR+GDIYGLKK L+GGY++  +WS+ICG ++Y HNDAFFI  RAFQGLG+A
Sbjct: 123 ALGSFILVSGRLGDIYGLKKILLGGYIITTVWSIICGLSSYAHNDAFFITARAFQGLGLA 182

Query: 183 FILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYA 242
           F LPN++GLIG IY+    RKN +IS +G  +P GA LGG+++GL    +   WPW FYA
Sbjct: 183 FALPNMIGLIGTIYRPGCFRKNMIISIIGAMSPTGATLGGLFAGLTVKYDKSNWPWSFYA 242

Query: 243 YAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGY 302
           + ++  +N++++ Y IP+++PTNIHG  MDW GS +GV G+I+ NFV+NQ PI GW   Y
Sbjct: 243 FGLISFVNLIISWYCIPNSIPTNIHGLKMDWLGSVLGVFGLIILNFVFNQAPIVGWQSAY 302

Query: 303 IIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYY 362
           II LL++S   L+ F +YE+K+AK+PL+P  +  NR + MIL ++F GWGSFGIWTFYY+
Sbjct: 303 IIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFSLFCGWGSFGIWTFYYF 362

Query: 363 AFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLS 422
           +F+LNLRHYS +WAG ++F+FVI G+  A +  LTIK++ PSVL C SM GF  G I+ +
Sbjct: 363 SFELNLRHYSPLWAGSSYFIFVISGSTVAIVCGLTIKKIKPSVLFCCSMMGFLGGNIIFA 422

Query: 423 VTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSL 482
            TPV+Q++++  LG   +L  GMD SFPASSIILSD LP QYQGMAGSLVNT++NYSTS+
Sbjct: 423 ATPVNQTFFRNMLGCMFLLPLGMDFSFPASSIILSDSLPMQYQGMAGSLVNTVINYSTSI 482

Query: 483 CLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
           CLG+  T E + N +G D L GYRAA+Y  IGL    + V+  Y+ E LW
Sbjct: 483 CLGMAGTVEMKHNSHGKDLLNGYRAAIYFAIGLAGLAVCVSGGYMIECLW 532

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/528 (49%), Positives = 361/528 (68%), Gaps = 4/528 (0%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSE--SEFTDND 59
           E  D ++       +D+  + +   Y+++ QTN    +   + S     S+  SE   ++
Sbjct: 26  ETLDIDATPESKERKDYFQLKKN--YSQDSQTNTSMNEVIGSISSVSNDSDINSENLQSE 83

Query: 60  TPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMAS 119
               +P YF NR  EY FI +CM              + MNILA+  N+   +Q WLMAS
Sbjct: 84  NKVLSPKYFKNRTHEYLFIISCMVSQFMSQAGLTQALSIMNILAEELNAEKSRQAWLMAS 143

Query: 120 FPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGL 179
           F L  GSFILVSGR+GDIYGLKK L+GGY ++ IWSLICGF++Y+HNDAFFI  RAFQGL
Sbjct: 144 FTLSMGSFILVSGRLGDIYGLKKVLLGGYAILTIWSLICGFSSYSHNDAFFITSRAFQGL 203

Query: 180 GIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWI 239
           G+AF+LPN +GLIG IY+  +++KN +I  +G  +PIGA LGG+++G+I  ++PKQWPW 
Sbjct: 204 GLAFVLPNSLGLIGVIYEPGSMKKNMIIGTLGAMSPIGATLGGLFAGIIGTKDPKQWPWS 263

Query: 240 FYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWN 299
           FY++ IV   NM+++ YSIP+ +PTNI+   MDW G+ +G+ G+++ NFV+NQ PI GW 
Sbjct: 264 FYSFGIVSFCNMILSWYSIPNNIPTNIYNLSMDWIGAILGIFGLLILNFVFNQAPIVGWQ 323

Query: 300 KGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTF 359
             YII LL++S   L+ F +YE+K+AK+PL+P  +  NR + MIL A+F GWG+FG WTF
Sbjct: 324 SAYIIVLLVLSFCALVIFVVYEVKYAKTPLIPKAISSNRGMLMILFALFCGWGAFGTWTF 383

Query: 360 YYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCI 419
           YY++F LN+R Y+A WAGG++F+F++ G   A L    +K+V PSV+L  SM GF  GC+
Sbjct: 384 YYFSFVLNVRGYTAAWAGGSYFIFIVSGCAIATLCGFMMKKVPPSVILYISMIGFMGGCV 443

Query: 420 MLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYS 479
           ML+VTP+HQSY++  LG+  +L  G+DLSFPA+SIILSD LP QYQGMAGSLV T+ NYS
Sbjct: 444 MLTVTPIHQSYFQNILGIMFVLPIGIDLSFPAASIILSDALPIQYQGMAGSLVYTITNYS 503

Query: 480 TSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYL 527
           TS+CLG+  + EA  N NG + LKGYR A+     L   G++V+  Y+
Sbjct: 504 TSICLGMAGSVEAYHNDNGQNILKGYRNAMIFADALAGLGIIVSGIYM 551

>KAFR0A02840 Chr1 complement(588197..589759) [1563 bp, 520 aa] {ON}
           Anc_8.843 YMR279C
          Length = 520

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/489 (54%), Positives = 356/489 (72%), Gaps = 7/489 (1%)

Query: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTC 81
           ++ +   ++ Q+++   K+ + + E             + WQ+P YF N +QEY F+ +C
Sbjct: 4   SRTSSIKEHIQSDISIDKSSNEKCEV-------IVREKSKWQDPGYFKNSFQEYLFVGSC 56

Query: 82  MXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLK 141
           M              + MN+L+D+FNSS   QTWL+ASFPLV+GSFIL+SGRIGDIYGLK
Sbjct: 57  MTTQLLNQATTPQTLSIMNVLSDSFNSSRSNQTWLVASFPLVAGSFILISGRIGDIYGLK 116

Query: 142 KTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTL 201
           KTLIGGY+ ++IWSLICGF  Y+ +D F I+ RAFQGLGIAF LPNV+G IGNIY   +L
Sbjct: 117 KTLIGGYIFLIIWSLICGFTYYSKSDTFLIIARAFQGLGIAFTLPNVVGTIGNIYHVGSL 176

Query: 202 RKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST 261
           RKN VIS +   AP+GAA+GG ++GLI  E+P QWPW FYA+AI  + N++++IYSIPS 
Sbjct: 177 RKNMVISLIAASAPVGAAIGGAFAGLIVTESPSQWPWSFYAFAIACSFNLLISIYSIPSN 236

Query: 262 VPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYE 321
           +PTN++GF MDW GSA+ V G+ILFNF WNQGPI GW+  YII LLI+SV  ++AF  YE
Sbjct: 237 IPTNVNGFKMDWIGSALIVTGLILFNFAWNQGPIVGWDIAYIIVLLIISVIFILAFLTYE 296

Query: 322 IKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFF 381
           I FA SPL+  E+  +R++ + +  +F+GWGS+GIW+FYY++F LNLRHYS VWAGG++F
Sbjct: 297 INFAPSPLIAREITHSRNMIITIFTLFLGWGSYGIWSFYYFSFVLNLRHYSPVWAGGSYF 356

Query: 382 MFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIIL 441
           +F I+G +A+  V ++IK++   V+L FSM  F VG  +LSV PV QSY+K+ L    IL
Sbjct: 357 IFGIFGVLASAFVGISIKKITAPVILLFSMVLFCVGTTLLSVAPVDQSYFKLTLAGMAIL 416

Query: 442 SFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDK 501
             G+D SFPA++IILSD LP +YQGMAGSL  TMVNYS SLCLG+G+T E Q+NK+G D 
Sbjct: 417 GVGLDTSFPAATIILSDGLPMEYQGMAGSLALTMVNYSMSLCLGMGNTVERQINKDGQDV 476

Query: 502 LKGYRAALY 510
           LKGYR+A Y
Sbjct: 477 LKGYRSAEY 485

>TBLA0C01160 Chr3 complement(246034..247836) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  436 bits (1122), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 224/520 (43%), Positives = 323/520 (62%), Gaps = 9/520 (1%)

Query: 22  NQEAEYTKNDQTNVEEKKNC-------STESE--AEWCSESEFTDNDTPWQNPTYFANRW 72
           N+     KND    ++   C       S ES   A       F       + P  F NR+
Sbjct: 61  NKNILTGKNDTMPKDQNLVCQNIMQFASFESSLSATPPDNKPFITESQNLRRPDIFKNRF 120

Query: 73  QEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSG 132
           QE+ F+   +              + MNILA+  +++  +Q WLMA+FPL  G  IL+SG
Sbjct: 121 QEFGFVLVGVIGQFLSQVGLTQVLSTMNILAEELHTTKMRQPWLMAAFPLGLGCTILISG 180

Query: 133 RIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLI 192
           R+GDI+GLKK L+ GY++  IW+LICGF++Y H+D  FI+ R FQGLG+A  LPN+  LI
Sbjct: 181 RLGDIFGLKKVLLLGYIITTIWTLICGFSSYAHSDDLFIVSRTFQGLGLACALPNMFELI 240

Query: 193 GNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMV 252
           G IYK +  +KN +   +G  +PIGA LGG+++GL    N K WPW FY++AIV  +N +
Sbjct: 241 GIIYKPHCFKKNMIFCIIGAMSPIGATLGGIFAGLSVKYNIKNWPWSFYSFAIVAFLNGI 300

Query: 253 MAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVF 312
           +A + IP+ +  N  G  MDW GSA+G+ G+++ NFV+NQ PIDGW+  Y+I LL+VSV 
Sbjct: 301 IAWFCIPNDIEKNPQGLKMDWIGSALGLFGLVVLNFVFNQTPIDGWSSAYLIVLLVVSVV 360

Query: 313 LLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYS 372
            LI F IYE+  A  PL+P  +  N  + +ILL +F GWG F IWTFYY+AFQLNLRHYS
Sbjct: 361 ALILFVIYELTMANFPLIPKGIHSNYRLILILLTLFCGWGGFAIWTFYYFAFQLNLRHYS 420

Query: 373 AVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWK 432
            +WA  + F+ +I GTI   +  L ++R+ P +LL FSM GF  G I+ +VTP+HQ++++
Sbjct: 421 PLWASSSNFVLIISGTIYTIICCLAVQRMKPPILLFFSMLGFLGGNILFAVTPIHQTFFR 480

Query: 433 MNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEA 492
              G   +   GM  SFP++S++ ++ LP+ Y+ MAGSLVN  +NY+TS+C+G+  +A  
Sbjct: 481 NMFGSMFLFPLGMVFSFPSASMMTAETLPTHYKSMAGSLVNVAINYATSICVGMAGSANV 540

Query: 493 QVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFEVLW 532
             N +G D L G+RAA Y+ IGL    + ++  Y+   +W
Sbjct: 541 NHNNHGQDLLHGFRAASYLAIGLSGFSVFLSGLYMIGSIW 580

>YOR378W Chr15 (1049511..1051058) [1548 bp, 515 aa] {ON} Putative
           paralog of ATR1, but not required for boron tolerance;
           member of the DHA2 family of drug:H+ antiporters;
           YOR378W is not an essential gene
          Length = 515

 Score =  331 bits (849), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/496 (38%), Positives = 279/496 (56%), Gaps = 16/496 (3%)

Query: 38  KKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTA 97
           +KN  T +EA    +   ++ D   + P      W E AF+                  A
Sbjct: 9   QKNLDTNAEALKKEDKVLSEFDIQDERPKSL--LW-ESAFVGVLCSAQLMTQAGLGQSLA 65

Query: 98  PMNILADAFNSS-AKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSL 156
           P++I+ ++F ++ A + +W  +++ L  G+FIL++GR+GDI+G KK  + G+    +WSL
Sbjct: 66  PLHIIGNSFGTTNAGQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSL 125

Query: 157 ICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216
           + GF+ Y+ N  FF  CRAFQG+G AF+LPN + ++G  YK    RKN V S  G  AP 
Sbjct: 126 LAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGR-RKNMVFSLFGASAPG 183

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST-VPT-NIHGFGM--- 271
           G  LG V+S ++       WPW ++   I   +  V   + IP T +P+ +   F +   
Sbjct: 184 GFFLGAVFSSMLGQL--AWWPWAYWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLER 241

Query: 272 -DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330
            D+ GS  GVVG+ILFNF WNQGP+ GW   Y  ALLIV  F L+ F   E + A  PLL
Sbjct: 242 IDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYALLIVGTFFLVIFAYIESR-AAFPLL 300

Query: 331 PPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIA 390
           P   + +     +L  +  GW SFGIW FY + F  + R  + + +   F    I G  A
Sbjct: 301 PFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAISGFCA 359

Query: 391 AFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFP 450
           A      +    PS ++ F+MT FTVG I+++  PVHQ+YW       I++ +GMD+SFP
Sbjct: 360 AVTTGFLLSHTPPSTVMLFAMTAFTVGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 419

Query: 451 ASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALY 510
           A++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+  T E++VN  G   LKGYR + Y
Sbjct: 420 AATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESRVNDGGAKPLKGYRCSWY 479

Query: 511 VGIGLGACGMLVAFCY 526
           +GIGL   G+ VA  Y
Sbjct: 480 MGIGLSGLGIFVAATY 495

>Smik_15.560 Chr15 (995453..997003) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  328 bits (841), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 186/460 (40%), Positives = 262/460 (56%), Gaps = 13/460 (2%)

Query: 74  EYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSG 132
           E AF+                  AP++I+ D+F ++   Q +W  +++ L  G+FIL++G
Sbjct: 43  ESAFVGVLCSAQLMTQAGLGQSLAPLHIIGDSFGTANPGQLSWFASAYSLTVGTFILIAG 102

Query: 133 RIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLI 192
           R+GDI+G KK  + G+    +WSL+ GF+ Y+ N  FF  CRAFQG+G AF+LPN + ++
Sbjct: 103 RLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGMGPAFLLPNAIAIL 161

Query: 193 GNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMV 252
           G  YK    RKN V S  G  AP G  LG V+S ++       WPW ++   I   +  V
Sbjct: 162 GRTYKPGR-RKNMVFSLFGASAPGGFVLGAVFSSMLGQL--AWWPWAYWLMGIACFLLAV 218

Query: 253 MAIYSIPSTVPTN--IHGFGM----DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIAL 306
              Y IP T   N  +  F +    D+ GS  GVVG+ILFNF WNQGP+ GW   Y  AL
Sbjct: 219 AGYYLIPHTPMPNRDVASFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGWQTPYTYAL 278

Query: 307 LIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           LIV    LI F   E + A  PLLP   + +     +L  +  GW SFGIW FY + F  
Sbjct: 279 LIVGTVFLIIFAFIESR-AAFPLLPFAALSS-DTAFVLSCIAAGWASFGIWIFYTWQFME 336

Query: 367 NLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPV 426
           + R  + + +   F    I G  AA +    +    PS ++ F+MT FTVG I+++  PV
Sbjct: 337 DSRGQTPLLSSAQFSPVAISGFCAALMTGFLLSHTPPSTVMFFAMTAFTVGTILIATAPV 396

Query: 427 HQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV 486
           HQ+YW       I++ +GMD+SFPA++I+LSD +P ++QG+A SLVNT+VNYS S+ LG+
Sbjct: 397 HQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNTVVNYSISIGLGI 456

Query: 487 GSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAFCY 526
             T E+ VN  G + LKGYR + Y+GIGL   G+ VA  Y
Sbjct: 457 AGTIESNVNDGGANVLKGYRCSWYLGIGLSGFGIFVAATY 496

>Suva_8.435 Chr8 (786917..788464) [1548 bp, 515 aa] {ON} YOR378W
           (REAL)
          Length = 515

 Score =  324 bits (830), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/496 (38%), Positives = 274/496 (55%), Gaps = 15/496 (3%)

Query: 38  KKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTA 97
           +KN  T +E    ++ E   N    Q+ T  +  W E AF+                  A
Sbjct: 9   QKNLETSAETT-KTDDEVLLNQFELQDETPGSLVW-EAAFVGVLCSAQLMTQAGLGQSIA 66

Query: 98  PMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSL 156
           P++I+ D+F ++   Q +W  +S+ L  G+FIL++GR+GDI+G +K  I G+    +WSL
Sbjct: 67  PLHIIGDSFGTTNPGQLSWFASSYSLTVGTFILIAGRLGDIFGHRKFFILGFFWYALWSL 126

Query: 157 ICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216
           + GF+ Y+ N  FF  CRAFQG+G AF+LPN + ++G  YK    RKN V S  G  AP 
Sbjct: 127 LAGFSVYS-NKIFFDCCRAFQGMGPAFLLPNAIAILGRTYKPGK-RKNMVFSLFGASAPG 184

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST-VPT-NIHGFGM--- 271
           G  LG V+S ++       WPW ++   I   +  V   + IP   +P+ +   F M   
Sbjct: 185 GFVLGAVFSSMLGQL--AWWPWAYWIMGIACFLLAVAGYFVIPHVQMPSRDSPSFNMLER 242

Query: 272 -DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330
            D+ GS  GV+G+ILFNF WNQGP+ GW   Y   LLIV    L  F   E + A  PLL
Sbjct: 243 VDFAGSVTGVIGLILFNFAWNQGPVVGWETPYTYVLLIVGTVFLGVFVFIESR-AAYPLL 301

Query: 331 PPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIA 390
           P   + +     +L  +  GW SFGIW FY + F    R  S + +   F    I G  A
Sbjct: 302 PFAALSS-DAAFVLGCIAAGWSSFGIWIFYTWQFMEESRKQSPLLSSAQFAPVAISGFCA 360

Query: 391 AFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFP 450
           A      +     S ++ F+MT FTVG I+++  PVHQ+YW       I++ +GMD+SFP
Sbjct: 361 AVTTGFLLSHTPASTVMLFAMTAFTVGIILIATAPVHQTYWAQTFVSIIVMPWGMDMSFP 420

Query: 451 ASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALY 510
           A++I+LS+ +P ++QG+A SLVNT+VNYS S+ LG+  T E+QVN  G + LKGYR + Y
Sbjct: 421 AATIMLSNSMPHEHQGLAASLVNTVVNYSISIGLGIAGTIESQVNDGGANALKGYRCSWY 480

Query: 511 VGIGLGACGMLVAFCY 526
           +GIGL   G+ VA  Y
Sbjct: 481 MGIGLSGLGIFVAAVY 496

>KLTH0C10560g Chr3 (875216..876763) [1548 bp, 515 aa] {ON} similar
           to uniprot|Q08902 Saccharomyces cerevisiae YOR378W
           Hypothetical ORF
          Length = 515

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/514 (37%), Positives = 275/514 (53%), Gaps = 24/514 (4%)

Query: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTC 81
           ++E    K+D    E     ST  + +  S+        P        +   E AF+   
Sbjct: 5   DKEENQKKDDGLTRE-----STHDQGQELSQPHHNGIQKP-------ESLLGEAAFVGVI 52

Query: 82  MXXXXXXXXXXXXXTAPMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSGRIGDIYGL 140
                          AP++I+ D+F +    Q +W  A++ L  G+FIL++GR+GD+YG 
Sbjct: 53  CGAQLMTQAGLGQSIAPLHIIGDSFGTRNPGQLSWFAAAYSLTVGTFILIAGRLGDVYGH 112

Query: 141 KKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANT 200
           KK  I G+    +WSL+ GF+ Y+ N  FF  CRAFQG+G A +LPN + ++G  Y    
Sbjct: 113 KKFFIIGFFWYALWSLLAGFSVYS-NQIFFDCCRAFQGIGPALLLPNAIAILGRTYVPGR 171

Query: 201 LRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPS 260
            RK  ++S  G  AP G  LG V+S +        WPW ++A  IV     V  I  IP 
Sbjct: 172 -RKAMILSLFGATAPAGFVLGAVFSSIFGQLT--WWPWAYWAMGIVCFFLAVAGILVIPR 228

Query: 261 ----TVPTNIHGFG-MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
                + T++  +  +D  GS  GV+G++L NF WNQGP+ GW   Y  +LLIVS   L 
Sbjct: 229 MPLPELDTSVSTYQRLDIPGSVTGVIGLVLLNFAWNQGPVVGWQTPYTYSLLIVSAVFLC 288

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVW 375
            F   E + A  PLLP   + +     +L  V  GW SFGIW +Y++ F   LR +S + 
Sbjct: 289 VFAFIESR-APHPLLPLSALSS-DAAFVLGCVGAGWSSFGIWIYYFWLFLEELRGHSPLL 346

Query: 376 AGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNL 435
               F    I G  AA      I RV  S+++ F+MT FTVG I+++  PV Q YW    
Sbjct: 347 TSAQFAPVAISGLCAALTTGFVITRVRASLVMLFAMTAFTVGGILIATAPVKQVYWAQAF 406

Query: 436 GMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVN 495
              I++ +GMD+SFPA++I+LSD +P ++QG+A SLVN +VNYS S+ LG+  T E +VN
Sbjct: 407 VSIIVMPWGMDMSFPAATIMLSDSMPHEHQGLAASLVNVVVNYSISIGLGLAGTVEGRVN 466

Query: 496 KNGTDKLKGYRAALYVGIGLGACGMLVAFCYLFE 529
             G + LKGYR A Y+GIGL   G+L+AF Y + 
Sbjct: 467 NGGANLLKGYRGAWYMGIGLSGFGILIAFMYEYH 500

>Skud_15.545 Chr15 (988549..990099) [1551 bp, 516 aa] {ON} YOR378W
           (REAL)
          Length = 516

 Score =  323 bits (829), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 184/482 (38%), Positives = 266/482 (55%), Gaps = 14/482 (2%)

Query: 52  ESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAK 111
           + E   ++   Q+ T  +  W E AF+                  AP++I+  +F ++  
Sbjct: 22  DDEVVLDEFDIQDETPGSLLW-ETAFVGVLCSAQLMTQAGLGQSLAPLHIIGKSFGTTNP 80

Query: 112 KQ-TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFF 170
            Q +W  +++ L  G+FIL++GR+GDI+G KK  + G+    +WSL+ GF+ Y+ N  FF
Sbjct: 81  GQLSWFASAYSLTVGTFILIAGRLGDIFGHKKFFVLGFFWYALWSLLAGFSVYS-NKIFF 139

Query: 171 ILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAH 230
             CRAFQG+G AF+LPN + ++G  YK+   RKN V S  G CAP G  LG V+S L+  
Sbjct: 140 DCCRAFQGMGPAFLLPNAIAILGRTYKSGK-RKNMVFSLFGACAPGGFVLGAVFSSLLGQ 198

Query: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG------MDWTGSAIGVVGMI 284
                WPW ++   I      +   + IP T   + H         +D+ GS  GV+G+I
Sbjct: 199 L--AWWPWAYWIMGIACFFLAIAGYFIIPHTAMPSRHASSFKLLERVDFAGSVTGVIGLI 256

Query: 285 LFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMIL 344
           LFNF WNQGP+ GW   Y   LLIV    L  F   E + A  PLLP   + +     +L
Sbjct: 257 LFNFAWNQGPVVGWQTPYTYILLIVGTVFLAIFAFIESR-AAFPLLPFAALSS-DTAFVL 314

Query: 345 LAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPS 404
             +  GW SFGIW FY + F  + R  + + +   F    + G  AA      + R  PS
Sbjct: 315 SCIAAGWASFGIWIFYTWQFMEDSRGQTPLLSSAQFSPVAVSGFCAALTTGYLLSRTPPS 374

Query: 405 VLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQY 464
            ++ F+MT FT G I+++  PVHQ+YW       I++ +GMD+SFPA++I+LSD +P ++
Sbjct: 375 TVMLFAMTAFTAGTILIATAPVHQTYWAQTFVSIIVMPWGMDMSFPAATIMLSDSMPHEH 434

Query: 465 QGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVAF 524
           QG+A SLVNT+VNYS S+ LG+  T E+ VN  G   LKGYR + Y+GIGL   G+ VA 
Sbjct: 435 QGLAASLVNTVVNYSISIGLGIAGTIESNVNDGGAKPLKGYRCSWYMGIGLSGLGIFVAA 494

Query: 525 CY 526
            Y
Sbjct: 495 IY 496

>Kwal_23.6547 s23 (1635677..1637212) [1536 bp, 511 aa] {ON} YOR378W
           - Hypothetical ORF [contig 358] FULL
          Length = 511

 Score =  303 bits (776), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 171/441 (38%), Positives = 250/441 (56%), Gaps = 12/441 (2%)

Query: 97  APMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           AP+ I+ ++F  S   Q +W  A++ L  G+FIL++GR+GD++G KK  + G+L   +WS
Sbjct: 62  APVRIIGNSFGISNPGQLSWFSAAYSLTVGTFILIAGRLGDLFGHKKLFVVGFLWYSLWS 121

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP 215
           L+ GF+ Y+ N  FF  CRA QG+G AF+LPN + ++G  Y     RK  V S  G  AP
Sbjct: 122 LLAGFSVYS-NQIFFDCCRALQGIGPAFLLPNSIAILGRTYTPGK-RKQMVFSIFGATAP 179

Query: 216 IGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG----- 270
            G  LG V+S + +      WPW ++A      +  V  I  IP   P  I         
Sbjct: 180 GGFVLGSVFSSIFSQL--AWWPWAYWAMGTACLVLGVAGIIVIPQAPPPKIDISAGILER 237

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330
           +D  G+  G++G+ L NF WNQGP+ GW   Y  ALLIV    L+ F + E + A+ PLL
Sbjct: 238 IDAAGATTGILGLALVNFAWNQGPVVGWQTPYTYALLIVGFVFLLVFSLIESR-ARFPLL 296

Query: 331 PPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIA 390
           P   +    +  +L  +  GW SFGIW FY++ F  + R  S +     F    I G  A
Sbjct: 297 PFAALST-DLAYVLGCIAAGWSSFGIWIFYFWQFLEDSRSQSPLLTSAQFVPVAISGLCA 355

Query: 391 AFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFP 450
           A      +  V    ++  +M  FTVG ++++  P++Q+YW       II+ +GMD+SFP
Sbjct: 356 ALTTGYILSHVPACAVMLIAMIAFTVGGVLVATAPINQTYWAQTFVSLIIMPWGMDMSFP 415

Query: 451 ASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALY 510
           A++I++S+ +P ++QG+A SLVNT+VNYS SL LG   T E +VN  G ++L+GYR A Y
Sbjct: 416 AATIMISNAMPHEHQGLAASLVNTVVNYSISLALGFAGTIETRVNNKGANRLEGYRGAWY 475

Query: 511 VGIGLGACGMLVAFCYLFEVL 531
           +GIGL   G+LVA  Y +  L
Sbjct: 476 MGIGLSGLGVLVAIVYAWSTL 496

>KLLA0B00352g Chr2 (22476..23972) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378W
          Length = 498

 Score =  297 bits (760), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 246/435 (56%), Gaps = 12/435 (2%)

Query: 98  PMNILADAFNSSAKKQ-TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSL 156
           P+ I+ D+F      Q +W  ++F L  G+FIL++GR+GD +G KK  + G+L   +WS+
Sbjct: 53  PLQIIGDSFGIKNPGQLSWFASAFSLTVGTFILIAGRLGDTFGHKKFFVMGFLWYALWSI 112

Query: 157 ICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216
           + GF+ Y+ N  FF  CRAFQG+G AF LPN + +I   Y+    ++N + S  G CAP 
Sbjct: 113 LAGFSVYS-NQIFFDCCRAFQGIGPAFTLPNAIAIIARTYRPGR-KQNMIFSLFGACAPS 170

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF-----GM 271
           G  +G V+S L++      WPW ++   I   +  V     IP   P +          +
Sbjct: 171 GFVVGAVFSSLLSEF--AWWPWAYWIMGITCFLLGVAGYLVIPHHPPIHPDEKCSLVERI 228

Query: 272 DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLP 331
           D  GS  GVVG+ILFNF WNQGP+ GW   Y  ALLIV    L AF   E + AK PLLP
Sbjct: 229 DVAGSVTGVVGLILFNFAWNQGPVVGWETSYTYALLIVGSAFLAAFGFIESR-AKHPLLP 287

Query: 332 PEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAA 391
              + +  I  ++  +  GW SFGIW +Y +    NLR    + +   F    I G  AA
Sbjct: 288 VRKLSSDTI-FVMGCIAAGWSSFGIWVYYTWQLMANLRDQPPLLSSAQFVPVAISGLCAA 346

Query: 392 FLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPA 451
                 + R  PS ++  +M  FTVG I+++  PV Q+YW       I++ +GMD+SFPA
Sbjct: 347 MSTEFLLTRTSPSTVMIIAMIAFTVGSILVATVPVSQTYWAQTFVSIIVMPWGMDMSFPA 406

Query: 452 SSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYV 511
           ++IILS  +P+ +QG+A SLVNT++NYS S+ LG   T E+Q++    D LKGYR A Y+
Sbjct: 407 ATIILSTAMPASHQGLAASLVNTIINYSISIGLGFAGTIESQISDGEDDLLKGYRGAYYM 466

Query: 512 GIGLGACGMLVAFCY 526
           GIGL   G+ VA  Y
Sbjct: 467 GIGLAGLGLGVAISY 481

>TDEL0G04950 Chr7 complement(922428..923966) [1539 bp, 512 aa] {ON} 
          Length = 512

 Score =  283 bits (725), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 174/509 (34%), Positives = 283/509 (55%), Gaps = 29/509 (5%)

Query: 26  EYTKNDQ-----TNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFIST 80
           ++ K DQ        E   +C+ ES  E         +   W   + F    +EYAF+ T
Sbjct: 4   KHDKEDQYVFFSECTERSISCNQESSKE-------AYDRCSWLKSSNFHFLCKEYAFVFT 56

Query: 81  CMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGL 140
            +                +N+L+D+F+       +L+ S+P+V GSF+L+ GR+G+++G 
Sbjct: 57  GVMAQAFNQAGGTMILPLVNVLSDSFHGK-----FLLNSYPMVCGSFMLIGGRLGEVHGY 111

Query: 141 KKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYK--A 198
           K+TL+GGY+++++ SL+ G + Y+ +  F+++CRAFQG+G+A ILPN        Y+  A
Sbjct: 112 KETLLGGYIILILSSLLGGLSRYSKSSIFYVICRAFQGVGMALILPNFSAAYDYRYQSQA 171

Query: 199 NTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSI 258
              RK  + + +G  A  GA LG   SG+    +   W W +Y Y I   + + ++ YS+
Sbjct: 172 KAHRKTILSTIIGCGASTGAFLGTFLSGICVTRSESNWSWAYYTYTIAATLTLALSYYSV 231

Query: 259 PSTVPTN----IHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLL 314
           P  +       ++G G  W  +     G+++ N   N   +   N  +II LL+V V LL
Sbjct: 232 PDNITKKNKPCLNGLG--WFSNR--SCGLLMLNVACNLAAVASSNWSHIIVLLVVFVCLL 287

Query: 315 IAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAV 374
           + F ++E+KF++ P+   E+  N  + ++L ++F GWG++GIW+ Y++ F LNLR+YS +
Sbjct: 288 LLFLVFELKFSEDPVFSKELFTNASVSLVLASIFFGWGTYGIWSGYFFRFLLNLRNYSPL 347

Query: 375 WAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMN 434
            AG T+   VI G +A   +++ +KR GP + L FS  GFT   I+LSVTP+HQSY++  
Sbjct: 348 AAGSTYLTLVIGGYVAEIGISMLVKRTGPKLFLLFSSLGFTCSIIILSVTPIHQSYFRST 407

Query: 435 LGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQV 494
           LG  I L+ G+D SFP+S+IIL + LPS+Y  M   L N + NY+ S   G+ ++A   +
Sbjct: 408 LGSMIFLALGLDFSFPSSAIILQNELPSKYHEMTAVLTNGIFNYAISFWPGICNSALRSL 467

Query: 495 NKNGTDKLKGYRAALYVGIGLGACGMLVA 523
           +    + +K YR   Y  IGL A G+  A
Sbjct: 468 SS--IELIKYYRYVYYFAIGLSAIGLFAA 494

>KNAG0D00130 Chr4 complement(6264..7961) [1698 bp, 565 aa] {ON}
           YOR378W
          Length = 565

 Score =  213 bits (543), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 160/548 (29%), Positives = 254/548 (46%), Gaps = 49/548 (8%)

Query: 4   SDSESECTKTI-------TRDHITIN--QEAEYTKND-QTNVEE--KKNCSTESEAEWCS 51
           SDS SE    +       T D I  N   ++  T+ D   NV +  K   + E     C+
Sbjct: 6   SDSNSENIFRLENKEVNGTYDSINFNGGDDSSKTRRDSDDNVSDINKSAPAPEEHDPPCT 65

Query: 52  ESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAK 111
             E T N           +   E  F+                    M+++ + F  +  
Sbjct: 66  GEEATLN----------MSLLHEIIFVLLVSSSQVLGLAGAVQGIPQMDVIVEWFKLTHP 115

Query: 112 KQT-WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFF 170
             + W    +    GSF+L++G++GD+ G K   + GY  + +WSL+ GF+ Y  +  FF
Sbjct: 116 SDSGWCNGGYATTYGSFVLIAGKMGDMNGHKSMFLIGYAWLALWSLLTGFSRYCPSSHFF 175

Query: 171 ILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAH 230
             CRA QG+G AF   + + ++G  Y     RKNF+ SF G C   G  LG V+S L   
Sbjct: 176 FFCRAAQGIGAAFTFTSALSILGKSYPPCK-RKNFIFSFFGACGSFGVVLGMVFSALFTQ 234

Query: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTV-----PTNIHGFGMDWTGSAIGVVGMIL 285
                W W +++ AI   + ++++I+ IP  V      +N+  F  D+ G+ + V G++L
Sbjct: 235 L--AHWSWAYWSMAIACVVIIILSIFFIPGDVVEKHETSNV--FYFDYLGAFLFVTGLVL 290

Query: 286 FNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILL 345
           F+  WNQ P  G+ + Y+  LLIVSV +L      E K    PLLP   I    +  +LL
Sbjct: 291 FSVAWNQAPTYGFGRTYVYVLLIVSVVILALAMYVETK-VDDPLLPWTHISANTL-KVLL 348

Query: 346 AVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIK-RVGPS 404
           A+F  + SF +W  Y + F L  +  + + A        + G  AA   AL +   V   
Sbjct: 349 AIFFAYASFTMWAAYTFRFNLMAKGDTLLLAAAKMTPMAVSGVFAALFSALLLNIHVQVQ 408

Query: 405 VLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQY 464
           + +  S+  F V  I+++     Q+YW       I++SFG+D+SFP+++++LS+ +P ++
Sbjct: 409 IRMLISLLAFLVPPILMATMGAGQTYWGEVFVTTIVISFGLDISFPSATLLLSNRIPDKF 468

Query: 465 QGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNK---------NGTDKLKGYRAALYVGIGL 515
           +G+  SLV  ++NY+T+L    G    A V +          G    K      YVGIG 
Sbjct: 469 KGLGASLVGAVLNYATAL----GPPTAASVLRYQCPDCMAHKGNAFTKTINIIGYVGIGT 524

Query: 516 GACGMLVA 523
              G LVA
Sbjct: 525 AGLGTLVA 532

>KAFR0C04860 Chr3 (964552..966156) [1605 bp, 534 aa] {ON}  YOR378W
          Length = 534

 Score =  191 bits (485), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/407 (32%), Positives = 212/407 (52%), Gaps = 15/407 (3%)

Query: 127 FILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH-NDAFFILCRAFQGLGIAFIL 185
           F++++G++GDI G K   I GY  + +WSL+ GF+ Y   N  FF  CR  QG+G AF+ 
Sbjct: 104 FVIIAGKLGDINGHKNMFIFGYAWLTLWSLLTGFSKYAKANAVFFYFCRGAQGIGSAFLT 163

Query: 186 PNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAI 245
           P  + L+G  Y     RKN+V SF G C P G   G V+S L        W W +++ A+
Sbjct: 164 PTGLALLGKHYPPCK-RKNYVFSFYGACGPFGIVAGSVFSALFTQLT--TWAWTYWSMAV 220

Query: 246 VVAINMVMAIYSIP-STVPTNIHG--FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGY 302
              I  +++   IP    P       +  D+ G   G+ GMILF+ VWNQ P+  +   Y
Sbjct: 221 TCLIITILSYIFIPKDNTPKRERSAFYSFDYVGGFCGITGMILFSVVWNQAPLSHFKAPY 280

Query: 303 IIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYY 362
           + +LLIVSV  +    I + +  K PL+P + + +  I   L+ VF G+  F IW FY +
Sbjct: 281 VYSLLIVSVVFMTMALIIDSR-VKDPLIPWKSMCSNVIKA-LIVVFFGFLGFTIWLFYSW 338

Query: 363 AFQLNLRHYSAVWAGGTFFMFVIWGTIAA-FLVALTIKRVGPSVLLCFSMTGFTVGCIML 421
            F L  ++ S + A   F    I G  AA F V L  K+V   + L  ++  F +  I++
Sbjct: 339 RFYLVAKNDSLLLAAAKFIPLGISGIFAACFSVLLLNKKVPVQLRLLTAVCAFLICAILI 398

Query: 422 SVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTS 481
           S   + ++YW       +I++ G+D++FP+++++LS+ + ++ QG+A +L  T +NY T+
Sbjct: 399 STMTLQETYWGNAFVATVIIAIGLDVAFPSATLLLSNGVLNEQQGLAAALAATALNYGTA 458

Query: 482 LCLGVGS-----TAEAQVNKNGTDKLKGYRAALYVGIGLGACGMLVA 523
           L  GV +       +  + ++    +     A YV IG     ++VA
Sbjct: 459 LGPGVATLIITYQCDDCLARSDGRFVHAVHIAGYVAIGTAGIAVVVA 505

>SAKL0C06116g Chr3 complement(571813..572370) [558 bp, 185 aa] {ON}
           some similarities with uniprot|P13090 Saccharomyces
           cerevisiae YML116W ATR1 Multidrug efflux pump of the
           major facilitator superfamily required for resistance to
           aminotriazole and 4-nitroquinoline-N-oxide
          Length = 185

 Score =  152 bits (385), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 107/177 (60%), Gaps = 35/177 (19%)

Query: 96  TAPM-NILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIW 154
           T P+ N+L+  F SS  +QT L+AS PLVSGSFILVSG++GDIYGLK TL+ GY  V++W
Sbjct: 14  TLPLINVLSRGFESSTAEQTRLVASIPLVSGSFILVSGKVGDIYGLKNTLLFGYATVIVW 73

Query: 155 SLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA 214
           S ICG   Y  +  FF++ RAFQGLG+AF+LPNVMG + N+Y A ++RKN V        
Sbjct: 74  SFICGLTRYAGSVQFFVIARAFQGLGLAFVLPNVMGTVSNVYIAGSIRKNMV-------- 125

Query: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGM 271
                                     YAY + V++NM + ++++P  +PTN+ G  M
Sbjct: 126 --------------------------YAYTVAVSLNMALCVWALPWNIPTNVRGQAM 156

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 460 LPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKL 502
           +P+  +G A      M+ YS  +CLG+  T E +V+K G D+L
Sbjct: 147 IPTNVRGQA------MLGYSMPMCLGIAGTVEHRVHKGGADRL 183

>NDAI0K02730 Chr11 complement(612590..614404) [1815 bp, 604 aa] {ON}
           
          Length = 604

 Score =  159 bits (403), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 123/481 (25%), Positives = 222/481 (46%), Gaps = 72/481 (14%)

Query: 108 SSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHND 167
           +S  +  W+ ASF +  G+FI+++G++ DI   +   I GY+   +W+LI GFA+Y   +
Sbjct: 108 TSTLQLGWVNASFAMTCGAFIILAGKLCDILNPRIIFISGYVWFSLWTLITGFASYVPKN 167

Query: 168 AFFI-LCRAFQGLGIAFILPNVMGLIGNIY---------------------KANTLRKNF 205
             F+ +CR  QG+G A + P+ + L+   Y                      ++ + KN 
Sbjct: 168 MIFLYICRGCQGIGGALLFPSALILLNQYYTVPEPSPSQSQSKSPTTSAPSPSHDIEKNL 227

Query: 206 -------------------------VISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIF 240
                                      S  G CAP+G  +GG++S +        WPW +
Sbjct: 228 SSDDDNDGDSSIADDSDIICTSKSIAFSLYGACAPLGIVIGGIFSAIFTQL--ATWPWNY 285

Query: 241 YAYAIVVAINMVMAIYSIPSTVP-----TNIHGF----GMDWTGSAIGVVGMILFNFVWN 291
           ++ +IV  +  +++ + +   +P     +N +        D+ G  +G+  +ILF   W+
Sbjct: 286 WSMSIVTTLLSILSYFYVVVPIPVEKLDSNPNSLKNWKNFDFLGVILGISALILFGVSWD 345

Query: 292 QGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMI--LLAVFM 349
           Q  +  +   ++   L+ S+   IA  I+E  F  +P++P   I+  H G I  LL VF 
Sbjct: 346 QATMYKFKTIHVYLTLLFSLVSFIAMIIWEYYF-NNPIIP---IRQIHPGTIKALLVVFF 401

Query: 350 GWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAA-FLVALTIKRVGPSVLLC 408
            + SF  W FY +     ++  S +     F    + G I+A F + L +KRV   + L 
Sbjct: 402 SYISFTQWLFYTWKLFTEVKDNSPILGSVKFIPLSVAGIISATFSILLIVKRVPVQIRLL 461

Query: 409 FSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMA 468
              + F +  I+L    +  SYW       I +S G+D+SFP+++++L++ +P + QG+ 
Sbjct: 462 AGASSFLLSHILLLTCKLDSSYWTYQFFSIISISIGLDISFPSATLLLTNGIPPEIQGIC 521

Query: 469 GSLVNTMVNYSTSLCLGVGST-AEAQVNKNGTDK------LKGYRAALYVGIGLGACGML 521
            +LV +++NY T++   +  T  + Q     +D       LKG   A  VG+G     +L
Sbjct: 522 AALVGSVLNYGTAIGPPIAQTIIQYQCESCMSDPHDKKAFLKGIHIAGAVGVGCSGIAVL 581

Query: 522 V 522
           +
Sbjct: 582 I 582

>NCAS0A05720 Chr1 (1117491..1119182) [1692 bp, 563 aa] {ON} 
          Length = 563

 Score =  158 bits (399), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 142/541 (26%), Positives = 235/541 (43%), Gaps = 41/541 (7%)

Query: 5   DSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQN 64
           D   +   T   DH   +     + + Q     K+ CS    A+         +     N
Sbjct: 12  DRTLKIQDTGNTDHYLPSNSTASSLHSQ---RTKEQCSNLQPAQ-------AQDQLESMN 61

Query: 65  PTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQT---WLMASFP 121
           P    +R +E  FI                    M+ +   F   A +     W  A+F 
Sbjct: 62  PPPGPSRLRECMFIVIIASSQFISLAAASQAILQMDAITAWFQLPADRSLEAGWANAAFA 121

Query: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH--NDAFFILCRAFQGL 179
           +  G+FI+ +G++ D+ G K   I GY    +WSL+ G + Y       FF   R  QG+
Sbjct: 122 ITCGTFIIPAGKLCDLIGSKTVFIFGYAWYTLWSLLVGISRYAPKGQATFFFFGRGCQGI 181

Query: 180 GIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWI 239
           G A + P+ + L+G  Y  +  +KN V S  G C P+G  +GGV+S +        W W 
Sbjct: 182 GAAALFPSSLALLGKYYPPSC-KKNIVFSLYGFCVPLGVVVGGVFSAIFTQL--AHWSWN 238

Query: 240 FYAYAIVVAINMVMAIYSIPSTVPTNI-------------HGFGMDWTGSAIGVVGMILF 286
           +++ AIV A   +++ + IP   P  I             H    D+ G+ + V  ++LF
Sbjct: 239 YWSMAIVSAFFTLISCFYIP---PDEIIKSEEQKKKRAWFHLPKFDYLGTFLYVASLLLF 295

Query: 287 NFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLA 346
              WNQ     +    +   LIVS+   +A  I E  +   P++P   I  + I   LL 
Sbjct: 296 AVCWNQATGFKFKSVQVYVTLIVSLVCFVAMVIVEF-YVDDPIIPARKIHPQTIKA-LLV 353

Query: 347 VFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGP-SV 405
           VF  + SF IW FY + +   +R+ + +     F    I G IAA    L I    P  +
Sbjct: 354 VFFSYLSFTIWLFYLWKYFTVVRNDTVLLGAAKFVPLSIAGFIAALFSILLISTAVPVQI 413

Query: 406 LLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQ 465
            L      F +  I+       +SYW       II+S G+D+SFP+++++LS+ +P + +
Sbjct: 414 RLLAGACSFLLAHILFITLSRTESYWARPFLTIIIISIGLDISFPSATLLLSNGVPQELR 473

Query: 466 GMAGSLVNTMVNYSTSLCLGVGSTAEA-QVNK-NGTDKLKGYRAALYV--GIGLGACGML 521
           G++ +LV T +NY T +   +  T    Q +K   +  +  +  A+++   +G+GA G+ 
Sbjct: 474 GISAALVGTALNYGTGIGPPIAQTIIGYQCDKCMASGDMDQFVKAIHIAAAVGIGASGIA 533

Query: 522 V 522
           V
Sbjct: 534 V 534

>CAGL0L02519g Chr12 complement(297555..299144) [1590 bp, 529 aa]
           {ON} similar to uniprot|Q08902 Saccharomyces cerevisiae
           YOR378w
          Length = 529

 Score =  151 bits (381), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 209/425 (49%), Gaps = 24/425 (5%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH-NDAFFILC 173
           W  AS+ L S   +L++G++GD+ G K+ ++ G++ + IWSLI GF+ Y   N AF+   
Sbjct: 82  WANASYMLGSAVMVLIAGKLGDLNGHKRMVVFGWIWLTIWSLITGFSYYDRGNQAFYYTA 141

Query: 174 RAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENP 233
           RA QG+G  FI+PN + ++G  Y    L+K  + S  GM    G  +G  +S L A    
Sbjct: 142 RALQGIGSGFIVPNSLAIMGRTYFEPGLKKTIIFSIFGMMTSTGFVIGTTFSSLFAQLT- 200

Query: 234 KQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNI-HGFG-------MDWTGSAIGVVGMIL 285
            +W W ++A A V  +  V AI  IP   P NI H           D+ G+  GV G++L
Sbjct: 201 -KWAWNYWALACVCVLYTVGAILFIP---PDNIVHKPNSKPLYKRFDYLGAITGVSGLVL 256

Query: 286 FNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILL 345
           F+  + Q    GW+  +    LI+ V L++     + +    PL+P + ++   + +IL+
Sbjct: 257 FDVAFTQASALGWSPPHTYITLIIGVILILIAMFVDWR-VDDPLVPLQHLR-ADVVVILI 314

Query: 346 AVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALTIKR--VGP 403
            V+ G+ SF IW  +++ F   + + S +          I G+I A +  +T  +  +  
Sbjct: 315 CVYFGFLSFVIWANWFWQFYELVHNDSPLRIAAKLVPLAI-GSIPAAIFTVTCLQLNIKA 373

Query: 404 SVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQ 463
             ++  SM  F V  I+++    + +YW       II  F +D++ P ++++ SD +  +
Sbjct: 374 PTMMVISMVCFLVPNILMATVTPNTTYWAQPFVSSIIAPFAVDITVPTATLLFSDSVRKE 433

Query: 464 YQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKG-----YRAALYVGIGLGAC 518
            QG+A SL+ T+++Y+ S+     +     V   G D   G       +    GI L   
Sbjct: 434 SQGIAASLIITVISYAISIGPSYTAMVMWYVAPLGNDSTPGGFTHSLHSNFICGIVLSGI 493

Query: 519 GMLVA 523
           G++ A
Sbjct: 494 GLVTA 498

>SAKL0F00440g Chr6 complement(36452..38086) [1635 bp, 544 aa] {ON}
           conserved hypothetical protein
          Length = 544

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 95/418 (22%), Positives = 170/418 (40%), Gaps = 43/418 (10%)

Query: 114 TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILC 173
           +W + ++ +    FI   GR+GDI G     +    +  I SLIC   N   N   F + 
Sbjct: 63  SWALTAYAITFAGFIAFLGRVGDIIGNSVLFVSSCFLFSILSLICAVVN---NFGTFAVF 119

Query: 174 RAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP--IGAALGGVWSGLIAHE 231
           RA QG+  A I+P+   LI  +   + ++  F I   G      IG  +GG ++  +   
Sbjct: 120 RALQGIAAAGIVPSGYALIPTLSDEHEVQSFFAIVSCGFSTSFGIGFIIGGAFT--LTRI 177

Query: 232 NPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIH---------GFGMDWTGSAIGVVG 282
             K   ++ +A  +V++I    +I +  +  P                +D+ GS + +  
Sbjct: 178 GYKGIFYLTFAVMLVISIISYFSIGTSANQKPCTKDSPKTTKWSDALSLDFIGSFMFISS 237

Query: 283 MILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEI---------KFAKSP----- 328
            IL      +G  + W K      LIV + L + FFI+ I         K A +P     
Sbjct: 238 TILIVVGLTEGG-ESWKKPSAYVTLIVGIALFVLFFIWNICYGVLVKNLKSASNPKVYNY 296

Query: 329 ------LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFM 382
                 L+P +V+  ++   I +AVF  +G      +    +   +   S + A      
Sbjct: 297 FRTIQVLIPKDVLMMKNFIPITVAVFANYGCLFSNLYIVNQYCQYVSKNSPLLAAVKLLP 356

Query: 383 FVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVH----QSYWKMNLGMQ 438
            V+   I   ++A+    + P   +        +G I+L    +H      YWK+    Q
Sbjct: 357 LVVSMLIPNVVIAIKSDLISPRKAVVLGFFIMFIGSIIL--IQLHLITDNLYWKIFFCSQ 414

Query: 439 IILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNK 496
            +++FG  + FP S  IL  F P +Y+G+A  ++ T   +   +   V ++    +N+
Sbjct: 415 SLIAFGAAIFFPYSLNILIGFAPDEYKGIASGVMQTFGQFGVEVTFSVMTSILGNINE 472

>Smik_6.24 Chr6 (39520..41154) [1635 bp, 544 aa] {ON} YMR279C (REAL)
          Length = 544

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 105/464 (22%), Positives = 179/464 (38%), Gaps = 44/464 (9%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           ++ LA  +N S    +W + S+ +    FI   GR+GDI G             I SL+C
Sbjct: 52  IDDLAKKYNISYTTASWSLTSYAVTFAGFIACMGRLGDIVGNSVLFTISCSCFAILSLLC 111

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
                  N   F + RA QG+  A ++P    LI  +     ++K F I   G  + IG 
Sbjct: 112 A---VMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG- 167

Query: 219 ALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIY---------SIPSTVPTNIHGF 269
            LG +  G  A      +  IFY    V+++  V+A +           P  +       
Sbjct: 168 -LGLIIGGAFAATKIG-YRGIFYLTFAVMSLISVIAFFFTYNVENFDKKPQKIQAQTSVK 225

Query: 270 GMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK--- 326
            +D+ GS I V G IL      +G  + WN+      LI+ + L   FF++   +AK   
Sbjct: 226 SLDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLIIGILLFFGFFVWNCTYAKIVR 284

Query: 327 ----------------SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRH 370
                             L+P +V+  ++   I+LA  +         +    +      
Sbjct: 285 GIRFVGIDTSKYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAEK 344

Query: 371 YSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQS- 429
            S + AG      +I   +   L A    ++ P V +    +    G I+L    + +  
Sbjct: 345 DSPLLAGVKLVPLIICMVVGNALCAFESTKLKPRVGVALGFSLALAGSIILIQLHLIKDN 404

Query: 430 -YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGS 488
            +WK+    Q ++ FG+ + +P +  I     P Q +G+A  +  T       +   V +
Sbjct: 405 VFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDQSKGIASGVAQTFGQLGIEITFSVMA 464

Query: 489 TAEAQVN--KNGTDKLKGYRAAL----YVGIGLGACGMLV-AFC 525
           +    +N  K   D ++ +R       Y  + +GA G LV A C
Sbjct: 465 SVLGDINEMKGKEDAIQNFRTGFQNCSYFTVAVGALGFLVTAIC 508

>Skud_6.16 Chr6 (26284..27933) [1650 bp, 549 aa] {ON} YOR378W (REAL)
          Length = 549

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 100/463 (21%), Positives = 177/463 (38%), Gaps = 42/463 (9%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           ++ LA  +N S    +W + S+ +    FI   GR+GDI G             + SL+C
Sbjct: 52  IDDLAKTYNISYTTASWSLTSYAVTFAGFIACMGRLGDIIGNSVLFTISCSCFAVLSLLC 111

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
                  N   F + RA QG+  A ++P    LI  +     ++K F I   G  + IG 
Sbjct: 112 A---VMPNFPAFAVFRAIQGICAAGLVPCAYALIPILAPKEKVQKYFSIVSCGFSSTIG- 167

Query: 219 ALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSI--------PSTVPTNIHGFG 270
            LG +  G  A          +  +A++  I+++   ++         P     +     
Sbjct: 168 -LGLIIGGAFATTKIGYRGIFYLTFAVMTLISIIAFFFTYGVEKLNKKPQKDQASTSVKS 226

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK---- 326
           +D+ GS I V G IL      +G  + WN+      L++ + L   FF++   + K    
Sbjct: 227 LDFIGSLIFVAGSILIVVGLTEGG-ESWNRPVTYVTLVIGIILFFGFFVWNCTYTKIVRG 285

Query: 327 ---------------SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHY 371
                            L+P +V+  ++   I+LA  +         +    +       
Sbjct: 286 FKYCGIDTSKYFEKVQLLIPIDVLFMKNFIPIVLAFALNNACLFSCLYIIDQYSQYAERN 345

Query: 372 SAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIML-SVTPVHQS- 429
           S + AG      +I   I   L A    ++ P V +         G I+L  +  V +  
Sbjct: 346 SPLLAGVKLVPLIICMVIGNALCAFESTKLRPRVGVAIGFFLALAGSIILIQLHLVKEDL 405

Query: 430 YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV--- 486
           +WK+    Q ++ FG+ + +P +  I     P + +G+A  +  T       +   V   
Sbjct: 406 FWKIFFSAQALVGFGVAIFYPYALQIAVGGAPDESRGIASGVAQTFGQLGIEITFSVMAS 465

Query: 487 --GSTAEAQVNKNGTDKLK-GYRAALYVGIGLGACGMLV-AFC 525
             G+  E +   N   K + G++   Y  + +GA G LV A C
Sbjct: 466 VLGNINEMKGKSNAIQKFRTGFQNCSYFTVAVGALGFLVTAIC 508

>Suva_10.11 Chr10 (18934..20556) [1623 bp, 540 aa] {ON} YOR378W
           (REAL)
          Length = 540

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 101/462 (21%), Positives = 180/462 (38%), Gaps = 47/462 (10%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           ++ LA  ++ S    +W + S+ +    FI   GR+GDI G             I SL+C
Sbjct: 52  IDDLAQKYDISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSILFTVSCFFFAILSLLC 111

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
                  N   F + RA QG+  A ++P    LI  +     ++K F I   G  + IG 
Sbjct: 112 A---VMPNFPAFAVFRAIQGISAAGLVPCAYALIPMLAPEEEVQKYFSIVSCGFSSTIG- 167

Query: 219 ALGGVWSGLIAHENPKQWPWIFY-AYAIVVAINMVMAIYSI--------PSTVPTNIHGF 269
            LG +  G  A      +  IFY  +A++  I++V   ++         P          
Sbjct: 168 -LGLIIGGAFAATKIG-YKGIFYLTFAVMFLISIVAFFFTYGVENLSEPPRKDQATNRVR 225

Query: 270 GMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK--- 326
            +D+ GS I V G IL      +G  + WN+      L++ + L   FF +   +A+   
Sbjct: 226 SLDFIGSLIFVTGSILIVVGLTEGG-ESWNRPATYVTLVIGIILFFGFFFWNCSYARIVR 284

Query: 327 ----------------SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRH 370
                             L+P +V+  ++   I+LA  +         +    +      
Sbjct: 285 GIRCCGIDTSRYFEKVQLLIPVDVLFMKNFIPIVLAFALNNACLFSCIYIIDQYSQYEEK 344

Query: 371 YSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVH--- 427
            S ++AG      +I   I   L A    ++ P V +    +    G I+L  T +H   
Sbjct: 345 NSPLYAGVKLVPLIICMVIGNGLCAFESTKLKPKVGVVLGFSLALAGSIIL--TQLHLIK 402

Query: 428 -QSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV 486
              +WK+    Q ++ FG+ + +P +  I     P + +G+A  +  T       +   V
Sbjct: 403 EDMFWKIFFSSQALVGFGVAIFYPYALQIAVGGAPDRSKGIASGVAQTFGQLGIEITFSV 462

Query: 487 GSTAEAQVN----KNGTDK--LKGYRAALYVGIGLGACGMLV 522
            ++    ++    K+G  +    G++   Y  + +GA G LV
Sbjct: 463 MASVLGNIDGIRGKSGASQKFRTGFQNCTYFTVAVGALGFLV 504

>KLLA0C18931g Chr3 (1680133..1681794) [1662 bp, 553 aa] {ON}
           uniprot|Q874B4 Kluyveromyces lactis KLLA0C18931g Drug
           efflux permease KNQ1
          Length = 553

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 101/231 (43%), Gaps = 20/231 (8%)

Query: 106 FNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH 165
           FN S  +  W + S+ +    FI   GR+GDI G    +    ++  I+SL+C       
Sbjct: 53  FNVSHTQSGWALTSYVITFAGFIAFFGRVGDIVGNGIMMCVFSVIFGIFSLLCA---VVP 109

Query: 166 NDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVI--SFVGMCAPIGAALGGV 223
           N   F + RAFQG+  A I+P    L+  +++   L++ F I  S +   A +G  +GG 
Sbjct: 110 NFIAFTVFRAFQGMAGAGIVPCAYALVNKMFQGPNLQRYFSILSSVISAMAGVGFIIGGA 169

Query: 224 WSGLIAHENPKQWPWIFY-AYAIVVAINMVMAIYSIPSTVPTNIHG--------FGMDWT 274
           +      E    +   FY  +A  +A   V+ +      +  N H         + +D  
Sbjct: 170 FG-----ETALGYKSFFYFLFAASLATAAVICVLIGYPELLLNRHSYKEKFQRVYKLDVI 224

Query: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFA 325
           G  + + G IL      QG  + WN       L VS+ LLI FF++ + +A
Sbjct: 225 GCLLFISGSILLVVGLTQGG-ESWNDPTAYVPLAVSIVLLIIFFMWNLGYA 274

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 73/294 (24%), Positives = 129/294 (43%), Gaps = 36/294 (12%)

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           T  ++ +A  FN    + +W+  ++ L S +F  + G++ DI+G +  L+   LV  + +
Sbjct: 161 TTLLDHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRRPLLVFSNLVFCLGA 219

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNI--YKANTLRKNFVISFVGMC 213
           LICG +    N    +L R   G+G   +         +I   ++  L +     F G+ 
Sbjct: 220 LICGMSK---NLWVLVLGRFVAGIGGGGLTSMCSITTTDIVPLRSRALYQGICNVFFGL- 275

Query: 214 APIGAALGGVWSGLIAHENPKQWPWIFYAYA--IVVAINMVMAIYSIPSTVPTNIH-GFG 270
              G A GG+  GL A +    W   F       +++   +    ++P   P + H G G
Sbjct: 276 ---GTACGGLVGGLFA-DRAVGWRMAFLVQVPLTLLSTTAIQLFLTLPK--PVDAHKGAG 329

Query: 271 ------------MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFF 318
                       +DWTG+   VV +  F  V +   + G +  ++  L+ V + L  ++F
Sbjct: 330 QRSIPWTTKLRMVDWTGTVTLVVFLFCFTLVCS---LYGEDLPHLY-LIFVVILLSGSYF 385

Query: 319 IY-EIKFAKSPLLPPEVIKNRHIGMILLA---VFMGWGSFGIWTFYYYAFQLNL 368
           IY E+  A  P+LP   ++NR +    L+     MG  + G +   YYA  LN+
Sbjct: 386 IYHELYVATDPILPIRFLENRSVLAASLSNWFCMMGMMTTGFYIPVYYASVLNM 439

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 115/256 (44%), Gaps = 25/256 (9%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           M  +A  FN    + +W+  ++ L S +F  + G++ DI+G K  L+   +V L+  L+C
Sbjct: 103 MAHIASEFNE-LPRISWIATAYLLSSATFQPLYGKLSDIFGRKPLLMLNNIVFLVGCLMC 161

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---P 215
           G    T +    +  R   G+G   +       I +I     LR   +  + GMC     
Sbjct: 162 GL---TPSFWGLVGARFISGIGGGGVTSMCSITISDIVP---LRDRAL--YQGMCNFFFG 213

Query: 216 IGAALGGVWSGLIAHENPKQWPWIFYAY-------AIVVAINMVMAIYSIPSTVPTNIHG 268
           +G A GGV  G  + ++   W   F          ++++A+ M +   S     P +I  
Sbjct: 214 LGTACGGVVGGWFS-DHGGGWRMAFLIQVPLSALSSLLIAVFMKLPPRSKRVNSPASIKN 272

Query: 269 --FGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALLIVSVFLLIAFFI-YEIKF 324
               +DW G++  VV + LF    + G  +  +N    +AL I S  L  AFFI  E+  
Sbjct: 273 KLLSVDWIGASALVVFLSLFLVTASLGGKEIAFNSKTFVALCIGSS-LACAFFIGVELYG 331

Query: 325 AKSPLLPPEVIKNRHI 340
           AK P+LP   ++NR +
Sbjct: 332 AKDPILPLSFLRNRSV 347

>Kwal_34.15746 s34 (37757..39313) [1557 bp, 518 aa] {ON} YGR224W
           (AZR1) - MFS-MDR [contig 274] FULL
          Length = 518

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 90/464 (19%), Positives = 167/464 (35%), Gaps = 47/464 (10%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           L + +       +W + S+ +    FI   GR+GDI G          +  ++SL+C   
Sbjct: 54  LGETYKLGYTGASWALTSYAITFAGFIAFMGRLGDIVGNSVLFTISCFLFTLFSLLCAVV 113

Query: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAAL- 220
                 A F   RA QG+  A I+P    LI  + +   ++K F I   G  + IG  L 
Sbjct: 114 RDFPTFAVF---RALQGISAAGIVPCGYALIPLLAEPQDIQKFFSIVSCGFSSTIGIGLI 170

Query: 221 ------------GGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHG 268
                        G++    A          FY Y I     + + +  IP   P     
Sbjct: 171 VGGAFALTKVGYAGIFYLSFAGMLVVSIAASFYTYRIEERKFLEVKVEDIPHDHPKVAS- 229

Query: 269 FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK-- 326
             +D+ GS I V G +L      +G  + W +        + V L  +FFI+   + K  
Sbjct: 230 --LDFVGSLIFVSGSVLIVAGLTEGG-ESWRRPVAYVPFSIGVLLFCSFFIWNCYYQKMV 286

Query: 327 ---------SP--------LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLR 369
                    +P        L+P +V+   +   I+L+            +    +   + 
Sbjct: 287 SRLKAVGFNTPQYLNNVQVLVPKDVLFMPNFIPIILSFACNNACLFSVIYIIDQYSQYVE 346

Query: 370 HYSAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQS 429
             S + AG      ++   I     A+   ++ P V +         G I+L      ++
Sbjct: 347 KNSPLIAGVRLIPLIVSMVIGNTTCAIRSLQLRPKVGVVLGFLFMLCGSIILIQLHTIEN 406

Query: 430 --YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV- 486
             +WK+    QI +  G  + +P +  ++    P   +G+A  +  T   +   +   V 
Sbjct: 407 GIFWKLFFCSQISVGLGAAIFYPYALKLVVGGAPDGAKGIASGMTQTFAQFGVEVTFSVM 466

Query: 487 ----GSTAEAQVNKNGTDKLKG-YRAALYVGIGLGACGMLVAFC 525
               G+  + +   N  +  K  ++   Y  + + A G+++  C
Sbjct: 467 VSVLGNITDVKETLNSQETFKDRFQNCAYFSVAVAALGLILTLC 510

>KLLA0E24113g Chr5 complement(2148115..2149842) [1728 bp, 575 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 575

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 109/264 (41%), Gaps = 20/264 (7%)

Query: 14  ITRDHITINQEAEY--TKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQ-------- 63
           IT  +I+IN        ++D T++ E K+   +S+     +S    N+   +        
Sbjct: 35  ITASNISINPNENRLEKESDMTDISEIKDTDFDSDKSKEEQSSIVRNEKHPETAFTALEP 94

Query: 64  ----NPTYFA-NRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMA 118
               NP Y A + +Q  + +   +                + IL   FN+S       +A
Sbjct: 95  EIAYNPPYSAFSNYQVVSILLIIIYIGFLGPVTGNIYIPALPILQSEFNTSTTAINGTVA 154

Query: 119 SFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQG 178
           +F  V      +     D  G K   I   ++ LI +++   A   H  A +IL R FQ 
Sbjct: 155 AFMGVFAVGPFLWAVHADFGGRKFLYIFSLMIALIANVLLA-AVPKHLAALYIL-RVFQA 212

Query: 179 LGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW 238
           +G + ++P  +G + ++       K   +S+  +   +G  LG ++ GLI   N  QW W
Sbjct: 213 IGTSAVIPLGVGTVSDLISPMNRAKG--VSYFMLGPNMGPILGPIFGGLILM-NGNQWRW 269

Query: 239 IFYAYAIVVAINMVMAIYSIPSTV 262
           +F   +I   + +++ +  +P T+
Sbjct: 270 LFGFTSITTGVGLILIVTFLPETL 293

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKF 324
            I  FG+   G A  ++ +    + + +G   GWN   +IA+ +V   LLI++ ++E+ F
Sbjct: 300 EIDAFGLILLGFAFSLILLPCSLYSYAEG---GWNNPSMIAMEVVGGILLISYVVFEVFF 356

Query: 325 AKSPLLPPEVIKNRHI--GMILLAVFMGWGSFGIWTFYYYAF-QLNLRHYSAVWAGGTF- 380
           A  PLLP  V+ NR     +I+  ++   G F +  F  Y F  LNL +   V+   T  
Sbjct: 357 APFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTT 416

Query: 381 ----FMFVIWGTI 389
               F  V+WG +
Sbjct: 417 MGLCFFGVVWGAL 429

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 96/220 (43%), Gaps = 20/220 (9%)

Query: 279 GVVGMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKN 337
            + GMIL  F    G    W+   II   ++   F L  F ++EIKFA+ PL P + +KN
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 338 RHIGMILLAVFMGWGSFGIWTFYYYAFQL---NLRHYSAVWAGGTF-FMFVIWGTIAAFL 393
           R I   L+ V     ++ + + Y Y   L   +    SA      F F+ VI G ++ F+
Sbjct: 342 RGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFV 401

Query: 394 VALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMD-LSFPAS 452
           VA  ++R    +     +   + G +M+  T    S+  + +  + IL FG   L FPA 
Sbjct: 402 VA-KVRRTKEFIFFGIGVWFISFG-LMIRYTGGLDSHVGIIVA-RCILGFGNGFLKFPAR 458

Query: 453 SIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGSTAEA 492
           + I            A +  + M+   TSL L V S   A
Sbjct: 459 ASI-----------QASAYSHEMMAVMTSLFLAVSSIGSA 487

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 65/133 (48%), Gaps = 11/133 (8%)

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKF 324
            I  FG+   G A  ++ +    + + +G   GWN   +IA+ +V    LI++ ++E+ F
Sbjct: 300 EIDAFGLILLGFAFSLILLPCSLYSYAEG---GWNNPSMIAMEVVGGIFLISYVVFEVFF 356

Query: 325 AKSPLLPPEVIKNRHI--GMILLAVFMGWGSFGIWTFYYYAF-QLNLRHYSAVWAGGTF- 380
           A  PLLP  V+ NR     +I+  ++   G F +  F  Y F  LNL + + V+   T  
Sbjct: 357 APFPLLPKRVLMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTT 416

Query: 381 ----FMFVIWGTI 389
               F  V+WG +
Sbjct: 417 MGLCFFGVVWGAL 429

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 68/154 (44%), Gaps = 25/154 (16%)

Query: 221 GGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAI--YSIPSTV--------PTNIHGFG 270
           G + S +  H  P  W W +  + I+V  + +M +  Y+    +        P  +   G
Sbjct: 204 GNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPYAYAQYIGWRNGTLPPYKLREKG 263

Query: 271 MDWTGS------AIGVVGMILFN---------FVWNQGPIDGWNKGYIIALLIVSVFLLI 315
            +   +       I ++G+ILF+              G    W +GYIIA+++V   L  
Sbjct: 264 QNLRQTLWKIVEDINLIGVILFSAFLVLLLLPLTIAGGATSKWREGYIIAMIVVGGCLGF 323

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFM 349
            F I+E++FAK+P +P   + +  I + LL  F+
Sbjct: 324 IFLIWELRFAKNPFIPRVYLGDPTIYVALLMEFV 357

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 114/254 (44%), Gaps = 27/254 (10%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           +A  FN  +K  +W+  S+ L S +F  + G++ DI+G K  L+   +  LI  L+CG +
Sbjct: 138 VASEFNQLSK-VSWIATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLS 196

Query: 162 NYTHNDAF--FILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---PI 216
                 +F   ++ R   G+G   +    M  I  I     LR+  +  + G+C     +
Sbjct: 197 K-----SFWWLVIARFVAGVGGGGL--TSMSSI-TITDLVPLRERAM--YQGICNVFYGL 246

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAI--YSIPSTVPTNIHG------ 268
           G A GG+  G  + +N   W   F     + AI++++ I    +PS   T          
Sbjct: 247 GTACGGIVGGWFS-DNKGGWRMAFLIQVPLSAISLLVIILHLKLPSKRATRNQDNSIKRK 305

Query: 269 -FGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAK 326
              +DW G++  V+ ++LF    + G  +        AL+++S  L    FIY E++ A 
Sbjct: 306 LLAIDWLGASTLVIFLVLFLLTASLGGKEIAYGSRTFALMLISSLLSCLVFIYVELRVAA 365

Query: 327 SPLLPPEVIKNRHI 340
            P+LP   +  R +
Sbjct: 366 DPILPLRFLAIRSV 379

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 56/126 (44%), Gaps = 12/126 (9%)

Query: 402 GPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLP 461
           G   LL F+   F +GC+M  ++   +S+W + +   +    G  L+   SSI ++D +P
Sbjct: 174 GRKCLLVFTNVAFLIGCLMCGLS---KSFWWLVIARFVAGVGGGGLT-SMSSITITDLVP 229

Query: 462 SQYQGMAGSLVNTMVNYSTSLCLGVGSTAEAQVNKNGTDKLKGYRAALYVGIGLGACGML 521
            + + M   + N           G+G+     V    +D   G+R A  + + L A  +L
Sbjct: 230 LRERAMYQGICNVFY--------GLGTACGGIVGGWFSDNKGGWRMAFLIQVPLSAISLL 281

Query: 522 VAFCYL 527
           V   +L
Sbjct: 282 VIILHL 287

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 64/266 (24%), Positives = 109/266 (40%), Gaps = 45/266 (16%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           +A  FN    + +W+  ++ L S +F  + G+I DI+G K  LI   +   + SLICG  
Sbjct: 148 IASEFNE-LPRISWVATAYLLSSATFQPIYGKISDIFGRKVVLIFCNITFFVGSLICG-- 204

Query: 162 NYTHNDAFFILCRAFQ----GLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA--- 214
                     L  +F+    G  IA I    +  + +I  ++ +       + G+C    
Sbjct: 205 ----------LSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRNRALYQGICNFYF 254

Query: 215 PIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGM--- 271
            +G ALGGV  G  + +    W   F     +   + ++ I  +   +P    G G+   
Sbjct: 255 GLGTALGGVVGGWFS-DRSVGWRMSFLIQLPIAFFSTILIILFL--RLPKESKGRGLQVD 311

Query: 272 --------------DWTGSAIGVVGMILFNFVWNQ---GPIDGWNKGYIIALLIVSVFLL 314
                         DW G+   V  + LF+F+      G    +     I L +V+V   
Sbjct: 312 GNYFSTIKVRLSAVDWIGATTLV--LFLFSFMITASLGGKEIPYTSHKFIGLCVVTVIGA 369

Query: 315 IAFFIYEIKFAKSPLLPPEVIKNRHI 340
           + F   E+K AK P+LP   +K+R +
Sbjct: 370 LIFGYTELKIAKDPILPLRFLKDRSV 395

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 283 MILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGM 342
           ++L       G    W +GYIIA+++V  FL   F I+E++FAK+P +P   + +  I +
Sbjct: 287 LVLLPLTIAGGATSKWREGYIIAMIVVGGFLGFIFLIWELRFAKNPFIPRVYLGDPTIYV 346

Query: 343 ILLAVFM 349
            LL  F+
Sbjct: 347 ALLMEFV 353

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 46/82 (56%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G+IL       G  + W++  IIA L++ + LL+ F  +E KFAK+  LP  ++K+R +
Sbjct: 289 LGLILVPLTLAGGVSERWHEPGIIATLVIGIALLLVFLFWEAKFAKNAALPFNLLKDRGV 348

Query: 341 GMILLAVFMGWGSFGIWTFYYY 362
              ++A F+    + + + Y Y
Sbjct: 349 WASIVAAFLEKMIYAMISDYLY 370

>KLTH0H16214g Chr8 complement(1398230..1399885) [1656 bp, 551 aa]
           {ON} conserved hypothetical protein
          Length = 551

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 86/459 (18%), Positives = 168/459 (36%), Gaps = 43/459 (9%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTL-IGGYLVVLIWSLICGF 160
           L + +       +W + S+ +     I   GR+GDI G      I G+     +SL C  
Sbjct: 58  LGETYGLEYTTASWALTSYAITFAGLIAFMGRLGDIIGNSVLFTISGFF----FSLFCLL 113

Query: 161 ANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAAL 220
                N   F + RA QG+  A ++P    LI  +     ++  F +   G  + IG  L
Sbjct: 114 CAVVTNFPAFAVLRALQGIAAAGLVPCGYALIPTLADPEDVQLFFAVVSCGFSSTIGIGL 173

Query: 221 GGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPS------TVPTNIHGFG---- 270
               +  + +   K   ++ +A  ++V+I      Y I            +IH  G    
Sbjct: 174 IIGGAFALTNVGYKGIFYLSFAGMLLVSIAAFFFTYRIEEHKFAEQDYEGSIHRPGKVAS 233

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK---- 326
           +D+ GS I + G +L      +G  + W +        + +     FF +   +      
Sbjct: 234 LDFVGSLIFISGSVLIVVGLTEGG-ESWKRPVAYVPFTIGMIFFCGFFAWNCSYQNLVIF 292

Query: 327 ---------------SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHY 371
                            L+P +V+   +   I L      G      +    +   +   
Sbjct: 293 LKKLGCDTSRYLEKVQVLIPRDVLFMTNFIPITLGFLCNGGCLYSNIYIIDQYSQYVDKN 352

Query: 372 SAVWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIML-SVTPVHQS- 429
           S + AG      +I   I   + A    ++ P + +         G I+L  +  V ++ 
Sbjct: 353 SPLLAGVKLVPLIITMVIGNTICASKSVKLRPRIGVALGFLSMVCGSIILIQLHLVEENL 412

Query: 430 YWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV--- 486
           YWK+    QI++ FG  + +P +  ++    PS  +G+A  +  T       +   V   
Sbjct: 413 YWKIMFCSQILVGFGAAIFYPYALKLVVGDAPSGAKGIASGVTQTFAQLGIEMTFSVMVS 472

Query: 487 --GSTAEAQVNKNGTDKLK-GYRAALYVGIGLGACGMLV 522
             G+  + +   +  ++ + G++   Y  +  GA G+++
Sbjct: 473 VLGNITQVKSRPDSFERFRDGFQKCTYFTLASGAFGLVL 511

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 72/154 (46%), Gaps = 19/154 (12%)

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKF 324
            I  FG+   G A  ++ +    + + +G   GW    +IA+ ++    LI++ I+E+ F
Sbjct: 301 EIDAFGLILLGFAFSLILLPCSLYSYAEG---GWKNPSMIAMEVIGGIFLISYVIFEVFF 357

Query: 325 AKSPLLPPEVIKNRHI--GMILLAVFMGWGSFGIWTFYYYAF-QLNLRHYSAVWAGGTF- 380
           A  PLLP  V+ NR     +++  ++   G F +  F  Y F  LNL + + V+   T  
Sbjct: 358 APFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTT 417

Query: 381 ----FMFVIWGTIAAF--------LVALTIKRVG 402
               F  V+WG +  +        +V + IK +G
Sbjct: 418 MGLCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIG 451

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 93/238 (39%), Gaps = 38/238 (15%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCR 174
           WL+  + L +  F L+ GR+  I GLK +L    ++  I SLI   +N   +    I  R
Sbjct: 46  WLVTGYALPNALFTLLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSN---SMGMIIGGR 102

Query: 175 AFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPK 234
              G G + I   V  +  ++ +     +  VI+ +G+   +  A+G V  G  A     
Sbjct: 103 VVAGCGGSGIQSLVFVVGTSLVEER--NRGMVITVLGLAFAVAFAVGPVIGG--AFTENV 158

Query: 235 QWPWIFYAYAIVVAINMVMAIYSIPSTVPT------------------------------ 264
            W W FY    +  + + M  +S  +T  +                              
Sbjct: 159 SWRWCFYINLPIGGVALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAY 218

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWN-QGPIDGWNKGYIIALLIVSVFLLIAFFIYE 321
           N   F +D+ G A+   G +LF       G    WN G II+ L V   L++ + +++
Sbjct: 219 NFLMFDLDFIGFALSSTGFVLFMLGLTFGGNTYAWNSGTIISFLTVGAILVLFWLVFD 276

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 46/98 (46%), Gaps = 12/98 (12%)

Query: 271 MDWTGSAIGVV--GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSP 328
           +D  G+ I  V  G IL       G    W+   II  L++ V LL    +YE+K+A+ P
Sbjct: 310 LDTIGTFIMTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLGVVLLPMLIVYELKWAREP 369

Query: 329 LLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           +LP ++IK+R +          W S  I   Y + F +
Sbjct: 370 ILPWKLIKDRAV----------WASMSISFLYDFIFYM 397

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 6/74 (8%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    IGV+      G IL       G    WN G IIA   +   L+  F  +E KF+K
Sbjct: 325 WRLDVIGVLLMGASLGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLIPIFTFWEWKFSK 384

Query: 327 SPLLPPEVIKNRHI 340
           SPL+P +++K+R +
Sbjct: 385 SPLIPSKLVKDRAV 398

>TDEL0C04580 Chr3 (829514..831187) [1674 bp, 557 aa] {ON} Anc_2.241
           YIL121W
          Length = 557

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 48/250 (19%), Positives = 102/250 (40%), Gaps = 14/250 (5%)

Query: 20  TINQEAEYTKNDQTNV--EEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFA-NRWQEYA 76
           T  ++   +K+++ ++  + +  CS + E   C+ ++    +  + +P Y    R +++ 
Sbjct: 12  TPTEKDTESKHERLSLPGDNESMCSIDVEQSSCTRTKSARLEPHYTSPPYSRFGRREKFL 71

Query: 77  FISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGD 136
            +  C                 + ++ D F+ S +K    +  + +  G    + G + D
Sbjct: 72  LVVQCAFTGFFSTIAAAIYYPVLTVIEDLFDISEEKVNITVVVYFIFQGISPTLMGGLAD 131

Query: 137 IYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIY 196
             G +  +I   L VL++   C     + + A  I  R  Q  GI+ ++    G++G++ 
Sbjct: 132 YLGRRPIVI---LSVLVYFSACVGLACSQSYAQIIALRCLQAAGISPVIAINSGIMGDV- 187

Query: 197 KANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW--IFYAYAIVVAINMVMA 254
                 +   + +V  C  +G+A G     LI      +W W  IF+  AI     +V  
Sbjct: 188 -TTRAERGGYVGYVSGCQVVGSAFG----ALIGAGLSSRWGWRSIFWFLAIGSGACLVAT 242

Query: 255 IYSIPSTVPT 264
           +  +P T  T
Sbjct: 243 VLFLPETKRT 252

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 66/274 (24%), Positives = 112/274 (40%), Gaps = 29/274 (10%)

Query: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171
           K  W+  S+ L S  F  + G++ DI+G K  LI   L+     +ICG +N  +     +
Sbjct: 433 KVPWVATSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLN---MLV 489

Query: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---PIGAALGGVWSGLI 228
             R   G+G   I       + +I     LR   V  + G+C     +G A GGV  G+ 
Sbjct: 490 WGRFVAGIGGGGITSMTTITVSDIVP---LRSRAV--YQGICNFFFGLGTAFGGVIGGIF 544

Query: 229 AHENPKQWPWIFYAYAIVVAIN--MVMAIYSIPS----TVPTNIHGFGMDWTGSAIGVVG 282
             ++   W  +F++   V  ++  ++ +   +P      V        +DW GS   ++ 
Sbjct: 545 V-DHQYGWRMVFWSQVPVSGLSTLLICSFLVVPRIKNYEVSLGRKLMRVDWLGSISMILW 603

Query: 283 MILFNFVWNQG-----PIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKN 337
           +  F  +          ID     Y+I    VS    I F + E+  A  P+LP   + N
Sbjct: 604 LTSFLLITTMMGGISLDIDSDQFHYLIMFSSVSA---IIFVLTELFVASDPVLPLRFLSN 660

Query: 338 RHIGMILLAVF---MGWGSFGIWTFYYYAFQLNL 368
           R +    L  F   MG+ +   +   Y+A  L++
Sbjct: 661 RSVLGASLGNFFCVMGFMTICFYLPIYFASVLDI 694

>NDAI0D01020 Chr4 complement(229357..231135) [1779 bp, 592 aa] {ON} 
          Length = 592

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 77/170 (45%), Gaps = 15/170 (8%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           +  L   FN    K    +  + L  G    VSG + D++G +  ++GG ++ ++ S+  
Sbjct: 125 LRQLEKEFNMDENKVNVTVVVYLLFQGIAPTVSGGLADVFGRRPIILGGMVIYVVASIGL 184

Query: 159 GFANYTHNDAFFILC--RAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216
             A      ++ ++C  R  Q +GI+  +    G++G+ +     R  FV +  G+    
Sbjct: 185 ACA-----PSYGVICFLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGL---- 234

Query: 217 GAALGGVWSGLIAHENPKQWPW--IFYAYAIVVAINMVMAIYSIPSTVPT 264
              LG  +  LI      +W W  IF+  AI   + +++A +++P T  T
Sbjct: 235 -VLLGQCFGSLIGAVLTARWDWRAIFWFLAIGSGVALIVAAFTLPETKRT 283

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 84/400 (21%), Positives = 157/400 (39%), Gaps = 36/400 (9%)

Query: 106 FNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTH 165
           FNS   K +W+  S+ L S +   + G++ D  G K  L+    V  I  LICG +N   
Sbjct: 117 FNS-LDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIW 175

Query: 166 NDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---PIGAALGG 222
                       G G+  +   +M  +        LR   V  + G+C     +G A GG
Sbjct: 176 AVVAGRFISGIGGCGLTSLATMIMSDL------VPLRDRAV--YQGLCNFVFGLGTASGG 227

Query: 223 VWSGLIAHENPKQWPWIFY---AYAIVVAINMVMAIYSIPSTVPTNIHGFG-----MDWT 274
           +          + W   F      +++  I +V+ +   P    +N   +      +DW 
Sbjct: 228 LVGAYF-----RDWRLAFILQCPISVLSGILIVVYLELPPRASASNKDCWSARLRRLDWA 282

Query: 275 GSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAKSPLLPPE 333
           G+   +  + LF    + G         + A +  +  +  A F+Y E++ A  P+LP  
Sbjct: 283 GATSLIAFLFLFMLTSSMGGSSVAYGSRLFAAMCAATLVFGAVFVYVELRVAADPVLPVT 342

Query: 334 VIKNRHIGMILLAVFMGWGSFGIWTFY---YYAFQLNLRHYSAVWAGGTFFMFVIWGTIA 390
            +++R +    LA +    S     FY   Y++  L ++           F  V +G++ 
Sbjct: 343 FLRDRSVLGSSLANWFCMMSMMTTNFYLPVYWSSVLGMKATDVGKRAMPSFFSVAFGSLG 402

Query: 391 AFLVALTIKRVGP--SVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLS 448
           A    L +KR G     LL F +        ++ +TP     W+  L +Q++  FG+ + 
Sbjct: 403 A---GLYMKRTGKYYYFLLAFCVLAIAGQVQIVLITP-QMPVWRQYL-LQVVPGFGVSVL 457

Query: 449 FPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGS 488
              + + +   +P ++     S+     +   +L + VG+
Sbjct: 458 ITVTLLAMIAAVPHEHHAATTSISYAFRSTGATLGVSVGA 497

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 87/416 (20%), Positives = 149/416 (35%), Gaps = 72/416 (17%)

Query: 37  EKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXT 96
           E+KN S      + S++E   N +  +           Y  +++                
Sbjct: 3   EEKNSSQAEVKAYDSDTELNVNSSDERGGISL------YLCLTSLTLVLFITALDILIVG 56

Query: 97  APMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSL 156
             ++++A+ F + +K   WL+  + L +    LV GR   I G + +LI   L+    SL
Sbjct: 57  TIIDVVAEQFGNYSKTG-WLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSL 115

Query: 157 ICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI 216
           +   AN  +     ++            L  +  +IG     N   +  VIS +     +
Sbjct: 116 VAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIG-CTMVNERSRPLVISILSCAFAV 170

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIV--VAINMVMAIYSIPS-------------- 260
            A +G +  G  A      W W FY    +   A+ M +  Y   S              
Sbjct: 171 AAIVGPIIGG--AFTTHVTWRWCFYINLPIGGFAVIMFLLTYKTKSENILQQTRNILGRI 228

Query: 261 --------TVPTNIHG------FGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIA 305
                   T P N+        F  D+ G A+   G++LF      G     WN G II 
Sbjct: 229 SKFELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTFGGNKYSWNSGQIIT 288

Query: 306 LLIVSVFLLI-----AFFIYEIKFAKSP-------------LLPPEVIKNRHIGMILLAV 347
            L++ + L +      FFI++ KF   P             +  P VI    + M+   +
Sbjct: 289 YLVLGILLFVFSLIYDFFIFQ-KFNPEPDNTSYRPLFLKRLVAKPAVII---VNMVTFLL 344

Query: 348 FMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFM-FVIWGTIAAFLVALTIKRVG 402
            +G+    I++  ++     L   S+ W  G   +  VI   IAA    +  K++G
Sbjct: 345 CIGYNGQMIYSVQFF----QLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLG 396

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 16/90 (17%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    IGV+      G IL       G    W    II + ++   L+  FFI+E KFA 
Sbjct: 280 WKIDIIGVLLMAASLGCILVPLTLAGGTSSKWRDSRIIGVFVLGFVLIPIFFIWEKKFAT 339

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
            P++P +++K+R +          W S GI
Sbjct: 340 DPIVPYKLVKDRGV----------WASLGI 359

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 44/81 (54%), Gaps = 2/81 (2%)

Query: 271 MDWTGSAIGVV--GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSP 328
           +D  G+++  V  G IL       G  D WNK  IIA ++V     + F  ++IKFAK+ 
Sbjct: 291 IDVVGTSLVTVSLGCILVPLTLAGGISDDWNKPGIIATIVVGFVSFMFFLAWDIKFAKNA 350

Query: 329 LLPPEVIKNRHIGMILLAVFM 349
           +LP +++K+R +   L A  +
Sbjct: 351 VLPFKLLKDRGVWASLAAALL 371

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 65/143 (45%), Gaps = 8/143 (5%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           +N +AD FN+ +K   WL+  + L +  F L+ GR   I+G K TL+   ++  I SL+ 
Sbjct: 44  LNTIADKFNAYSKIG-WLITGYSLSNALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVI 102

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
             +N        I  R   G G + I   V  +  ++   +T  +  +++ + +   + +
Sbjct: 103 AVSNSMD---MIIGGRVIAGCGASGIQTLVFAIATSLVDEHT--RGTIVTLLSLSYAVAS 157

Query: 219 ALGGVWSGLIAHENPKQWPWIFY 241
           ALG    G  A      W W FY
Sbjct: 158 ALGPYIGG--ALTEYVTWRWCFY 178

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 103/253 (40%), Gaps = 38/253 (15%)

Query: 260 STVPTNIHGF---------GMDWTGSAIGVV--GMILFNFVWNQGPIDGWNKGYIIALLI 308
           ST+P N+             +D  G  +GV+    +L  F       D W    II   +
Sbjct: 252 STIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIVPEV 311

Query: 309 VSVFLLIAFFIY-EIKFAKSPLLPPEVIKNRHI-GMILLAVFMGWGSFGIWTFYYYAFQL 366
           +   + +  +I+ E KFAK PL P  ++K+R + G +L+A+F+ +  + + + Y Y   L
Sbjct: 312 IGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYY-VQSTYKYTVLL 370

Query: 367 NLRHYSAVWAGGTFFMFVIWGTIAAFL----VALTIKRVGPSVLLCFSMTGFTVGCIMLS 422
                + + A  T  MF   G I A L    VA  ++R    +    SM   + G +   
Sbjct: 371 VSFDTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLYRY 430

Query: 423 VTPVHQSYWKMNLGMQI---ILSFGMD-LSFPASSIILSDFLPSQYQGMAGSLVNTMVNY 478
               H       +G  +   +L FG   L FPA + I            A +  +  +  
Sbjct: 431 RIGAHA-----KVGTIVACCLLGFGNGFLKFPARASI-----------QAAAYTHKNLAI 474

Query: 479 STSLCLGVGSTAE 491
            TSL L +GS  E
Sbjct: 475 ITSLFLALGSIGE 487

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 47/103 (45%), Gaps = 6/103 (5%)

Query: 270 GMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIK 323
            M W    +GV+      G+IL       G    W++G +IA  ++   ++  F I+E  
Sbjct: 323 DMFWRFDVVGVILLAAFIGLILIPLTLAGGTKSRWSEGKLIAPFVIGCVMVPCFAIWEKW 382

Query: 324 FAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           FAK P++P  +IK+R I   L    +    F +   Y Y+  L
Sbjct: 383 FAKHPIMPWRLIKDRSIWAALTLSLVYKFVFAVAQDYMYSLLL 425

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 92/408 (22%), Positives = 170/408 (41%), Gaps = 38/408 (9%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           +  +   FNS   K +W+  S+ L S +   + G++ D  G K  L+   +V  I  LIC
Sbjct: 106 LTRIGSEFNS-LDKVSWIATSYLLSSSTCQPLYGKLSDQLGRKPLLVFSNVVFSIGCLIC 164

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPI-- 216
           G +    +  + ++ R   G+G   +      +I ++     LR+  V  + G+C  I  
Sbjct: 165 GMST---SIWWVVVGRFVSGIGGCGLTCLASMVISDLVP---LRERAV--YQGLCNFIFG 216

Query: 217 -GAALGGVWSGLIAHENPK-----QWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG 270
            G A GG+     A ++ +     Q P    + A++V+   +   +              
Sbjct: 217 LGTASGGLVGA--AFQDWRMAFTIQCPISLASCALIVSYLELPPRHEDDKDRHWTSKLRD 274

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAKSPL 329
           +DW G    V  + LF  V + G  +      + ALL V+  +L + F Y E+  A  P+
Sbjct: 275 LDWAGVVTLVCFLFLFMLVSSLGGKEIAYDSVLFALLCVTTLVLGSIFAYVELYVAVDPV 334

Query: 330 LPPEVIKNRHIGMILLAVFMGWGSFGIWTFY---YYAFQLNLRHYSAVWAGGTFFMFVIW 386
           LP   +K R +    LA +    S     +Y   Y+A  LN++           F  V +
Sbjct: 335 LPIAFLKYRSVLGSSLANWFAMMSMLTTNYYLPVYWASVLNMKPTDIGKRSIPSFFSVAF 394

Query: 387 GTIAAFLVALTIKRVGPS--VLLCFSMTGFTVGCIMLSV----TPVHQSYWKMNLGMQII 440
           G++ A    + +KR G     LL F   G  +G + +++    TPV Q Y      + ++
Sbjct: 395 GSLGA---GIYMKRTGKYYWFLLAFCGIGI-LGQLKINLLTPATPVWQQYL-----LLVV 445

Query: 441 LSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGVGS 488
            SFG+ +    + + +   +P ++     S+     +   +L + +G+
Sbjct: 446 PSFGLSVLITVTLLAMISAVPHEHHAATTSISYAFRSTGATLGVSIGA 493

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 68/159 (42%), Gaps = 35/159 (22%)

Query: 221 GGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIY-------------SIP-------- 259
           G + S +  +  P +W W +  + I+V I+ ++ +               +P        
Sbjct: 205 GNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYAQYISWRSGKLPPLKLKEKG 264

Query: 260 STVPTNIHGFGMDWTGSAIGVVGMILFN---------FVWNQGPIDGWNKGYIIALLIVS 310
            T+   +  F  D     I ++G+ILF               G    W +G+IIA+++V 
Sbjct: 265 QTLRQTLWKFADD-----INLIGVILFTAFLVLVLLPLTIAGGATSKWREGHIIAMIVVG 319

Query: 311 VFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFM 349
             L   F I+E+KFAK+P +P   + +  I + LL  F+
Sbjct: 320 GCLGFIFLIWELKFAKNPFIPRVYLGDPTIYVALLMEFV 358

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 6/134 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G IL  F    G  D W   +II   ++     L  F ++EIKF+K PL P  +IK+R I
Sbjct: 300 GCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGI 359

Query: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              L+  F     W   G + +      +N    SA      + F+ VI GT+   LV +
Sbjct: 360 FFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG-LVII 418

Query: 397 TIKRVGPSVLLCFS 410
            ++R  P ++   S
Sbjct: 419 KVRRTKPFIIFGVS 432

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 41/90 (45%), Gaps = 16/90 (17%)

Query: 273 WTGSAIGV------VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W   A+GV      +G IL       G    WN  ++I   ++   L+    ++E KFA+
Sbjct: 304 WKIDAMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLIPILVLWEYKFAR 363

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
            P++P +++K+R +          W SF I
Sbjct: 364 DPIIPYKLVKDRGV----------WASFAI 383

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 42/143 (29%), Positives = 65/143 (45%), Gaps = 10/143 (6%)

Query: 100 NILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICG 159
           + +   FN  A    WLMA + L +  F+L+ GRI  + GLK +L+   ++    SL+ G
Sbjct: 32  DTIGQEFNDYANVG-WLMAGYNLPNALFMLLWGRIASLVGLKCSLMASIVIFEAGSLMAG 90

Query: 160 FANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAA 219
            AN   +    I  R   G G + I   V G+  +I +     +  VI+ +G+   +   
Sbjct: 91  AAN---SMGMLIGARVISGFGGSGIESLVYGVGTSIVEEK--HRARVITVLGIAYMLAEG 145

Query: 220 LGG-VWSGLIAHENPKQWPWIFY 241
            G  V  GL  H +   W W FY
Sbjct: 146 AGPFVGGGLAEHVS---WRWCFY 165

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 59/134 (44%), Gaps = 6/134 (4%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIK 336
           +G +G +L  F    G  D W    II   ++     L  F ++E KFA+ PL P  V+K
Sbjct: 277 VGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVLK 336

Query: 337 NRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGG--TFFMFV--IWGTIAAF 392
           +R +   L+  F       +   Y Y   +   H S   A    T F FV  I GT+  F
Sbjct: 337 DRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLLGF 396

Query: 393 LVALTIKRVGPSVL 406
           ++ + +KR    +L
Sbjct: 397 VI-VYVKRTKKFIL 409

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 67/271 (24%), Positives = 110/271 (40%), Gaps = 34/271 (12%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           MN +A+ F  S KKQ W+  SF L + +F  + G++ DI G +  L+  +    +  L+ 
Sbjct: 57  MNRVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLT 115

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
            FA        F L RA  G+G   I       + +I  A    +     +  +    G 
Sbjct: 116 CFAQSVEQ---FALARAICGIGGGGINACSSIAVSDICTAK--ERGSYQGYANIVFGTGQ 170

Query: 219 ALGGVWSGLIAHENPKQWPWIFYAYAIVVAI-------NMVMAIYSIPSTVPT----NIH 267
            LGG   GL+   +   W  IF     ++         N+ + +  IP         N+ 
Sbjct: 171 MLGGPIGGLLI--DTIGWRAIFAVQVPIIMFCSFLTYKNITIKLSHIPPVSERFTWMNLS 228

Query: 268 GFGMDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY---EIKF 324
              +  + S + V+  ILF    N      WNK      +I+S F ++ F  +   E  F
Sbjct: 229 RIDIMGSSSLVVVICGILFICSTN------WNK------VILSTFTIVGFLFFIVTETYF 276

Query: 325 AKSPLLPPEVIKNRHIGMILLAVFMGWGSFG 355
           AK  +LP +++K       L+ V   + +FG
Sbjct: 277 AKECILPLKLLKGASGLCSLVTVLSSFITFG 307

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 42/100 (42%), Gaps = 16/100 (16%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    IG+V      G IL       G  + W    II  L+    L + F  +E  +A 
Sbjct: 137 WELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFLIFMFWEASYAH 196

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           +PLLP +++K+R I          W   G+  F Y+ F +
Sbjct: 197 NPLLPFKLLKDRGI----------WAPLGVAFFNYFTFYI 226

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 64/134 (47%), Gaps = 6/134 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G +L  F    G  + W   +II   ++  V +L  + ++E+K+++ PL P ++IK+R I
Sbjct: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGI 355

Query: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              LL  F     W   G + +      ++    SA      + F+ VI GTI  F++ +
Sbjct: 356 FFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFIL-I 414

Query: 397 TIKRVGPSVLLCFS 410
            ++R  P ++   S
Sbjct: 415 KVRRTKPFIIFGIS 428

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 2/133 (1%)

Query: 12  KTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANR 71
           K+I   ++   +E +  KN+  N  +     +       S +    N+ P  +P    N 
Sbjct: 2   KSIDNSNVNNTEETQLLKNNAVNNSDTSLAKSGGYNSIVSGASSDSNNKPKLDPITKYNL 61

Query: 72  WQEYAFISTCMXXXXXXXXXXXXXTAP-MNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
                 I T +              A  MN +A+ FN+S +KQ W+  S+ L + +F  +
Sbjct: 62  SLSKGPILTSLWLGSFLSALDATIVAVIMNRVAEDFNASNQKQ-WIATSYLLTNTAFQPL 120

Query: 131 SGRIGDIYGLKKT 143
            GR+ DI G K T
Sbjct: 121 YGRLSDIIGRKYT 133

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 59/249 (23%), Positives = 104/249 (41%), Gaps = 28/249 (11%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           MN +A+ F  S KKQ W+  SF L + +F  + G++ DI G K  ++  +     + L C
Sbjct: 64  MNKVAEEFEESDKKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHF---FFGLGC 119

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
               +  N   F + RA  G+G   +  N M  I      +T  +     +  +   +G 
Sbjct: 120 FLTCFAQNITQFSIARAICGIGAGGV--NAMSSITVSDICSTRERGIYQGYANIVFGLGQ 177

Query: 219 ALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIP---STVPTNIHGF------ 269
            LG    GL    +   W  IF     ++ +   +A  +I    + +P     F      
Sbjct: 178 LLGAPLGGLFI--DSVGWRVIFGVQVPMLLLCSTLATRNINVKLAHIPPRKERFTWKNLS 235

Query: 270 GMDWTGSA--IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKS 327
            +D  GS   +G +  +LF        I       ++ L +++ F+L  F   E+ +AK 
Sbjct: 236 RIDIFGSLALVGTISSLLFLTSTTLNKI-------VLTLSMIASFIL--FIWIELYYAKE 286

Query: 328 PLLPPEVIK 336
            +LP +++K
Sbjct: 287 RILPFDLLK 295

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFF-IYEIKFAKSPLLPPEVIKNRH 339
           +G IL       G    WN G +I   I+  F+LI FF ++E  FA+ PLLP +++K+R 
Sbjct: 302 LGCILVPLTLAGGTSSKWNHGNVIGPFILG-FVLIPFFALWEKFFARDPLLPAKLVKDRG 360

Query: 340 I 340
           +
Sbjct: 361 V 361

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 63/134 (47%), Gaps = 6/134 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G +L  F    G  + W   +II   ++  V  L  + ++E+K+++ PL P ++IK+R I
Sbjct: 296 GCVLVPFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGI 355

Query: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              LL  F     W   G + +      ++    SA      + F+ VI GTI  F++ +
Sbjct: 356 FFALLIAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFIL-I 414

Query: 397 TIKRVGPSVLLCFS 410
            ++R  P +L   S
Sbjct: 415 KVRRTKPFILFGIS 428

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 62/134 (46%), Gaps = 6/134 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G +L  F    G  + W   +II   ++  V  L  + ++E+K+++ PL P ++IK+R +
Sbjct: 296 GCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGV 355

Query: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              L   F     W   G + +      ++    SA      + F+ VI GTI  F++ +
Sbjct: 356 LFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFIL-I 414

Query: 397 TIKRVGPSVLLCFS 410
            ++R  P +L   S
Sbjct: 415 KVRRTKPFILFGIS 428

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 66/315 (20%), Positives = 115/315 (36%), Gaps = 46/315 (14%)

Query: 44  ESEAEWCSESEFTDNDTPWQNPTYFANR-----WQEYAFISTCMXXXXXXXXXXXXXTAP 98
            S  E C+++E + ++   QN    +       +  YA + +               +  
Sbjct: 7   NSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGSLTLALFLSALDILIVSTI 66

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           +  ++  FN  +K   WL+  + L +    LV GR   I G K +++   ++  + SL+ 
Sbjct: 67  IETVSRDFNEYSKSG-WLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSIIIFEVGSLVS 125

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
             AN  +     I  R   G+G + +      +I  +   N   +   IS +     + +
Sbjct: 126 ALANSMN---MLIGGRVISGVGGSGLQTLCFLIISTL--VNERSRGMAISVLSCSFAVAS 180

Query: 219 ALGGVWSGLIAHENPKQWPWIFY------AYAIVVAI------------NMVMAIYSIPS 260
            +G    G  A      W W FY        A +V +            N   A+ SI  
Sbjct: 181 IVGPFLGG--AFTTHVTWRWCFYINLPIGGLAFLVFVLSYNPNGGNSIKNFTKAVRSISH 238

Query: 261 TVPTNIHG------------FGMDWTGSAIGVVG--MILFNFVWNQGPIDGWNKGYIIAL 306
                +              F  D+ G A+   G  +IL    +  G    W  G IIA 
Sbjct: 239 VDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGFCLILLGLTFG-GNEYSWGSGTIIAY 297

Query: 307 LIVSVFLLIAFFIYE 321
           L++ + L IAFF+Y+
Sbjct: 298 LVIGIVLSIAFFLYD 312

>Smik_2.434 Chr2 (773094..774518) [1425 bp, 474 aa] {ON} YBR293W
           (REAL)
          Length = 474

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 110/269 (40%), Gaps = 28/269 (10%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCR 174
           W+  ++ + S SF  + G   D  G +  L        I  L CGF++  +  +F    R
Sbjct: 6   WITTAYLITSTSFQPLYGSFSDALGRRNCLFFANATFTIGCLACGFSSNIYMLSFM---R 62

Query: 175 AFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPK 234
           A  G+G   ++   +  I N     T ++    +F  +    GA  G  + G IA     
Sbjct: 63  ALTGIGGGGLI--TLSTIVNSDVIPTSKRGIFQAFQNLLLGFGAICGASFGGTIAST--I 118

Query: 235 QWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHG-----------FGMDWTGSAIGVVGM 283
            W W F     +  I+ ++  Y +P+    N               G+D  GS + + G+
Sbjct: 119 GWRWCFLIQVPISMISSILMNYYVPNQKEYNDQNSNIFNDPKKILTGIDVMGSILIITGL 178

Query: 284 ILFNFVWNQGPIDG---WNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
            L     + G       W    ++ LL  SV +L+ F ++E K     ++P E++ + + 
Sbjct: 179 TLQLLYLSLGCSTSNLSWTSPSVLLLLFGSVIILLLFILHERKTTARAIIPMELVSSSYS 238

Query: 341 GMIL-LAVFMGWGSFGIWTFYYYAFQLNL 368
            ++L +++ +G+ S      Y Y F L L
Sbjct: 239 FVVLSISILVGFAS------YAYLFTLPL 261

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKN 337
           I  +G IL       G    WN  +II   ++   L+     +E+++A+ PL+P  +IK+
Sbjct: 286 IATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLVPILMFWEMRWARDPLVPYGLIKD 345

Query: 338 RHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           R +   L   F+ +  F +   Y YA  L
Sbjct: 346 RGVWSALAISFLNYFIFALAAGYLYAILL 374

>TDEL0D06610 Chr4 complement(1195341..1196834) [1494 bp, 497 aa]
           {ON}  possible pseudogene; N added at two sites to avoid
           frameshifts
          Length = 497

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 81/403 (20%), Positives = 146/403 (36%), Gaps = 43/403 (10%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           L+  ++ S    +W + S+ +    FI   GR+GDI G  +          I SL+CG  
Sbjct: 55  LSTKYSISYTTASWSLTSYAVTFAGFIAFMGRLGDIVGNSRLFTVSCGCFAILSLLCGL- 113

Query: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALG 221
               N   F + RA QG+  A ++     LI  +     +++ F I   G  + IG    
Sbjct: 114 --MPNFEAFAVMRALQGIAAAGLVMCGYALIPILSPKEQVQEYFSIVSCGFSSTIGIGF- 170

Query: 222 GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF----------GM 271
                 I       +  IFY     + +  +MA +           G            +
Sbjct: 171 ------IIGGAXXGYKGIFYLTFAAMTLICIMAFFFTCDVEKNEEKGLEVKESTATVASL 224

Query: 272 DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFF---IYEIK----- 323
           D+ GS I + G IL      +G  + W +        + + L ++FF    + +K     
Sbjct: 225 DFIGSLIFITGSILIVVGLTEGG-ESWREAKAYVTFAIGIILFLSFFAWNCFYLKIVNGI 283

Query: 324 ----------FAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSA 373
                     F K  LL P  +    +  I+LA  M         +    +     + S 
Sbjct: 284 RLIGIDTTKYFEKVQLLVP--LNIHFMTXIVLAFAMNNACPFSSIYIIDQYSQYKENDSP 341

Query: 374 VWAGGTFFMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPV--HQSYW 431
           + AG      +I   I  FL  +   R+ P   +         G I+L+      +  +W
Sbjct: 342 LMAGVKLVPLIISMIIGNFLCGIEKTRMRPKFGVTLGFFLALSGSIILTQLRAVKYDVFW 401

Query: 432 KMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQGMAGSLVNT 474
           K+    ++++ FG+ + +P +  +     P + +G+A  +  T
Sbjct: 402 KIFFSAEVLVGFGVAIFYPYAQQLAVGRAPDEAKGIASGVAQT 444

>NDAI0D01680 Chr4 complement(395646..397196) [1551 bp, 516 aa] {ON}
           Anc_5.284
          Length = 516

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 134 IGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIG 193
           I ++YG + T I    + +IW  +     ++HN    +  R   G   +  L    G I 
Sbjct: 134 ISELYGRRLTFIFSMTLSIIWQCL---TTWSHNVVGMMFGRFLSGFFGSAFLSIAGGSIS 190

Query: 194 NIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVM 253
           +I+   T+     +S   +    G  LG + SG +  EN   + W+F    I   + +V+
Sbjct: 191 DIFDKATI--TIPMSLYTLSCFYGPVLGPIVSGALYREN---YRWVFATLLIASGVCLVL 245

Query: 254 AIYSIPST 261
            I++IP T
Sbjct: 246 IIFTIPET 253

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 68/145 (46%), Gaps = 10/145 (6%)

Query: 264 TNIHGFGMDWTGS--AIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIY 320
           T I  + +D+ G   A+   G++L  F    G    W    II   ++  V    AF  +
Sbjct: 269 TEIFLWKLDFIGLLLAVAFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTW 328

Query: 321 EIKFAKSPLLPPEVIKNRHI-GMILLAVFMGWGSFGIWTFYYYAFQL---NLRHYSAVWA 376
           EIKFAK PL P + +K+R +   +++A+F+   +F +   Y Y   L   N    SA   
Sbjct: 329 EIKFAKYPLTPWKTVKDRGVFSALIIAIFLQ-TAFYMQKTYMYTILLVAVNQTKKSATRI 387

Query: 377 GGTF-FMFVIWGTIAAFLVALTIKR 400
              F F+  + GT+   LV + ++R
Sbjct: 388 NSLFTFVTALSGTLLG-LVIVKVRR 411

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFI-YEIKFAKSPLLPPEVIK 336
           I ++G IL       G  + WN  +IIA  I+  F+LI FFI +E K+A+ P+ P ++++
Sbjct: 304 IIILGCILVPLTLAGGISNKWNNPHIIAPFILG-FVLIPFFIAWESKWAREPIAPFKLLR 362

Query: 337 NRHIGMILLAVFM 349
           +R I   L   F+
Sbjct: 363 DRGIWAALCIAFL 375

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 21/101 (20%)

Query: 267 HGF-----GMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           HGF      + W    IGV+      G IL       G    WN   +I   ++   L+ 
Sbjct: 276 HGFIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIP 335

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
             +I+E +FA+ P+LP +++K+R +          W S GI
Sbjct: 336 VLWIWEYRFARDPILPYKLVKDRAV----------WSSMGI 366

>YHR048W Chr8 (204607..206151) [1545 bp, 514 aa] {ON}  YHK8Presumed
           antiporter of the DHA1 family of multidrug resistance
           transporters; contains 12 predicted transmembrane spans;
           expression of gene is up-regulated in cells exhibiting
           reduced susceptibility to azoles
          Length = 514

 Score = 38.9 bits (89), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 51/260 (19%), Positives = 100/260 (38%), Gaps = 14/260 (5%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP 61
           +++ ++S    +   +H +IN + +  K D     E+KN   +S      E  F ++   
Sbjct: 6   QIASAQSSALTSTEEEHCSINSD-KAAKLDLELTSERKNDGKQSH-----EVTFNEDIAD 59

Query: 62  WQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFP 121
            ++     +  + Y   S                T P   + + F+ S +  T  +  + 
Sbjct: 60  PEDIARHMSTARRYYISSLITFTSMVITMISSSWTLPSTHIIEHFHISHEVSTLGITLYV 119

Query: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181
              G   L    + ++YG + T +    + +IW  +  ++       F      F   G 
Sbjct: 120 FGLGIGPLFLSPLSELYGRRITFLYALTLSIIWQCLTIWSKTITGVMFGRFLSGF--FGS 177

Query: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241
           AF L    G I +I+  + +     ++     A +G +LG +  G + H++ K   W F 
Sbjct: 178 AF-LSVAGGAIADIFDKDQI--GIPMAIYTTSAFLGPSLGPIIGGALYHQSYK---WTFI 231

Query: 242 AYAIVVAINMVMAIYSIPST 261
              I     +VM I++IP T
Sbjct: 232 TLLITSGCCLVMIIFTIPET 251

>Suva_4.553 Chr4 (959592..961280) [1689 bp, 562 aa] {ON} YBR293W
           (REAL)
          Length = 562

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 57/270 (21%), Positives = 107/270 (39%), Gaps = 29/270 (10%)

Query: 113 QTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFIL 172
            +W+  ++ + S SF  + G   D  G +  L     V  I  L C F+   +  +F   
Sbjct: 95  SSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANAVFTIGCLACSFSTNIYMLSFMRA 154

Query: 173 CRAFQGLGIAFILPNVMGLIGNIYKANTLR--KNFVISFVGMCAPIGAALGGVWSGLIAH 230
                G G+  +   V   +    K    +  +N ++ F  +C   GA+ GG  +  I  
Sbjct: 155 LAGIGGGGLITLSTIVNSDVIPSSKRGIFQAFQNLLLGFGAIC---GASFGGTITSTIG- 210

Query: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGM-----------DWTGSAIG 279
                W W F     +  I  ++  Y +P+    +     +           D TGS + 
Sbjct: 211 -----WRWCFLIQVPISMIASLLMNYYVPNQKEYDDQKINILLSSKKILKDIDITGSILI 265

Query: 280 VVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRH 339
           + G+ L     + G    W    ++ LL+ S+ ++I F + E K     ++P E++ +  
Sbjct: 266 IAGLTLQLLYLSLGASFSWTNPPVLMLLLASIVIIILFILNERKTTARAIIPMELVNSSF 325

Query: 340 IGMIL-LAVFMGWGSFGIWTFYYYAFQLNL 368
             ++L +++ +G+ S      Y Y F L L
Sbjct: 326 SFVVLSISILVGFAS------YAYLFTLPL 349

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G IL            W+   IIA L+    L   F  +E KFAKSPLLP +++ +R I
Sbjct: 286 LGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 131/347 (37%), Gaps = 52/347 (14%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           ++++A+ F + +K   WL+  + L +    L+ GR   I G + +LI   L+    SLI 
Sbjct: 61  IDVVAEQFGNYSKTG-WLVTGYSLPNAILSLIWGRFASIIGFQHSLILAILIFEAGSLIA 119

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
             A+  +     I  R   G+G +  L  +  +IG        R   VIS +     + A
Sbjct: 120 ALASSMN---MLIFGRVVAGVGGSG-LQTLCFVIGCTMVGERSRP-LVISILSCAFAVAA 174

Query: 219 ALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVM------------------AIYSIPS 260
            +G +  G  A      W W FY    +  + ++M                  AI +I S
Sbjct: 175 IVGPIIGG--AFTTHVTWRWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISS 232

Query: 261 TVPTNIHG------------FGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALL 307
              +                F  D+ G A+   G++LF      G     WN G +I  L
Sbjct: 233 FTFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVITYL 292

Query: 308 IVSVFLLIAFFIYEI----KF-------AKSPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
           ++ V L I   +Y+     KF       +  PLL   ++    I ++ +  F+    +  
Sbjct: 293 VLGVLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNG 352

Query: 357 WTFYYYAFQLNLRHYSAVWAGGTFFM-FVIWGTIAAFLVALTIKRVG 402
              Y   F   L   S+ W  G   +  VI   IAA    +  K++G
Sbjct: 353 QMIYSVQF-FQLIFASSAWKAGLHLIPIVITNVIAAIASGVITKKLG 398

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G IL            W+   IIA L+    L   F  +E KFAKSPLLP +++ +R I
Sbjct: 286 LGCILVPLTLANETSQKWHNSKIIATLVSGGCLFFIFLYWEAKFAKSPLLPFKLLSDRGI 345

>KAFR0J00930 Chr10 (168674..170374) [1701 bp, 566 aa] {ON} Anc_2.242
           YNL065W
          Length = 566

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/163 (22%), Positives = 69/163 (42%), Gaps = 7/163 (4%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           L   FN    K    +  + L  G    +SG + D+YG +  ++GG L+ ++ S+  G A
Sbjct: 117 LEQKFNIDENKVNVTVVVYLLFQGVAPAISGGLADVYGRRPVILGGMLIFVVASI--GIA 174

Query: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALG 221
               +    +  R  Q +GI+  +    G++ + +     R  FV +  G+   IG  +G
Sbjct: 175 K-APSYGVIVFLRCIQSIGISPTIAISSGVVSD-FTVKRERGTFVGATSGLVL-IGQGIG 231

Query: 222 GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPT 264
            +   +I       W  +F+   I     M++  + +P T  T
Sbjct: 232 PLLGAVITAA--LHWRAVFWFLTIGCGSCMIIGFFLLPETKRT 272

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 16/100 (16%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    +GV+      G IL       G    WN  ++IA  ++   LL  F ++E K+A 
Sbjct: 280 WKLDVVGVLLLTVTLGCILVPLTLAGGVSQKWNNPHVIAPFVLGFVLLPIFVVWESKWAL 339

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
            P+ P E++K+R +          W +  I    Y+ +Q+
Sbjct: 340 DPIAPFELLKDRGV----------WSALTIQFLIYFVYQM 369

>SAKL0D04510g Chr4 complement(360010..361605) [1596 bp, 531 aa] {ON}
           similar to uniprot|P36035 Saccharomyces cerevisiae
           YKL217W JEN1 Lactate transporter, required for uptake of
           lactate and pyruvate; expression is derepressed by
           transcriptional activator Cat8p under nonfermentative
           growth conditions, and repressed in the presence of
           glucose, fructose, and mannose
          Length = 531

 Score = 38.5 bits (88), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 4/94 (4%)

Query: 96  TAPMNI--LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLI 153
           T  +N+  ++  F+ + K+ TW +    ++     ++ G IGD YG K + I     +++
Sbjct: 93  TVTLNVKKISHDFDVTTKQVTWGITLVLMLRVVGAVLFGYIGDRYGRKVSFIINLFFMMV 152

Query: 154 WSLICGFANYTHNDAFFILCRAFQGLGIAFILPN 187
             +I GF    HN  +F++ RAF G+ +  I  N
Sbjct: 153 LEIITGFIK--HNFKYFLIARAFFGVVLGGIFGN 184

>KNAG0I01910 Chr9 complement(373073..374869) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 38.5 bits (88), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 37/144 (25%), Positives = 66/144 (45%), Gaps = 11/144 (7%)

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG 190
           SG + D YG +  ++GG LV ++ S+  G A    +    +  R  Q +GI+  +    G
Sbjct: 169 SGGLADRYGRRPIILGGMLVYVVASI--GLAR-APSYGVIVFLRIVQSIGISPTIAISSG 225

Query: 191 LIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW--IFYAYAIVVA 248
           ++ + Y     R  FV +  G    IG  +G +   +IA     +W W  IF+   I   
Sbjct: 226 VVSD-YTLKRERGTFVGATSGFVL-IGQGIGPLLGAVIA----ARWDWRAIFWFLVIGCG 279

Query: 249 INMVMAIYSIPSTVPTNIHGFGMD 272
            +M++A + +P T  T +    ++
Sbjct: 280 TSMLIAFFLLPETKRTIVGNLSIE 303

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 57/252 (22%), Positives = 109/252 (43%), Gaps = 27/252 (10%)

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           +  MN +A  F   A   TW+  ++ L + S   + G+  D+ G KK L+   +V +I  
Sbjct: 72  STTMNEVASIFQE-ASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGL 130

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP 215
           ++CG A      A   + RA  G+G      + +G + NI  ++    +    + G+   
Sbjct: 131 VLCGMARTVKELA---IARAICGIG-----GSGLGAMCNIILSDLAPLSQRSIYWGL--- 179

Query: 216 IGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF------ 269
            G+ + G    +          W  +  + +  I +   ++S+  TV   IH        
Sbjct: 180 -GSLIWGFSQSIGGPLGGLLLNW--FGVSGLFVIQVPFCLFSLFLTV-RYIHDLTDQRQG 235

Query: 270 ---GMDWTGSAIGVVGMILFNFVWNQGP-IDGWNKG-YIIALLIVSVFLLIAFFIYEIKF 324
               +D+ GS   ++G+  F F  + G  +D  ++G + +  LIV++  +  F + E + 
Sbjct: 236 TWRDIDFAGSFCLIIGISAFIFSCSAGDGVDSNDEGPFKVVCLIVTIAAVAGFVVVEKRM 295

Query: 325 AKSPLLPPEVIK 336
           A   +LP  V+K
Sbjct: 296 ATKSILPAHVLK 307

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 38.1 bits (87), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 109/281 (38%), Gaps = 43/281 (15%)

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           T  ++ +A  FN      +W+  ++ L S +F  + G+I DI+G +  +I   L  ++  
Sbjct: 82  TTLLSHIASEFNE-LSHISWIATAYLLSSATFQPLYGKISDIFGRRPLIIISNLFFILGC 140

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKAN--TLRKNF----VISF 209
           LICG +    N    +  R   G+G   +       +G+I  ++   LR       + +F
Sbjct: 141 LICGLSK---NLWTLVAGRFIAGIGGGGVTS-----LGSITASDIVPLRSRALYQGIFNF 192

Query: 210 VGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGF 269
                     L G W      E+   W   F     + AI++V+ I  I   +P    G 
Sbjct: 193 FFGLGIAIGGLIGGWFS----ESKNGWRMAFLVQVPLCAISLVLII--IFLKLPPGCKGL 246

Query: 270 GM------------------DWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSV 311
           G+                  DW GS   V  +  F    + G  +      I  LL+V+ 
Sbjct: 247 GLVSNDKDGKVDIKDKLKRIDWLGSLSLVTFLFAFMLASSLGGKEIPYNSNIFKLLVVAT 306

Query: 312 FLLIAFFIY-EIKFAKSPLLPPEVIKNRHIGMILLAVFMGW 351
            L    FIY E+  +  P+LP   + NR    IL A F  W
Sbjct: 307 ILSGTAFIYVELYISDDPILPIRFLTNRS---ILGASFANW 344

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score = 38.1 bits (87), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 43/101 (42%), Gaps = 21/101 (20%)

Query: 267 HGF-----GMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           HGF      + W    +GV+      G IL       G    WN   +I   ++   L+ 
Sbjct: 276 HGFIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIP 335

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
             +I+E +FA+ P+LP  ++K+R +          W S GI
Sbjct: 336 ILWIWEYRFARDPILPYRLVKDRAV----------WSSMGI 366

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 36/75 (48%), Gaps = 7/75 (9%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFA 325
           W   A+G++      G IL  F       D W    II   ++     L  F ++E+KFA
Sbjct: 254 WRLDAVGLIMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFA 313

Query: 326 KSPLLPPEVIKNRHI 340
           K PL+P  VIK+R I
Sbjct: 314 KHPLVPWNVIKDRGI 328

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score = 38.1 bits (87), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 15/172 (8%)

Query: 248 AINMVMAIYSIPSTVPTNIHGFGMD-WTGSAIGVV------GMILFNFVWNQGPIDGWNK 300
           A + +M  ++IP  V    +   +  W    IG++      G +L  F    G  + W  
Sbjct: 251 AKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVLIPFTLAGGMKEQWRT 310

Query: 301 GYIIALLIVSVFLLIAFFI-YEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTF 359
            +II   ++   + +  +I +EIKF++ PL P E++K+R +   L+  F+    + +   
Sbjct: 311 AHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSALIIAFLINFCWYMQGD 370

Query: 360 YYYAFQLNLRHYSAVWAGGTF----FMFVIWGTI-AAFLVALTIKRVGPSVL 406
           Y Y   +   H S   A        F+ VI GTI   FLV L  +R  P +L
Sbjct: 371 YMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKL--RRTKPFIL 420

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 16/98 (16%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W   +IG++      G +L       G    W+   II  L+    L   F  +E  +AK
Sbjct: 267 WELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFCIFVFWETAYAK 326

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAF 364
           +PLLP +++ +R I          W   G+  F Y+ F
Sbjct: 327 NPLLPFKLLGDRGI----------WAPLGVAFFNYFTF 354

>SAKL0E08756g Chr5 complement(714902..716599) [1698 bp, 565 aa] {ON}
           similar to uniprot|P53943 Saccharomyces cerevisiae
           YNL065W AQR1 Plasma membrane transporter of the major
           facilitator superfamily that confers resistance to
           short- chain monocarboxylic acids and quinidine
          Length = 565

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 46/234 (19%), Positives = 97/234 (41%), Gaps = 10/234 (4%)

Query: 32  QTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXX 91
           +T   E +   +ES+ +  +++E T +    + P       Q++  ++            
Sbjct: 55  RTTTREVRATPSESDLDTYTDAE-TPDKVSCETPYTLMTHGQKWFMVALLTSGGFWSSLG 113

Query: 92  XXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVV 151
                  +  L   FN + +     +  + +  G    +SG + D+YG +  ++ G L+ 
Sbjct: 114 SPIYYPALKQLEQVFNINEEMVNITVVVYFIFQGVAPTISGGLADVYGRRPIILAGMLIY 173

Query: 152 LIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVG 211
           ++ S+    +N   +    +  R  Q  GI+ ++    G++G+ +   + R +FV +  G
Sbjct: 174 VVASIGLACSN---SYGVIVFLRCVQSAGISPLIAISSGVVGD-FTTKSERGSFVGAVSG 229

Query: 212 MCAPIGAALGG-VWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPT 264
             A +G A G  + +GL A  +   W  IF+   I      V+  + +P T  T
Sbjct: 230 F-ALMGQAFGSLIGAGLTAAYD---WRAIFWFLTIGCGTCFVINFFLLPETKRT 279

>Skud_2.423 Chr2 (756345..758027) [1683 bp, 560 aa] {ON} YBR293W
           (REAL)
          Length = 560

 Score = 37.7 bits (86), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 77/181 (42%), Gaps = 30/181 (16%)

Query: 203 KNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTV 262
           +N ++ F  +C   GA+ GG  +  I       W W F     +  I+ V+  Y +P+  
Sbjct: 182 QNLLLGFGAIC---GASFGGTIASTIG------WRWCFLIQVPISIISSVLMNYYVPNQK 232

Query: 263 PTNIHGFGM-----------DWTGSAIGVVGMILFNFVWN---QGPIDGWNKGYIIALLI 308
             N     +           D TGS + + G+ L     +    G    W    ++ LL+
Sbjct: 233 EYNHENSNIFRNSKRILTDIDITGSILIITGLTLQLLYLSLGCSGSKLSWTSPSVLLLLV 292

Query: 309 VSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILL-AVFMGWGSFGIWTFYYYAFQLN 367
            S+ +L+ F  +E K     ++P E++ + +  ++LL ++ +G+ S      Y Y F L 
Sbjct: 293 GSIAILLLFISHEKKTTARAIIPMELVSSSYSFVVLLISILVGFAS------YAYLFTLP 346

Query: 368 L 368
           L
Sbjct: 347 L 347

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 51/118 (43%), Gaps = 6/118 (5%)

Query: 255 IYSIPSTVPTNIHGFGMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLI 308
           + S+   +PT ++   + W     GV+      G IL     + G  + W     I +L 
Sbjct: 272 LRSVTKKMPTPVYIKEVFWNLDIPGVLLIAISLGCILIPLTVSGGETEEWKDSRNIGVLC 331

Query: 309 VSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
           +   L   F ++E K AK P+L    +K+R +   L A F    ++ I T Y YA  L
Sbjct: 332 LGSVLFPIFLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYLIATDYLYAVLL 389

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPL 329
           +DW G+   V+ ++ F  + + G  D        + L ++SV   I+F   E+KFAK P+
Sbjct: 306 IDWYGAMSLVIFLLSFMILSSAGGSDISVKSNTFLYLTLISVTSFISFIYIELKFAKDPI 365

Query: 330 LPPEVIKNRHI 340
           LP   +K+R +
Sbjct: 366 LPLVFLKDRSV 376

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 63/148 (42%), Gaps = 11/148 (7%)

Query: 265 NIHGFGMD-----WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFL 313
            IHG+ +      W    +GV+      G IL       G    WN   II   ++   L
Sbjct: 279 QIHGWKVTLKTLFWKLDVVGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVL 338

Query: 314 LIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSA 373
           +  F  +E ++A +PL+P +++K+R +   L   F+    F +   Y Y   +   H S 
Sbjct: 339 IPIFSYWEARWATNPLVPYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESV 398

Query: 374 VWAGGTFFMFVIWGTIAAFLVALTIKRV 401
             A     +     T+A+ +VAL + RV
Sbjct: 399 KSATRISSLSSFVSTVASPIVALALTRV 426

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 38/90 (42%), Gaps = 16/90 (17%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    IGV+      G IL       G    WN G II   ++   L+  F  +E  FA+
Sbjct: 283 WRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIGPFVLGFVLVPIFAAWEYFFAR 342

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
            PL+P  +IK+R +          W S GI
Sbjct: 343 DPLIPYALIKDRGV----------WASMGI 362

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G IL       G    W    II  L++   L+  F  +E K+AK PL P E++K+R I
Sbjct: 290 LGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLVPVFIYWESKWAKDPLAPFELLKDRGI 349

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           +  +N +A  F   A   TW+  ++ L + +   + G+I DI G +K L+ G ++  +  
Sbjct: 81  STTVNDIASQFQQ-ASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEVIFALGV 139

Query: 156 LICGFANYTHNDAFFILCRAFQGLG 180
           L+C FAN     A   + RA  G+G
Sbjct: 140 LLCNFANTIPQLA---IARAICGIG 161

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 54/130 (41%), Gaps = 7/130 (5%)

Query: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171
           K  W+ A + L +    L+ GRI  I G K  ++   ++  I SLI G AN  +     I
Sbjct: 114 KTGWIFAGYSLPNALLALLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMN---MLI 170

Query: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHE 231
             R   G+G + I      +  N+   +  R+  +I+ +     + + +G    G  A  
Sbjct: 171 GGRVIAGVGGSGIQSLAFVIGSNL--VDERRRGLIIACMSSAFAVASVIGPFLGG--AFT 226

Query: 232 NPKQWPWIFY 241
               W W FY
Sbjct: 227 THATWRWCFY 236

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 40/83 (48%), Gaps = 6/83 (7%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W   A+GV+      G IL       G    W    IIA +++   L++ F  +E K A 
Sbjct: 284 WKLDAVGVLLFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVLVFIYWESKLAL 343

Query: 327 SPLLPPEVIKNRHIGMILLAVFM 349
            PL P +++K+R I   LL +F+
Sbjct: 344 VPLAPFKMLKDRGIWAPLLLMFL 366

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 36/75 (48%), Gaps = 10/75 (13%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           VG IL       G    W+  ++I  L++   LL  F I+E K AK P++P  +IK+R +
Sbjct: 281 VGCILAPLTLAGGVKSKWSNPHLIGPLVLGFVLLPLFMIWESKAAKYPVVPYGLIKDRAV 340

Query: 341 GMILLAVFMGWGSFG 355
                     WG+ G
Sbjct: 341 ----------WGALG 345

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 79/319 (24%), Positives = 129/319 (40%), Gaps = 25/319 (7%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           MN +A+ F  S +KQ W+  SF L + +F  + G++ DI G K  L+     +  + L C
Sbjct: 58  MNKVAEEFQESQEKQ-WIATSFLLTNTAFQPLYGKLSDITGRKFALLTA---LSFFGLGC 113

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANT--LRKNFVISFVGMCAPI 216
              + + N   F + RA  G+G   I       +G+I  A    + + +     GM   +
Sbjct: 114 FLTSLSTNIKQFAIARAICGIGGGGINAISSITVGDICTAKDRGIYQGYANIVFGMGQLL 173

Query: 217 GAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG------ 270
           GA +GG++   IA    +   WI     I+  I   M +      VP     F       
Sbjct: 174 GAPVGGLF---IATIGWRALFWIQVPLVIIAIILGEMYVNIKLVHVPPPSERFKWKNISR 230

Query: 271 MDWTGSAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330
           +D+ GS   V  +  F  + +        K  +I L ++SV   IAF   E+  +K  +L
Sbjct: 231 IDFLGSFTLVSSITCFIILIS-------TKSNVILLSLLSVLSFIAFIYVELYVSKDRIL 283

Query: 331 PPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMF-VIWGTI 389
           P E++K       +  V   +  FG    +     L L    +V   G F +F  I   I
Sbjct: 284 PFELLKGSFGCNSIATVISSYVIFG--EIFRSPIYLQLVQDFSVIKTGIFLIFPAITTAI 341

Query: 390 AAFLVALTIKRVGPSVLLC 408
            + +    +KR    +  C
Sbjct: 342 GSLVTGAILKRTKLDLAYC 360

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 93/247 (37%), Gaps = 40/247 (16%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCR 174
           WL+  + L +  F+L+ GR+ +I G  + L+   ++  + SLI   +N         L  
Sbjct: 47  WLVTGYALTNAVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIA 106

Query: 175 AFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPK 234
            F G GI  +   V   I       T+      S+V +   +G  +GG      A     
Sbjct: 107 GFGGSGIESLAFVVGTSIVQENHRGTMITALATSYV-IAEGVGPFIGG------AFNEHL 159

Query: 235 QWPWIFY------AYAIVV------------AINMVMAIYSIPS------------TVPT 264
            W W FY      A+A+++             ++++  I SI S                
Sbjct: 160 SWRWCFYINLPIGAFALIILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKAF 219

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALLIVSVFLLIAFFIYEIK 323
            +  F +D  G  +   G  L     + G  +  WN   II+L  V   LLI F  Y+  
Sbjct: 220 KVFVFKLDMIGVTLSSAGFTLLMLGLSFGGNNFAWNSSTIISLFTVGPILLILFCAYDFH 279

Query: 324 FAKSPLL 330
           F   PLL
Sbjct: 280 FL--PLL 284

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 32/60 (53%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G +L       G    W    +I+  ++   LL  F I+E K+A+ P++P ++IK+R +
Sbjct: 284 IGCVLAPLTLAGGTGSKWQNPRVISPFVLGFVLLPIFLIWEKKWARDPIIPYDLIKDRAV 343

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 83/199 (41%), Gaps = 42/199 (21%)

Query: 189 MGLIGNIYK-------ANTLRKNFVISFVGMCAPIGAALGGVW-SGLIAH-ENPKQ---- 235
           +GL+G +++       +++L+     +FV    P   AL  VW SG + H  NPKQ    
Sbjct: 172 IGLVGAMFQVTLMLSDSSSLKWRLFYNFV----PAWPALVTVWISGNVIHLANPKQNWSW 227

Query: 236 ----WPWIFYAYAIVV---AINMVMAIYSIPS-------TVPTNIHGF-----GMDWTGS 276
               W +IF A  + +    ++M   + + P              HG       + W   
Sbjct: 228 GIAMWAFIFPAACLPIIGCLLHMRWKLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLD 287

Query: 277 AIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLL 330
            +GV+      G IL       G    W    +IA +++   L+ AF  +E K A  PL 
Sbjct: 288 VVGVLLFSVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVLVPAFIYWESKLALVPLA 347

Query: 331 PPEVIKNRHIGMILLAVFM 349
           P +++K+R I   LL  F+
Sbjct: 348 PFKMLKDRGIWAPLLITFL 366

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 34/63 (53%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKN 337
           +  +G IL       G    W+ G I+   I+   L+ AF ++E K+A+ P+ P +++K+
Sbjct: 305 VAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCLVPAFILWETKYARLPIAPFKMLKD 364

Query: 338 RHI 340
           R I
Sbjct: 365 RGI 367

>YBR293W Chr2 (787006..788430) [1425 bp, 474 aa] {ON}  VBA2Permease
           of basic amino acids in the vacuolar membrane
          Length = 474

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 40/181 (22%), Positives = 78/181 (43%), Gaps = 30/181 (16%)

Query: 203 KNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTV 262
           +N ++ F  +C   GA+ GG  +  I       W W F     +  I+ ++  Y +P+  
Sbjct: 96  QNLLLGFGAIC---GASFGGTIASSIG------WRWCFLIQVPISVISSILMNYYVPNQK 146

Query: 263 PTNIHGFGM-----------DWTGSAIGVVGMILFNFVWNQGPIDG---WNKGYIIALLI 308
             N     +           D  GS + + G+ L     + G       W    ++ LL+
Sbjct: 147 EYNRQNSSIFQNPGKILRDIDVMGSILIITGLTLQLLYLSLGCSTSKLSWTSPSVLLLLV 206

Query: 309 VSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMIL-LAVFMGWGSFGIWTFYYYAFQLN 367
            SV +L+ F ++E K +   ++P E++ + +  ++L +++ +G+ S      Y Y F L 
Sbjct: 207 GSVIILLLFILHERKTSARAIIPMELVNSSYSVVVLSISILVGFAS------YAYLFTLP 260

Query: 368 L 368
           L
Sbjct: 261 L 261

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 38/133 (28%), Positives = 57/133 (42%), Gaps = 12/133 (9%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G IL  F    G    W   +II   ++     L  F ++EIKF++ PL P  +IK+R  
Sbjct: 296 GCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWALIKDRG- 354

Query: 341 GMILLAVFMGWGSFGIWTF---YYYAFQLNLRHYSAVWAGGTF----FMFVIWGTIAAFL 393
             I+ A+F+ +     W     Y Y   +   H S   A        F+ VI GTI    
Sbjct: 355 --IIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSATRITSLYSFVSVITGTILGMF 412

Query: 394 VALTIKRVGPSVL 406
           +   I+R  P ++
Sbjct: 413 IT-KIRRTKPFIV 424

>TBLA0G02550 Chr7 complement(668523..670364) [1842 bp, 613 aa] {ON}
           Anc_2.242 YNL065W
          Length = 613

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 58/251 (23%), Positives = 95/251 (37%), Gaps = 19/251 (7%)

Query: 22  NQEAEY----TKNDQTNVE---EKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQE 74
           NQ+  Y    T +  T  E   +  +  T  + E  +  E     TP  +   + N+W  
Sbjct: 41  NQDGTYYLKGTLSHTTTRELHSDDSSIDTSLDGELSTPDEEAQEHTPPHSMLSYWNKWGM 100

Query: 75  YAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRI 134
            A ++ C                 +  L   FN         +  + +  G    VSG +
Sbjct: 101 VAVLTMC---GFWSSLGSPIYYPALKQLEKKFNVDENLVNVSVVVYLIFQGFAPAVSGGL 157

Query: 135 GDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGN 194
            DIYG +  ++ G LV ++ S+     N   +    I  R  Q  GI+ ++    G +G+
Sbjct: 158 ADIYGRRPVILFGMLVYVVASIGIAACN---SYGVIIFLRCLQSTGISPLIAISSGAVGD 214

Query: 195 IYKANTLRKNFVISFVGMCAPIGAALGG-VWSGLIAHENPKQWPWIFYAYAIVVAINMVM 253
            +     R  FV +  G+   +G A G  + + L A  N   W  IF+  AI     M +
Sbjct: 215 -FTVKAERGTFVGAVSGLVL-MGQAFGSLIGAALAAAYN---WRAIFWFLAIGCGACMAI 269

Query: 254 AIYSIPSTVPT 264
           A   +P T  T
Sbjct: 270 AGIVLPETKRT 280

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 124/322 (38%), Gaps = 54/322 (16%)

Query: 96  TAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWS 155
           +A + ++A+ F   +K   W+++ + L      L+ GR   I G K +L+   L+    S
Sbjct: 139 SASIEVIAEQFKDYSKSG-WIVSGYSLTEALLTLLWGRFATIIGFKSSLLVSILIFEAGS 197

Query: 156 LICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAP 215
           LI   +N  +     I  R   G+G + I  ++  +I +    +  R   +I  V  C+ 
Sbjct: 198 LISAISNSMN---MLIGGRVVAGIGGSGI-QSLCFVIASTLTPD--RSRVIIISVLSCSY 251

Query: 216 IGAALGGVWSG--LIAHENPKQWPWIFY-----------AYAIVVAINMVMAIYSIPSTV 262
             AA+ G + G  L  H     W W FY             A+V   +   +I  + S  
Sbjct: 252 AVAAVVGPFLGGALTTHVT---WRWCFYINLPIGGLAFVVLAMVYNPSGRKSIKDVFSVT 308

Query: 263 PTNIH-GFGM-----------DWTGSAIGVVGMIL--------FNFVWNQGPIDGWNKGY 302
             N   G G            +W    I  VG +L           +   G +  W+ G 
Sbjct: 309 KANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAGFTLLLLGLTFGGSMYAWSSGT 368

Query: 303 IIALLIVSVFLLIAFFIYEI----KFAKS-------PLLPPEVIKNRHIGMILLAVFMGW 351
           II  L+V V L+ A  +Y+     +F +        PLLP  V+    I     AVF+G 
Sbjct: 369 IIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPLLPWRVVSRPGIFTSNTAVFLGC 428

Query: 352 GSFGIWTFYYYAFQLNLRHYSA 373
            ++     Y   F   +R  SA
Sbjct: 429 IAYSAQIVYAVQFFQLVRGASA 450

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 35.8 bits (81), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 59/272 (21%), Positives = 116/272 (42%), Gaps = 30/272 (11%)

Query: 114 TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILC 173
           +W+ AS+ + S SF  + G   D+ G +K L    ++  I  L CG    + N  +    
Sbjct: 105 SWITASYLITSTSFQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGI---SINILWLSFM 161

Query: 174 RAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENP 233
           RAF   GI       +  I N     T ++    +F  +   +GA  G  + G+I   + 
Sbjct: 162 RAFT--GIGGGGLITLSTIVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVIT--SS 217

Query: 234 KQWPWIF-YAYAIVVAINMVMAIY----------SIPSTVPTNIHGFGMDWTGSAIGVVG 282
             W W F     I +A  ++  +Y              +  T      +D++G+ + ++G
Sbjct: 218 IGWRWCFLLQVPISLAGALIGHLYVRNQDEYERRKSKESSQTKEMLKHIDFSGAFLIIIG 277

Query: 283 MILFNFVWNQGPI-----DGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKN 337
           + L     + G       + W+   + A+L+ S  +L+ F + E + +   ++P +++++
Sbjct: 278 LTLQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRS 337

Query: 338 RHIGMIL-LAVFMGWGSFGIWTFYYYAFQLNL 368
               ++L ++V +G+ S      Y Y F L L
Sbjct: 338 LFSFLVLTISVLVGFAS------YAYLFTLPL 363

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFA 325
           W    +GV+      G IL       G    W    +IA L++   LL+ FFIY E K A
Sbjct: 284 WKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGS-LLVPFFIYWESKLA 342

Query: 326 KSPLLPPEVIKNRHIGMILLAVFM 349
             PL P +++K+R I   LL  F+
Sbjct: 343 LVPLAPFKMLKDRGIWAPLLITFL 366

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 40/84 (47%), Gaps = 8/84 (9%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFA 325
           W    +GV+      G IL       G    W    +IA L++   LL+ FFIY E K A
Sbjct: 284 WKLDVVGVLLFSVSTGCILIPLTIAGGASTHWRSAKVIAPLVLGS-LLVPFFIYWESKLA 342

Query: 326 KSPLLPPEVIKNRHIGMILLAVFM 349
             PL P +++K+R I   LL  F+
Sbjct: 343 LVPLAPFKMLKDRGIWAPLLITFL 366

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 56/244 (22%), Positives = 91/244 (37%), Gaps = 44/244 (18%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCR 174
           WL+  + L +  F+L+ GR+ +I G K+ L+   +V  I SLI   +N   + A  I  R
Sbjct: 47  WLVTGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSN---SMATLISGR 103

Query: 175 AFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPK 234
              G G + I      +  +I + N   +  +I+ + +   I   +G    G  A     
Sbjct: 104 VVAGFGGSGIESLAFVVGTSIVREN--HRGIMITALAISYVIAEGVGPFIGG--AFNEHL 159

Query: 235 QWPWIFYAYAIVVAINMVMAIYS-----------IPSTVPT------------------- 264
            W W FY    + A   ++  +            +PS +                     
Sbjct: 160 SWRWCFYINLPIGAFAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWKNTF 219

Query: 265 NIHGFGMDWTGSAIGVVG----MILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY 320
            +  F +D  G  +   G    M+  +F  N  P   WN G II    V   LL+ F  Y
Sbjct: 220 EVLVFKLDMVGIILSSAGFTLLMLGLSFGGNNFP---WNSGIIICFFTVGPILLLLFCAY 276

Query: 321 EIKF 324
           +  F
Sbjct: 277 DFHF 280

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 35/131 (26%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G++L  F    G    W    II   ++     L  F ++E K+A++PL P ++IK+R I
Sbjct: 277 GLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYARNPLTPWDLIKDRGI 336

Query: 341 GMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF----FMFVIWGTIAAFLVAL 396
              L+  F+    + +   Y Y   +   H S   A        F+ VI GT+  F++ +
Sbjct: 337 FSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSFVSVITGTLLGFVI-V 395

Query: 397 TIKRVGPSVLL 407
            ++R  P +L 
Sbjct: 396 KVRRTKPFILF 406

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 39/90 (43%), Gaps = 16/90 (17%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    IGV+      G IL       G    WN   +I   ++   L+   +++E  +A+
Sbjct: 291 WKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIPILWVWEYSYAR 350

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
            P+LP +++K+R +          W S GI
Sbjct: 351 DPILPYKLVKDRGV----------WSSMGI 370

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 38/168 (22%), Positives = 71/168 (42%), Gaps = 13/168 (7%)

Query: 109 SAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDA 168
           ++ + +W+  ++ L   +F  + G++ DI+G K  LI   L   +   ICG + +T+N  
Sbjct: 74  ASSQMSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICG-SPWTNNVW 132

Query: 169 FFILCRAFQGLGIAFILPNVMGLIGNIYKAN--TLRKNFVIS-FVGMCAPIGAALGGVWS 225
                R   G+G           +  I  ++   LRK  V    V +C  +G A G V  
Sbjct: 133 VLSTGRFVAGIG-----GGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGCASGSVLG 187

Query: 226 GLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDW 273
            ++      +W ++      +V   M+  +  +P+  P    G G+ W
Sbjct: 188 AVLQQGIGWRWAFLVQVPMALVCALMIAVVLDLPADSP----GRGLLW 231

>KLLA0F03311g Chr6 (311639..313267) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 542

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 49/227 (21%), Positives = 90/227 (39%), Gaps = 25/227 (11%)

Query: 6   SESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNP 65
           SES   +T+TR+           ++D  +V   +    ES  +   + + ++ D P+   
Sbjct: 27  SESSVFRTVTRE----------LRDDTDDVVTHEIYDEESFPDGSKQEQLSEEDVPYTLL 76

Query: 66  TYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSG 125
           TY   +W   A +++                  +  L   F+ + +     +  + L  G
Sbjct: 77  TY-RQKWFMVALLTSA---GFWSSLGSPIYYPALKELEAEFDVNEELINITVVVYLLFQG 132

Query: 126 SFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFIL 185
               +SG + D+YG +  ++ G L+ +I S+  G A      A   L R  Q  GI+ I+
Sbjct: 133 IAPTISGGLADVYGRRPIILLGMLIYVIASI--GLACSKSYGAVVFL-RCLQSAGISPII 189

Query: 186 PNVMGLIGNIYKANTLRKNFVISFVGMC-------APIGAALGGVWS 225
               G+ G+ +   + R  FV +  G         + IGAAL   + 
Sbjct: 190 AINSGVAGD-FTVKSERGTFVGAVSGFTLMGQAFGSLIGAALTAAYD 235

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 21/101 (20%)

Query: 267 HGF-----GMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           HGF      + W    IGV+      G IL       G    WN   +I   ++   L+ 
Sbjct: 281 HGFVKVLEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLIP 340

Query: 316 AFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGI 356
             +++E + A+ P++P +++K+R +          W S GI
Sbjct: 341 ILWVWEYRVARDPIIPYKLVKDRGV----------WSSMGI 371

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 68/317 (21%), Positives = 120/317 (37%), Gaps = 51/317 (16%)

Query: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171
           K  W++  + L +  F L+  R+  + G + +++   ++    SLI   AN  +     I
Sbjct: 80  KSGWIVTGYSLPNALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMN---MLI 136

Query: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHE 231
             R   G+G + +    + L+      +   +  V+S +     + + +G    G  A  
Sbjct: 137 AGRVVAGIGGSGL--QTLSLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGG--AFT 192

Query: 232 NPKQWPWIFY--------AYAIVV------AINMV-------------MAIYSIPSTVPT 264
               W W FY        A AI V       +N++               +   P  V  
Sbjct: 193 THVTWRWCFYINLPIGGLAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQ 252

Query: 265 NIHGFGMDWTGSAIGVVGMILFNFVWN-QGPIDGWNKGYIIALLIVSVFLLIAFFIYEIK 323
            +  FG D         G +LF       G    WN G +I+ +I+ V L+    +Y+ K
Sbjct: 253 QLL-FGFDILSFISFTAGWLLFLLALTFGGQTHAWNSGIVISFIIIGVLLIAISLVYDFK 311

Query: 324 FAKS--------PLLPPEVIKNRHIGMILLAVFMGWGS---FGIWTFYYYAFQLNLRHYS 372
             +         PLL  E++ NR    ILL+ F G+ S   + +   Y   F   +  +S
Sbjct: 312 VFEQIKTQDSFRPLLSWEIMSNRS---ILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFS 368

Query: 373 AVWAGGTFFMFVIWGTI 389
           A W  G   + ++  T+
Sbjct: 369 A-WKAGLHLIPILVSTV 384

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 60/130 (46%), Gaps = 6/130 (4%)

Query: 282 GMILFNFVWNQGPIDGWNK-GYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G IL  F    G  + W   G I+  +I  V  L  + I+E K+A+ PL P ++IK+R I
Sbjct: 277 GCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPWKLIKDRGI 336

Query: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              L+  F     W   G + F      +N  + SA      + F+ VI GT+   LV +
Sbjct: 337 FSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGTLLG-LVIV 395

Query: 397 TIKRVGPSVL 406
            ++R    +L
Sbjct: 396 KVRRTKKFIL 405

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score = 34.7 bits (78), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%)

Query: 293 GPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVF 348
           G    W +G+IIA+++V     I FF++E+  AK P +P   + +  I + LL  F
Sbjct: 300 GASTKWKEGHIIAMIVVGGCCGILFFVWELWLAKKPFIPRVYLGDATIYVALLMEF 355

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 57/253 (22%), Positives = 102/253 (40%), Gaps = 30/253 (11%)

Query: 6   SESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNP 65
           S +   K+I R +I I+ ++     D   V   K  + ++  E   E E+ +   P    
Sbjct: 2   SRASMEKSIVRGNIGIDIKSV----DSVQVHTSKTDTAQTLEE---EVEYNEFGQPLPKG 54

Query: 66  TYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSG 125
                    +A                   T  +N +   F++ AK   W++A + L + 
Sbjct: 55  IIL------WACTGALALANFLAALDIMIVTTIINDVGAHFDAYAK-TGWIIAGYSLPNA 107

Query: 126 SFILVSGRIG-DIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFI 184
              L+ GRI     G K  ++   ++  I SLIC  AN        I  R   G+G + I
Sbjct: 108 LMSLLWGRIAFSFLGFKTAMLSAIVIFEIGSLICALANSMD---MLIGGRVIAGIGGSGI 164

Query: 185 LPNVMGLIGNIYKANTLRKNFVISFV----GMCAPIGAALGGVWSGLIAHENPKQWPWIF 240
             ++  +IG+   +   R  F+I+F+    G+ + IG  +GG ++  +       W W F
Sbjct: 165 -QSLSFVIGSTLVSPRGR-GFIIAFMSASFGIASVIGPFIGGAFTSHVT------WRWCF 216

Query: 241 YAYAIVVAINMVM 253
           +    V A+ +V+
Sbjct: 217 WINLPVGAVALVI 229

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           +G IL       G  + WN G II  L++ VFL+     +E  +AK P  P  ++K+R I
Sbjct: 300 MGCILVPLTIAGGISEQWNNGKIIGPLVLGVFLVPLTIYWESNWAKVPFAPFLLLKDRGI 359

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 34.3 bits (77), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 108 SSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHND 167
            ++ + +W+  S+ L   +F  + G++ DI+G K  L+   LV  I   +CG + +T N 
Sbjct: 73  DASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCG-SPWTTNI 131

Query: 168 AFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVG-MCAPIGAALGGVWSG 226
                 R   G+G   +         +I     LRK  V   +G +C  +G A G V   
Sbjct: 132 WILSAGRFIAGIGGGGLTTLSTITTSDIIP---LRKRGVYQGLGNICFSLGCASGSVLGA 188

Query: 227 LIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIG 279
           ++  +    W W F     +  I+ ++ ++ +   +P++  G G+ W   A G
Sbjct: 189 VL--QQGIGWRWAFLIQVPIALISGLLIVFVLE--LPSDSPGRGLIWLEHARG 237

>TDEL0B01900 Chr2 complement(335873..337936) [2064 bp, 687 aa] {ON}
           Anc_8.446 YDL199C
          Length = 687

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 44/83 (53%), Gaps = 6/83 (7%)

Query: 104 DAFNSSAKKQTWLMASFPLVSGSFI--LVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           + FN+ ++     M S  L  G+ +  L+ GR+G+ +G ++T+  G L+ +I  L  GFA
Sbjct: 137 NHFNNPSRAAIGNMVSI-LEIGALVSSLLVGRLGEKWGRRRTIKYGSLIFVIGGLFQGFA 195

Query: 162 NYTHNDAFFILCRAFQGLGIAFI 184
           +   +    I+ R   GLG+  +
Sbjct: 196 DKMMH---LIIGRTISGLGVGLL 215

>TPHA0F01290 Chr6 complement(294550..296238) [1689 bp, 562 aa] {ON}
           Anc_2.241 YIL121W
          Length = 562

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 30/133 (22%), Positives = 60/133 (45%), Gaps = 7/133 (5%)

Query: 132 GRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGL 191
           G + D++G +  ++ G L+  + S+    +N   +    +  R  Q  GI+  +    G 
Sbjct: 148 GGLADLFGRRPVILTGMLIYTVASIGLACSN---SYGVIVFLRCLQSAGISPTISISSGA 204

Query: 192 IGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINM 251
           +G+ +   + R  FV +  G+   +G A G +    +A      W  IF+   I   ++M
Sbjct: 205 VGD-FTVKSERGTFVGAVSGLVL-LGQAFGSLIGAALAASF--NWRAIFWFLTIGCGVSM 260

Query: 252 VMAIYSIPSTVPT 264
           ++A + +P T  T
Sbjct: 261 MVAFFVLPETKRT 273

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 82/418 (19%), Positives = 148/418 (35%), Gaps = 58/418 (13%)

Query: 28  TKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXX 87
           +K  Q   E K  CS++ E E  S+S+ + N     N          Y  +++       
Sbjct: 4   SKGSQNMAETK--CSSQPEIEEASDSDTSLN----VNGGDAKMGLSLYLCLASLTLVLFI 57

Query: 88  XXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGG 147
                      ++++A  F + +K   WL+  + L +    L+ GR   I G + +LI  
Sbjct: 58  TALDILIVGTIIDVVAKQFGNYSKTG-WLVTGYSLPNAVLSLLWGRFASIIGFQHSLILA 116

Query: 148 YLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVI 207
            L+    SL+   AN  +     ++            L  +  +IG     +   +  VI
Sbjct: 117 VLIFEAGSLVAALANSMN----MLIVGRVVAGVGGSGLQTLCFVIG-CTMVDERSRPLVI 171

Query: 208 SFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPS------- 260
           S +     + A +G +  G  A      W W FY    +  + ++M + +  +       
Sbjct: 172 SILSCAFAVAAIVGPIIGG--AFTTHVTWRWCFYINLPIGGLAVIMFLLTYDAKNDGIIQ 229

Query: 261 -----------------TVPTNIHG------FGMDWTGSAIGVVGMILFNFVWNQGPID- 296
                              P N+        F  D+ G A+   G++LF      G    
Sbjct: 230 QMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFALSSTGLVLFLLGLTFGGNKY 289

Query: 297 GWNKGYIIALLIVSVFLLIAFFIYEI----KF-------AKSPLLPPEVIKNRHIGMILL 345
            W+ G +I  L++ + L I   +Y+     KF       +  PL    ++    I ++ +
Sbjct: 290 TWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNISYRPLFLRRLVAKPAIIIVNM 349

Query: 346 AVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFM-FVIWGTIAAFLVALTIKRVG 402
             F+    +     Y   F   L   S+ W  G   +  VI   IAA    +  K++G
Sbjct: 350 VTFLLCTGYNGQMIYSVQF-FQLIFASSAWKAGLHLIPIVITNVIAAIASGIITKKLG 406

>YIL120W Chr9 (134417..136108) [1692 bp, 563 aa] {ON}  QDR1Multidrug
           transporter of the major facilitator superfamily,
           required for resistance to quinidine, ketoconazole,
           fluconazole, and barban
          Length = 563

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 47/261 (18%), Positives = 102/261 (39%), Gaps = 25/261 (9%)

Query: 13  TITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTY--FAN 70
           ++ R+     +E E + N+  +     +  ++++AE  +     DN++ +    Y  F++
Sbjct: 7   SVMRNASIAKEEREGSDNNNVD-RSSSDAISDNDAERSNSHSEIDNESNFDMVPYSRFSH 65

Query: 71  RWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
           + Q+   +  C                 + I+   FN + +     +  + +  G    +
Sbjct: 66  K-QKMLLVVQCAFTGFFSTVAGSIYYPVLTIIERKFNITEELANVTIVVYFIFQGVAPSI 124

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICGFANY-----THNDAFFILCRAFQGLGIAFIL 185
            G + D +G +         +++W+++  F         HN A  +  R  Q  GI+ ++
Sbjct: 125 MGGLADTFGRRP--------IVLWAILAYFCACIGLACAHNYAQILALRCLQAAGISPVI 176

Query: 186 PNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW--IFYAY 243
               G++G++     + +   +  V     +G A G     LI      +W W  IF+  
Sbjct: 177 AINSGIMGDV--TTKVERGGYVGLVAGFQVVGTAFG----ALIGAGLSSKWGWRAIFWFL 230

Query: 244 AIVVAINMVMAIYSIPSTVPT 264
           AI   I +V +   +P T  T
Sbjct: 231 AIGSGICLVFSTLLMPETKRT 251

>Suva_15.236 Chr15 (408206..409750) [1545 bp, 514 aa] {ON} YHR048W
           (REAL)
          Length = 514

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 52/260 (20%), Positives = 93/260 (35%), Gaps = 24/260 (9%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP 61
           ELSD E          H +++ + +  +  Q   E K N +   E        F +N   
Sbjct: 16  ELSDEE----------HFSMHSDKDTERGSQLTSEGKPNGTQTYEVG------FGENLAD 59

Query: 62  WQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFP 121
            ++        + Y   S                T P   + + F+ S +  T  +  + 
Sbjct: 60  PEDIARHMGMARRYYISSVITFTSMVITMVSSCWTLPSTHIIEHFHISHEVSTLGITLYV 119

Query: 122 LVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGI 181
              G   L    + ++YG + T I    + ++W  +  ++       F      F   G 
Sbjct: 120 FGLGIGPLFLSPLSELYGRRTTFIYALTLSVVWQCLTIWSKTITGVMFGRFLSGF--FGS 177

Query: 182 AFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFY 241
           AF L    G I +I+  + +     ++     A +G +LG +  G + HEN K   W F 
Sbjct: 178 AF-LSVAGGAIADIFDKDQI--GVPMAIYTTSAFLGPSLGPIIGGALYHENYK---WTFI 231

Query: 242 AYAIVVAINMVMAIYSIPST 261
              I     +V+ + +IP T
Sbjct: 232 TLLITSGCCLVVIMLTIPET 251

>ABL210C Chr2 complement(7071..8507) [1437 bp, 478 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKL217W
           (JEN1)
          Length = 478

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 3/80 (3%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           +A+  N + +K TW M    +      ++ G IGD +G K + +    ++ I  L+ GFA
Sbjct: 71  IAEDLNVNDEKVTWGMTIALMTRTIGAVLYGYIGDQFGQKASFMINIGMISILQLLTGFA 130

Query: 162 NYTHNDAFFILCRAFQGLGI 181
                  +FI CRA+ G+ +
Sbjct: 131 T---TFPYFIACRAYFGVEL 147

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 30/58 (51%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNR 338
           +G IL       G    WN   +I   ++   L+    ++E K+A+ PL+P +++++R
Sbjct: 292 LGCILVPLTLAGGTNSKWNNSRVIGPFVLGFVLIPILGVWEYKWARDPLIPYKLVRDR 349

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/130 (23%), Positives = 55/130 (42%), Gaps = 7/130 (5%)

Query: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171
           K  W+ A + L S    L+ GRI  + G K +++   ++  + SL+   AN        I
Sbjct: 91  KTGWIYAGYSLPSALLTLIWGRIAAVCGFKSSMLTAIIIFEVGSLVAALANSMD---MLI 147

Query: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHE 231
             R   GLG + I      +I  + + +  ++  +I+ +G    I + +G    G  A  
Sbjct: 148 GGRVIAGLGGSGIQTLCFVIISTLVEES--KRGLLIACMGSAFGIASVVGPFLGG--AFT 203

Query: 232 NPKQWPWIFY 241
               W W F+
Sbjct: 204 THVTWRWCFW 213

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFA 325
           W    +GV+      G IL       G    W    +IA  ++  FLL+  FIY E K A
Sbjct: 282 WKLDVVGVLLFSISTGCILVPLTLAGGASTQWRSAKVIAPFVLG-FLLVPVFIYWESKLA 340

Query: 326 KSPLLPPEVIKNRHIGMILLAVFM 349
             PL P +++K+R I   L+  F+
Sbjct: 341 LVPLAPFKMLKDRGIWAPLVITFL 364

>KLLA0F13684g Chr6 complement(1267367..1269082) [1716 bp, 571 aa]
           {ON} similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 571

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 60/270 (22%), Positives = 109/270 (40%), Gaps = 32/270 (11%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           MN +A+ F  S KKQ W++ SF L + +F  + G++ D+ G K  L+  +   L+    C
Sbjct: 64  MNKVAEEFEESDKKQ-WIVTSFLLTNTAFQPLYGKLSDLAGRKTALMVAHSFFLVG---C 119

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIY--KANTLRKNFVISFVGMCAPI 216
            F   + N   F + RA  G+G   I       + +I   K   + + +     G  + +
Sbjct: 120 LFTALSRNLVEFSIARAVCGMGAGGISALSSISVSDICTPKERGVYQGYANVVFGTGSML 179

Query: 217 GAALGG------VWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPT----NI 266
           G  +GG       W  + A + P     +F  Y      N+ + +  +P         NI
Sbjct: 180 GGPIGGWLMDSFGWKVIFAGQVPLIMTCMFLGYR-----NVNIKLLHVPPRHERYRWENI 234

Query: 267 HGFGMDWTGSAIGVV-GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFA 325
               +  + S IG + G +         P           L  +++  L+ F + E+ +A
Sbjct: 235 KRIDLGGSISLIGTISGFLCLCSTDLNKP----------LLATLTLLSLVLFIMNELYWA 284

Query: 326 KSPLLPPEVIKNRHIGMILLAVFMGWGSFG 355
              ++P +++        LL VF  + +FG
Sbjct: 285 PERIIPTDLLSGTFGITSLLTVFSSFIAFG 314

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 59/126 (46%), Gaps = 3/126 (2%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKG-YIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIK 336
           +    +IL      +G  +GW    +I+  ++     L  F  +E+KFA +P+ P ++IK
Sbjct: 276 VAFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIK 335

Query: 337 NRHI-GMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVA 395
           +R I G I +++F+ +  + I + Y Y   +   + S   A     +F     + AF + 
Sbjct: 336 DRGIYGGIGVSLFLEF-VYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLG 394

Query: 396 LTIKRV 401
             + +V
Sbjct: 395 FVVVKV 400

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 41/86 (47%), Gaps = 13/86 (15%)

Query: 267 HGF-----GMDWTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLI 315
           HGF      + W    IGV+      G IL       G    W    II  +++  F+LI
Sbjct: 264 HGFIQTLVQLFWKLDVIGVLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVLG-FVLI 322

Query: 316 AFFIY-EIKFAKSPLLPPEVIKNRHI 340
             +IY E K+AK P+ P +++K+R +
Sbjct: 323 PMYIYWESKWAKEPMAPFKLLKDRGV 348

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 71/156 (45%), Gaps = 13/156 (8%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFA 325
           W    +G++      G IL       G    W    +IA  ++  F+LIA FIY E K A
Sbjct: 283 WKLDVVGIILLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLG-FVLIAIFIYWESKLA 341

Query: 326 KSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAF---QLNLRHYSAVWAGGTF-F 381
            +P+ P +++K+R I   L  +F+    + +   Y Y      ++    SA      + F
Sbjct: 342 LAPIAPFKMLKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSF 401

Query: 382 MFVIWGTIAAFLVALTIKRVGPSVLLCFSMTGFTVG 417
           +  I+  +  F+VA +  R+ P ++L  S+   T+G
Sbjct: 402 VSAIFAPVLGFIVARS-SRLKPYMVLGCSLYFVTMG 436

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 36/76 (47%), Gaps = 7/76 (9%)

Query: 296 DGWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFG 355
           + W    II  LI+   L+I+F I+E  FA    +P E++ NR +          + SF 
Sbjct: 301 NEWRSPLIICFLIIGGLLIISFGIWEY-FAPVSFIPWELLTNRTVIFTYSMAAAMYCSFY 359

Query: 356 IWTFYYYAFQLNLRHY 371
           IW  Y++      RH+
Sbjct: 360 IWDSYFF------RHH 369

>Kwal_26.7984 s26 complement(598830..600668) [1839 bp, 612 aa] {ON}
           YNR055C (HOL1) - Putative ion transporter similar to the
           major facilitator superfamily of transporters [contig
           55] FULL
          Length = 612

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 69/160 (43%), Gaps = 7/160 (4%)

Query: 102 LADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFA 161
           LA+ FN S    ++L+    L      +++     ++G +   + G +V    S+ C   
Sbjct: 105 LAEEFNRSLSDISYLVGGMMLALAFGSIIASPSAVLFGKRILYLIGIIVFFFGSIGC--- 161

Query: 162 NYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALG 221
           + +H+    +  R   GLG+A I       +  IY A+   + + +    +    G  L 
Sbjct: 162 SVSHSYESLLASRIVSGLGVATIESLPSATVAEIYFAH--ERAYRLGVYTLLLLGGKNLV 219

Query: 222 GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPST 261
            + + L+     + W  +F+   I+V IN V+ ++ +P T
Sbjct: 220 PLLASLVFQSLDRYW--LFWIVTIIVGINFVLHLFFVPET 257

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 95/422 (22%), Positives = 170/422 (40%), Gaps = 51/422 (12%)

Query: 114 TWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILC 173
           +W+  ++ L S +F  + G+I DI+G K  LI   ++  +  LICG +        + L 
Sbjct: 167 SWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLS-----PGLWCL- 220

Query: 174 RAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCA---PIGAALGGVWSGLIAH 230
               G  IA I    +  + +I  ++ +       + G+C     +G A GG+  G  + 
Sbjct: 221 --VAGRFIAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFS- 277

Query: 231 ENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG---------------MDWTG 275
           E+   W   F     + AI+  + +  +   +P    G G               +DW G
Sbjct: 278 EHGGGWRVAFLIQIPLCAISCSLIVAYL--ELPKGCKGSGIQSDEDNQISEKLRRIDWFG 335

Query: 276 SAIGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAKSPLLPPEV 334
           +   VV ++LF    + G  +   +      L V++ +  A F+Y E   +K P+LP   
Sbjct: 336 ALSLVVFLLLFMLASSLGGKELPFQSNGFYALCVAIVVGGATFVYVETYVSKDPILPVAF 395

Query: 335 IKNRHIGMILLA---VFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAA 391
           +KNR I    LA     MG  +   +   Y+A  LN++           F     G++ A
Sbjct: 396 LKNRTILGSSLANWFSMMGMMTTSYFLPVYWAGVLNMKPTDMGKRTIPSFFSTALGSLGA 455

Query: 392 FLVALTIKRVGPSVLLCFSMTGFT-VGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFP 450
                 +K+ G    L  +      VG + +S+   + + W+  + + +I  FG+ +   
Sbjct: 456 ---GYYMKKTGKYKWLLMAFCALAVVGQLQISLIEPNIAVWRQYI-LLVIPGFGLSVLIT 511

Query: 451 ASSIILSDFLPSQYQGMAGSLVNTMVNYSTSLCLGV-----------GSTAEAQVNKNGT 499
            + + +   +P ++Q    S+  +    ST   LGV           GS  E  V K  +
Sbjct: 512 VTLLAMIAAVPHEHQAATTSI--SYAFRSTGCTLGVSIGGAIFRKSLGSLLERNVMKLAS 569

Query: 500 DK 501
           DK
Sbjct: 570 DK 571

>Kwal_23.4824 s23 (883258..884919) [1662 bp, 553 aa] {ON} YNL065W
           (AQR1) - multidrug resistance transporter [contig 5]
           FULL
          Length = 553

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 38/224 (16%), Positives = 88/224 (39%), Gaps = 8/224 (3%)

Query: 3   LSDSESECTKTITRDHITINQEA---EYTKNDQTNVEEKKNCSTESEAEWCSESEFTDND 59
           LS+S+++    + ++   +N +    +Y ++  + V   +   + SE+    +    +  
Sbjct: 11  LSESDAQSANHLEKEVHQLNHDGNKHKYEQDAPSRVTTHEMKGSSSESIEGHDIAHDNAP 70

Query: 60  TPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMAS 119
            P   P    +  Q++  ++                   +  L   F+ S +     +  
Sbjct: 71  LPQHAPYTLLSNAQKWCMVALLTSAGFWSSLGSPIYYPALKQLEKQFSVSEELVNITVVV 130

Query: 120 FPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGL 179
           + +  G    +SG + D+YG +  ++ G L+ +  S+    +N   +    +  R  Q  
Sbjct: 131 YLIFQGVAPTISGGLADVYGRRPVILIGMLIYVCASIGLACSN---SYGVIVFLRCLQSA 187

Query: 180 GIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGV 223
           GI+ I+    G++G+ +     R  FV +  G    +G A G +
Sbjct: 188 GISPIIAINSGVVGD-FTVKQERGTFVGAVSGFTL-MGQAFGSL 229

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 60/135 (44%), Gaps = 6/135 (4%)

Query: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           G +L  F    G    W   +II   ++  V  L  + ++E+KF+K PL P  ++K+R +
Sbjct: 284 GCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGV 343

Query: 341 GMILLAVFM---GWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396
              L+   M    W   G + +      ++    SA      + F+ V+ GT    LV +
Sbjct: 344 FSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGT-GLGLVLI 402

Query: 397 TIKRVGPSVLLCFSM 411
            ++R  P ++   SM
Sbjct: 403 KVRRTKPFIIFGISM 417

>TDEL0C00120 Chr3 complement(7481..9190) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 64/301 (21%), Positives = 116/301 (38%), Gaps = 39/301 (12%)

Query: 113 QTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFIL 172
            +W+  ++ + S SF  + G   D  G +  L        I  L CG +    N      
Sbjct: 92  SSWITTAYLITSTSFQPLYGSFSDALGRRNCLFFANTSFTIGCLACGLS---PNIVVLSF 148

Query: 173 CRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHEN 232
            RA  G+G   ++   +  I N     + ++    +F  +   +GA  G  + G IA  +
Sbjct: 149 MRALTGIGGGGLI--TLSTIVNSDMIPSSKRGIFQAFQNLLLGLGAICGASFGGSIA--S 204

Query: 233 PKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFG-----------MDWTGSAIGVV 281
              W W F+    +   N ++    +P+         G           +D TGS   ++
Sbjct: 205 SIGWRWCFFVQVPICITNSLIMSSYVPNQKEYEDREIGFLFHPKKILKDIDVTGSVFIII 264

Query: 282 GMILFNFVWNQGPID---GWNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNR 338
           G+ L     + G       W    ++ LL  S  +L+ F   E K +   ++P E++++ 
Sbjct: 265 GLTLQLLYLSLGSSKVGVSWTSPSVLPLLFASGIILVLFVYNEAKTSARAIIPLELMRSS 324

Query: 339 HIGMIL-LAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTFFMFVIWGTIAAFLVALT 397
              ++L +++ +G+ S      Y Y F L L           FF  V+  + A   + LT
Sbjct: 325 FSFVVLTISILVGFAS------YAYLFTLPL-----------FFQIVLGDSTAKAGLRLT 367

Query: 398 I 398
           I
Sbjct: 368 I 368

>NCAS0G02990 Chr7 complement(549460..551205) [1746 bp, 581 aa] {ON} 
          Length = 581

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 56/282 (19%), Positives = 109/282 (38%), Gaps = 40/282 (14%)

Query: 4   SDSESECTKTITRDHITINQ-----EAEYTKN---------DQTNVEEKKNCSTESEAEW 49
            + E+   + +TR++   N+     EA  +K+          +    E    S +S  E 
Sbjct: 10  DEDEAGSIENLTREYTGDNKPKELIEAVASKDGLYHLNGTLSRATTREIDGDSLQSSDEE 69

Query: 50  CSESEFTDNDTPWQNPTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSS 109
            +E + +++ +P+   TY   +W   A ++ C                 +  L   F   
Sbjct: 70  KNE-QASESTSPYTLLTY-KQKWGMVALLTMC---GFWSSLGSPIYYPALRQLEKQFGLD 124

Query: 110 AKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAF 169
             K    +  + L  G    +SG + D++G +  ++ G L+ ++ S+  G A    +   
Sbjct: 125 ENKVNVTVVVYLLFQGIAPTISGGLADVFGRRPVILIGMLIYVVASI--GLA-CAPSYGV 181

Query: 170 FILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFV-----ISFVGMC--APIGAALGG 222
            +  R  Q +GI+  +    G++G+ +     R  FV     +  +G C  + IGA L  
Sbjct: 182 IVFLRIIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGLVLLGQCFGSLIGAVLAA 240

Query: 223 VWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPT 264
            W+          W  IF+   I    + ++A   +P T  T
Sbjct: 241 AWN----------WRAIFWFLTIGCGTSFIIAFLLLPETKRT 272

>SAKL0D11000g Chr4 (910457..912430) [1974 bp, 657 aa] {ON} similar
           to uniprot|P25351 Saccharomyces cerevisiae YCR023C
           Hypothetical ORF
          Length = 657

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 47/196 (23%), Positives = 79/196 (40%), Gaps = 21/196 (10%)

Query: 110 AKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAF 169
           +K   +L ++F L      L  G+  D YG K  L  G       SLI GF+   +   F
Sbjct: 101 SKYSGYLSSTFALCQVLSSLQWGKFSDKYGRKPALFIGLCGTCASSLILGFSQNFYQALF 160

Query: 170 FILCRAFQGL--GIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGL 227
               R+  GL  G   +L  V+G + +  +   L  + +       + IG  +GG +S  
Sbjct: 161 ---ARSLMGLLNGNVAVLRTVIGEVASERRHQALAFSTMPLLFQFGSVIGPMIGGFFSFP 217

Query: 228 IAHENPKQWP-WIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIGVVGMILF 286
              +N K+ P W+    A +V           P ++P  +  F +      IG++  +L 
Sbjct: 218 KGSDNNKEVPKWLPKPIAKMVE--------KYPYSMPNIVICFLL-----IIGLINAVL- 263

Query: 287 NFVWNQGPIDGWNKGY 302
            F+    P+  + K Y
Sbjct: 264 -FLEETHPVYKYRKDY 278

>CAGL0J00363g Chr10 (27627..29123) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P38776 Saccharomyces cerevisiae
           YHR048w
          Length = 498

 Score = 32.3 bits (72), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 28/128 (21%), Positives = 52/128 (40%), Gaps = 8/128 (6%)

Query: 134 IGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIG 193
           I ++YG + T +    + +IW  +  ++       F      F G   +  L    G I 
Sbjct: 116 ISELYGRRITFVSSLFLSIIWQCLTTWSKTIEGVLFGRFLSGFFG---SVFLSVAGGAIS 172

Query: 194 NIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVM 253
           +I+    +     ++     A +G +LG + SG + H N K   W F    I   + + +
Sbjct: 173 DIFSKKQI--GIPMAIYTTAAFLGPSLGPIISGALYHANYK---WTFVTLLIASGVCLTL 227

Query: 254 AIYSIPST 261
            + S+P T
Sbjct: 228 IVISVPET 235

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 5/124 (4%)

Query: 298 WNKGYIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIW 357
           W  G +IA  ++   L+ AF  +E + A+ PL P  ++K+R I   L   F+    + + 
Sbjct: 313 WRSGKVIAPFVLGFSLIPAFVYWESRLARFPLAPFLMLKDRGIWAPLWIYFLIAFIYEMA 372

Query: 358 TFYYYAFQL---NLRHYSAVWAGGTF-FMFVIWGTIAAFLVALTIKRVGPSVLLCFSMTG 413
             Y Y   L   N    SA+     + F+  I+  I   LVA +  R+ P  ++  S+  
Sbjct: 373 AEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGLLVARS-SRLKPYTVVGCSLYF 431

Query: 414 FTVG 417
            T+G
Sbjct: 432 VTMG 435

>SAKL0H09328g Chr8 (791744..793534) [1791 bp, 596 aa] {ON} similar
           to uniprot|P38125 Saccharomyces cerevisiae YBR180W DTR1
           Multidrug resistance dityrosine transporter of the major
           facilitator superfamily essential for spore wall
           synthesis facilitates the translocation of bisformyl
           dityrosine through the prospore membrane
          Length = 596

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 49/243 (20%), Positives = 96/243 (39%), Gaps = 9/243 (3%)

Query: 21  INQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFIST 80
           I  E +  K  +  ++ +K  +T +  E   E+     +   + P Y A   ++   I  
Sbjct: 87  IESEEDIEKKSKEELKIEKRIATATSTE---ETSLKSANRSKEPPPYTAFSKKQRLIIFL 143

Query: 81  CMXXXXXXXXXXXXXTAP-MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYG 139
            +               P + +L ++FN SA      ++ F  V     L      D  G
Sbjct: 144 VIIYVGFLGPLSGNIYIPALPLLQESFNVSATTINATVSVFMAVFSVGPLFWALFADFGG 203

Query: 140 LKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKAN 199
            K   I   L+ +I +++   A  T+  A F L R  Q  G + ++   +G + +I    
Sbjct: 204 RKFLYIVSLLLTIIVNILLS-AVPTNIGALFFL-RIAQAFGSSSVMSLGIGTVSDITPPK 261

Query: 200 TLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIP 259
           +  +   +S+  +   +G  L  + +GLI   +   W W+F    I+  I + + +  +P
Sbjct: 262 S--RGRAVSYFMLGPNMGPILAPIIAGLILMSS-NNWRWLFGFICIISGIALFLVVLLLP 318

Query: 260 STV 262
            T+
Sbjct: 319 ETL 321

>KLTH0G09372g Chr7 (780184..781839) [1656 bp, 551 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065W AQR1
           Plasma membrane transporter of the major facilitator
           superfamily that confers resistance to short- chain
           monocarboxylic acids and quinidine
          Length = 551

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 47/244 (19%), Positives = 95/244 (38%), Gaps = 9/244 (3%)

Query: 22  NQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTYFANRWQEYAFISTC 81
           N +    ++  + V  ++   + S++    ES   ++  P   P    +  Q++  ++  
Sbjct: 33  NTKKLLPQDAASRVTTREMRESSSDSRDRVESSGVNSKLPQGAPFTLLSHGQKWFMVALL 92

Query: 82  MXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLK 141
                            +  L   FN S +     +  + +  G    +SG + D+YG +
Sbjct: 93  TSAGFWSSLGSPIYYPALKQLEKKFNVSEEMVNITVVVYLIFQGIAPTISGGLADVYGRR 152

Query: 142 KTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTL 201
             ++ G L+ +  S+  G A  + +    +  R  Q  GI+ I+    G++G+ +     
Sbjct: 153 PVILMGMLIYVCASI--GLA-CSQSYGVIVFLRCLQSAGISPIIAINSGVVGD-FTLKHE 208

Query: 202 RKNFVISFVGMCAPIGAALGG-VWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPS 260
           R  FV +  G    +G A G  + + L A  +   W  IF+   I     M++    +P 
Sbjct: 209 RGTFVGAVSGFTL-MGQAFGSLIGAALTAAFD---WRAIFWFLTIGCGTCMIINFLILPE 264

Query: 261 TVPT 264
           T  T
Sbjct: 265 TKRT 268

>YAL067C Chr1 complement(7235..9016) [1782 bp, 593 aa] {ON}
           SEO1Putative permease, member of the allantoate
           transporter subfamily of the major facilitator
           superfamily; mutation confers resistance to ethionine
           sulfoxide
          Length = 593

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 152 LIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG---LIGNIYKANTLRKNFVIS 208
           L WSL+   A Y ++       R F G   AF  P+ +    L G+ YK + + +     
Sbjct: 212 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 268

Query: 209 FVGMCAPIGAALG---GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIP 259
           ++G    I +A G    V+S L      + W W F   AIV  +  ++  YS+P
Sbjct: 269 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLP 322

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 7/127 (5%)

Query: 115 WLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCR 174
           WL+  + L S  F L+ GR+  + GLK  L+   L+  I SLI   +N   +    I  R
Sbjct: 82  WLVTGYSLSSALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSN---SMGMLIAGR 138

Query: 175 AFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPK 234
              G G + I  +++ ++G    +   R   ++  V   A +G+  GG   G   +E+  
Sbjct: 139 VVAGAGGSGI-QSLVYIVGTSLVSE--RSRGMVIMVLTFAFVGSNAGGPILGGALNEH-A 194

Query: 235 QWPWIFY 241
            W W F+
Sbjct: 195 SWRWCFF 201

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 32.0 bits (71), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 60/147 (40%), Gaps = 14/147 (9%)

Query: 269 FGMDWTGSAIGVVGMILFNFVWNQGPID-GWNKGYIIALLIVSVFLLIAFFIYEI----K 323
           F  D+ G A+   G++LF      G     WN G +IA L++ V L I   +Y+     K
Sbjct: 129 FKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLGVLLFIFSLVYDFFLFDK 188

Query: 324 F-------AKSPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQLNLRHYSAVWA 376
           F       +  PLL   ++    I +I +  F+    +     Y   F   L   S+ W 
Sbjct: 189 FNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGYNGQMIYSVQF-FQLIFASSAWK 247

Query: 377 GGTFFM-FVIWGTIAAFLVALTIKRVG 402
            G   +  VI   IAA    +  K++G
Sbjct: 248 AGLHLIPIVITNVIAAIASGVITKKLG 274

>SAKL0C11066g Chr3 complement(998593..1000335) [1743 bp, 580 aa]
           {ON} similar to uniprot|P30605 Saccharomyces cerevisiae
           YDR497C
          Length = 580

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 33/53 (62%), Gaps = 4/53 (7%)

Query: 414 FTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSIILSDFLPSQYQG 466
           F +G I+ + T   +S+W+M  G ++++ FG+ +    S + +S+  PS+Y+G
Sbjct: 158 FLIGAILQACT---RSFWQMAAG-RLLMGFGIGIGSLLSPLFISEIAPSEYRG 206

>NDAI0B03770 Chr2 complement(947945..949660) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 38/169 (22%), Positives = 74/169 (43%), Gaps = 13/169 (7%)

Query: 99  MNILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLIC 158
           ++++ + FN + +     +  + +  G    + G + D  G +  ++     VL++   C
Sbjct: 102 LSVIENEFNITEEMVNITVVVYFIFQGIAPSIMGGLADSMGRRPVVLSS---VLVYCCAC 158

Query: 159 GFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGA 218
                +H  A  I+ R  Q  GI+ ++    G++G+I       +   + +V     IG+
Sbjct: 159 IGLACSHTYAQIIVLRCLQAAGISPVIAINSGIMGDI--TTRAERGGYVGYVSGFQVIGS 216

Query: 219 ALGG-VWSGLIAHENPKQWPW--IFYAYAIVVAINMVMAIYSIPSTVPT 264
           A G  + +GL A      W W  IF+  AI   + +V +I  +P T  T
Sbjct: 217 AFGALIGAGLSA-----TWSWRSIFWFLAIGSGVCLVASIIILPETKRT 260

>NCAS0A02450 Chr1 complement(463760..469546) [5787 bp, 1928 aa] {ON}
           Anc_4.238 YDL058W
          Length = 1928

 Score = 32.0 bits (71), Expect = 4.9,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 4/60 (6%)

Query: 2   ELSDSESECTKTITRDHITINQEAEYTKNDQTNVEEKKNCSTESEAEWCSESEFTDNDTP 61
           +LSD  +E  K ITR    +N+E    +N   ++E +KN   +   EW S+ +  DN  P
Sbjct: 873 QLSDKLNEKEKDITR----LNEELATLENTVKSLESEKNEKRKEVEEWKSKFQNHDNLVP 928

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 281 VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFI-YEIKFAKSPLLPPEVIKNR 338
           +G +L  F    G  D W   +II   ++   +    F+ +E K+A+ PL P  ++K+R
Sbjct: 271 LGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLLKDR 329

>YNL065W Chr14 (503724..505484) [1761 bp, 586 aa] {ON}  AQR1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, confers resistance to short-chain
           monocarboxylic acids and quinidine; involved in the
           excretion of excess amino acids
          Length = 586

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 63/286 (22%), Positives = 98/286 (34%), Gaps = 46/286 (16%)

Query: 9   ECTKTITRDHITINQEAEYTKNDQTNVEEK---------------KNCSTESEAEWCSES 53
           E   T    H+T     EYTK D     EK               K  + E E +  SE+
Sbjct: 13  EMYPTHNEQHLT----REYTKPDGQTKSEKLNFEGAYINSHGTLSKTTTREIEGDLDSET 68

Query: 54  EFTDNDT---PWQNPT----------YFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMN 100
               +D    P Q  T           +  +W   A ++ C                 + 
Sbjct: 69  SSHSSDDKVDPTQQITAETKAPYTLLSYGQKWGMVAILTMC---GFWSSLGSPIYYPALR 125

Query: 101 ILADAFNSSAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGF 160
            L   FN         +  + L  G    VSG + D +G +  ++ G L+ +I S+  G 
Sbjct: 126 QLEKQFNVDENMVNVTVVVYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVIASI--GL 183

Query: 161 ANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAAL 220
           A    +    I  R  Q +GI+  +    G++G+ +     R  FV +  G        L
Sbjct: 184 A-CAPSYGVIIFLRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGF-----VLL 236

Query: 221 GGVWSGLIAHENPKQWPW--IFYAYAIVVAINMVMAIYSIPSTVPT 264
           G  +  LI      +W W  IF+   I      ++A   +P T  T
Sbjct: 237 GQCFGSLIGAVLTARWDWRAIFWFLTIGCGSCFLIAFLILPETKRT 282

>Smik_14.262 Chr14 (484135..485820) [1686 bp, 561 aa] {ON} YNL065W
           (REAL)
          Length = 561

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 57/268 (21%), Positives = 95/268 (35%), Gaps = 24/268 (8%)

Query: 9   ECTKTITRDHITINQEAEYTKNDQT-NVEEKKNCSTESEAEWCSESEFTDNDTPWQNPTY 67
           E TK        +N E  YT +  T +    +    + E+E  S S     D+  Q  T 
Sbjct: 26  EYTKPNDEKSEKVNFEGAYTNSHGTLSKATTREIEGDLESETSSHSGDVKGDSTQQITTE 85

Query: 68  ---------FANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMA 118
                    +  +W   A ++ C                 +  L   FN         + 
Sbjct: 86  IGAPYTLLSYGQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENMVNVTVV 142

Query: 119 SFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQG 178
            + L  G    VSG + D +G +  ++ G L+ ++ S+  G A    +    I  R  Q 
Sbjct: 143 VYLLFQGISPTVSGGLADCFGRRPIILAGMLIYVVASI--GLAC-APSYGVIIFLRCIQS 199

Query: 179 LGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPW 238
           +GI+  +    G++G+ +     R  FV +  G        LG  +  LI      +W W
Sbjct: 200 IGISPTIAISSGVVGD-FTLKHERGTFVGATSGF-----VLLGQCFGSLIGAVLTARWDW 253

Query: 239 --IFYAYAIVVAINMVMAIYSIPSTVPT 264
             IF+   I      ++A   +P T  T
Sbjct: 254 RSIFWFLTIGCGSCFLIAFLILPETKRT 281

>ZYRO0F02178g Chr6 (176789..178576) [1788 bp, 595 aa] {ON} similar
           to gnl|GLV|DEHA0A14894g Debaryomyces hansenii
           DEHA0A14894g and weakly similar to YLL028W
           uniprot|Q07824 Saccharomyces cerevisiae YLL028W TPO1
           Proton- motive-force-dependent multidrug transporter of
           the major facilitator superfamily able to transport
           eight different compounds including polyamines quinidine
           cycloheximide and nystatin involved in excess spermidine
           detoxification
          Length = 595

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 52/114 (45%), Gaps = 8/114 (7%)

Query: 153 IWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGM 212
           +W ++ G A    N    I+ R   G+ +A      +G+  +++  +     + ++FV +
Sbjct: 194 VWQILGGLAP---NFGSIIVARFLGGISLAG-GSVTLGVAADMW--DPADHGYAVAFVVL 247

Query: 213 CAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNI 266
           C+  G  +G ++ GL+  E    W W F+   I   +  V+  + +P T  T I
Sbjct: 248 CSVGGTVIGPIFGGLM--EEHLSWHWNFWIQLIFNGVTQVLHFFIVPETRSTVI 299

>Smik_1.1 Chr1 complement(4254..6038) [1785 bp, 594 aa] {ON} YAL067C
           (REAL)
          Length = 594

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 50/114 (43%), Gaps = 9/114 (7%)

Query: 152 LIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMG---LIGNIYKANTLRKNFVIS 208
           L WSL+   A Y ++       R F G   AF  P+ +    L G+ YK + + +     
Sbjct: 213 LCWSLLTVGAAYVNSVPHLKAIRFFIG---AFEAPSYLAYQYLFGSFYKHDEMVRRSAFY 269

Query: 209 FVGMCAPIGAALG---GVWSGLIAHENPKQWPWIFYAYAIVVAINMVMAIYSIP 259
           ++G    I +A G    V+S L      + W W F   AIV  +  ++  Y++P
Sbjct: 270 YLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYALP 323

>TBLA0B04480 Chr2 (1029953..1031779) [1827 bp, 608 aa] {ON}
           Anc_8.570 YBR180W
          Length = 608

 Score = 31.6 bits (70), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 55/291 (18%), Positives = 106/291 (36%), Gaps = 20/291 (6%)

Query: 4   SDSESECT--KTITRDHITINQEAEYTKN--DQTNVEEKKNCSTES----EAEWCSESEF 55
           ++  S+C+  +   R   +INQ +  T+   D +N +       E+    E  + +E+E 
Sbjct: 48  NEENSDCSPIRNTPRIQESINQTSTETERLLDGSNSKISTKIEIENKLSNEFAYSTETEI 107

Query: 56  TDNDTPWQN-------PTYFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNS 108
                P Q        P     + Q++      +                + IL + F  
Sbjct: 108 EKQSVPEQAVPITEEIPYTKFTKAQQFVIFCIIVYIGFLGPMCGNIYIPALPILQEEFQV 167

Query: 109 SAKKQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDA 168
           +       ++ F  +     LV G   D  G K   I    +  + +++   A+   N  
Sbjct: 168 TTTTINGTVSIFMGLFAFMPLVWGMFADFGGRKFLYIISLFIFTVANIL--LASLPANII 225

Query: 169 FFILCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLI 228
              L R  Q +G +  +    G + +I       K+  +  +G    +G  +  + +GLI
Sbjct: 226 ALYLVRVLQVVGASAAISLGTGTVADISPPKHRGKSVALFMLG--PNMGPIIAPIIAGLI 283

Query: 229 AHENPKQWPWIFYAYAIVVAINMVMAIYSIPSTVPTNIHGFGMDWTGSAIG 279
              N  QW W+F   AI   + +++ I  +P T+   +      W+ S  G
Sbjct: 284 LM-NSNQWRWLFGFSAICTGVALMIVIVILPETLRCIVGNNDPKWSRSQRG 333

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 55/238 (23%), Positives = 100/238 (42%), Gaps = 39/238 (16%)

Query: 132 GRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFILCRAFQGLGIAFILPNVMGL 191
            R  DI+  + +++   L  ++ ++I   A      A + +     G+G A I+     L
Sbjct: 132 ARASDIFSREFSMVISILFYVVGTIISSQATSV---AKYAVGACIYGIGHAGIV-----L 183

Query: 192 IGNIYKANTLRKNFVISFVGMCAPIGAALGGVW-SGLIAHENPKQWPW-------IFYAY 243
           +  IY A+    N+ +  V   AP+  A+   W SG I  +   +W W       IF A 
Sbjct: 184 LCEIYMADFSNLNWRV--VAENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPAS 241

Query: 244 AIVVAI-------------NMVMAIYSIPSTVP-----TNIHGFGMDWTGSA--IGVVGM 283
            I + +               +  I+  PS +       +I  + +D+ G    + V  +
Sbjct: 242 CIPLFVCIYHMRYMAKKNNEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFAL 301

Query: 284 ILFNFVWNQGPIDGWNKG-YIIALLIVSVFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340
           IL  F  + G    WN   +I+  ++  V  L  F ++E KF++ P+L  ++I +R I
Sbjct: 302 ILVPFTTSGGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGI 359

>SAKL0A02310g Chr1 complement(215994..217163) [1170 bp, 389 aa] {ON}
           highly similar to uniprot|P23644 Saccharomyces
           cerevisiae YMR203W TOM40 Essential component of the
           preprotein translocase of the mitochondrial outer
           membrane (TOM complex) in which it constitutes the core
           element of the protein conducting pore
          Length = 389

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 31/61 (50%), Gaps = 7/61 (11%)

Query: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454
           +L  K + PS+      TG  VG I+ SVTP      ++ LG++ I S G   + PA S 
Sbjct: 179 SLNFKTLNPSISSTGLFTGVAVGSILQSVTP------QLALGLETIYSRGQS-AMPADSA 231

Query: 455 I 455
           +
Sbjct: 232 V 232

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 31.6 bits (70), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 29/134 (21%), Positives = 56/134 (41%), Gaps = 15/134 (11%)

Query: 112 KQTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFI 171
           K  WL   + L +   +L+ GRI  + G K + +   ++  + SL+   AN        I
Sbjct: 79  KVGWLFTGYSLPNALLVLIWGRIATLVGFKTSTLAAIVIFEVGSLVSALANSMD---MLI 135

Query: 172 LCRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFV----GMCAPIGAALGGVWSGL 227
             R   G+G + +   V  +   + +     +  +I+ +    G+ + +G  LGG ++  
Sbjct: 136 GGRVIAGIGGSGVQSLVFVISSTLVEERN--RGLIIAVMSSSFGIASVVGPFLGGAFTTH 193

Query: 228 IAHENPKQWPWIFY 241
           +       W W FY
Sbjct: 194 VT------WRWCFY 201

>KLLA0F06292g Chr6 complement(613470..614633) [1164 bp, 387 aa] {ON}
           highly similar to uniprot|P23644 Saccharomyces
           cerevisiae YMR203W TOM40 Essential component of the
           preprotein translocase of the mitochondrial outer
           membrane (TOM complex) in which it constitutes the core
           element of the protein conducting pore
          Length = 387

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 7/61 (11%)

Query: 395 ALTIKRVGPSVLLCFSMTGFTVGCIMLSVTPVHQSYWKMNLGMQIILSFGMDLSFPASSI 454
           +L  K + PS     S TG  VG I+ S+TP      ++ +G++ I S G  +S PA + 
Sbjct: 178 SLNFKTLNPSAASDGSFTGVAVGSILQSITP------QLAIGLEAIYSKGQAMS-PADAA 230

Query: 455 I 455
           +
Sbjct: 231 V 231

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 136 DIYGLKKTLIGGYLVVLIWSLICGFANYTHND----AFFILCRAFQGLG---IAFILP 186
           DI G K   + G++++ I   + GFA +   D    A +++C+ FQ  G     FI+P
Sbjct: 413 DIIGRKPIQLAGFIILTILFCVIGFAYHKIGDHGLLALYVICQFFQNFGPNTTTFIVP 470

>Skud_14.267 Chr14 (493984..495672) [1689 bp, 562 aa] {ON} YNL065W
           (REAL)
          Length = 562

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 58/274 (21%), Positives = 99/274 (36%), Gaps = 39/274 (14%)

Query: 15  TRDHITINQEAEYTKNDQTNVEE---------KKNCSTESEAEWCSESEFTDNDT---PW 62
           TR++   N E   TK+++ N+E           K  + E E +  SE+     D    P 
Sbjct: 24  TREYTIPNGE---TKSEKLNLEGGYVNSHGTLSKATTREIEGDLESETSSHSGDDKIDPQ 80

Query: 63  QNPT----------YFANRWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKK 112
           Q  T           +  +W   A ++ C                 +  L   FN     
Sbjct: 81  QQITAETGAPYTLLSYGQKWGMVAILTMC---GFWSSLGSPIYYPALRQLEKQFNVDENM 137

Query: 113 QTWLMASFPLVSGSFILVSGRIGDIYGLKKTLIGGYLVVLIWSLICGFANYTHNDAFFIL 172
               +  + L  G    +SG + D +G +  ++ G L+ ++ S+  G A    +    I 
Sbjct: 138 INITVVVYLLFQGVSPTISGGLADCFGRRPIILAGMLIYVVASI--GLAC-APSYGVIIF 194

Query: 173 CRAFQGLGIAFILPNVMGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHEN 232
            R  Q +GI+  +    G++G+ +     R  FV +  G        LG  +  LI    
Sbjct: 195 LRCIQSIGISPTIAISSGVVGD-FTLKHERGTFVGATSGF-----VLLGQCFGSLIGAVL 248

Query: 233 PKQWPW--IFYAYAIVVAINMVMAIYSIPSTVPT 264
             +W W  IF+   I      ++A   +P T  T
Sbjct: 249 TARWDWRSIFWFLTIGCGSCFLIAFLVLPETKRT 282

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 31.2 bits (69), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 278 IGVVGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIY-EIKFAKSPLLPPEVIK 336
           +GV G++L       G    WN+  II   ++   L +  +++ E KFAK P++  E ++
Sbjct: 286 VGVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFAKYPIIKLETVR 345

Query: 337 NRHI 340
           +  I
Sbjct: 346 DSGI 349

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 47/97 (48%), Gaps = 8/97 (8%)

Query: 273 WTGSAIGVV------GMILFNFVWNQGPIDGWNKG-YIIALLIVSVFLLIAFFIYEIKFA 325
           W    +G++      G+IL  F   +     W K  YI+  ++     L  + I+E  FA
Sbjct: 278 WRVDVVGLILLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFA 337

Query: 326 KSPLLPPEVIKNRHI-GMILLAVFMGWGSFGIWTFYY 361
           + PL P   +K+R I G +L+++F+ +  +   T+ Y
Sbjct: 338 RFPLTPLATVKDRGIYGALLVSLFIDFVYYMQHTYLY 374

>KLTH0E13222g Chr5 complement(1175450..1177150) [1701 bp, 566 aa]
           {ON} similar to uniprot|P38125 Saccharomyces cerevisiae
           YBR180W DTR1 Multidrug resistance dityrosine transporter
           of the major facilitator superfamily essential for spore
           wall synthesis facilitates the translocation of
           bisformyl dityrosine through the prospore membrane
          Length = 566

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 57/289 (19%), Positives = 108/289 (37%), Gaps = 27/289 (9%)

Query: 18  HITINQEAEYTKNDQ--TNVE---EKKNCSTESEAEWCSESEFTDNDTPWQNPTY--FAN 70
           H  +N+     +N +  TNV+   EK++ S + + E     +   N +   +P Y  F+ 
Sbjct: 45  HRAVNEGPSNPENRENITNVDIESEKEHPSGKLKEEELKTEDADQNLSEQPDPPYTAFSQ 104

Query: 71  RWQEYAFISTCMXXXXXXXXXXXXXTAPMNILADAFNSSAKKQTWLMASFPLVSGSFILV 130
           R     FI                  A + IL + F  SA      ++ F  V     L+
Sbjct: 105 RQVLVIFIIVIFVGFLGPLSGNIYIPA-LPILQNVFGLSATAINATVSVFMAVFAVGPLI 163

Query: 131 SGRIGDIYGLKKTLIGGYLVVLIWSLICG--FANYTHNDAFFILCRAFQGLGIAFILPNV 188
                D +G +K L   Y++ L+ +++     A+   N       R  Q    + ++   
Sbjct: 164 WASFAD-FGGRKIL---YMISLLMTVVVNVLLASVPVNVGALFTLRVVQAFASSSVMALG 219

Query: 189 MGLIGNIYKANTLRKNFVISFVGMCAPIGAALGGVWSGLIAHENPKQWPWIFYAYAIVVA 248
            G + +I       K   I++  +   +G  L  + +GLI       W W+F    I+  
Sbjct: 220 AGTVSDIRPPKVRGK--AIAYFMLGPNMGPILAPIIAGLILMHG-SYWRWLFGFTCILSG 276

Query: 249 INMVMAIYSIPSTVPTNIHGFGMDWTG----------SAIGVVGMILFN 287
             ++M +  +P T+   +    + W              I V G+++F+
Sbjct: 277 FGLLMVVVLLPETLRCIVGNGDIKWRDCEEKDNIGPTRTISVAGLLIFS 325

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 7/58 (12%)

Query: 136 DIYGLKKTLIGGYLVVLIWSLICGFANYTHND----AFFILCRAFQGLG---IAFILP 186
           D+ G K   + G++++ I   + GFA +   D    A +++C+ FQ  G     FI+P
Sbjct: 412 DVIGRKPIQLAGFIILTILFCVIGFAYHKIGDHGLLALYVICQFFQNFGPNTTTFIVP 469

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score = 30.8 bits (68), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 38/100 (38%), Gaps = 16/100 (16%)

Query: 273 WTGSAIGV------VGMILFNFVWNQGPIDGWNKGYIIALLIVSVFLLIAFFIYEIKFAK 326
           W    +GV      VG IL       G    W    II   ++   L+  F  +E + A 
Sbjct: 282 WKLDVVGVLLFTAGVGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVLVPGFIYWESRLAL 341

Query: 327 SPLLPPEVIKNRHIGMILLAVFMGWGSFGIWTFYYYAFQL 366
            P  P +++K+R +          W   GI  F  + +Q+
Sbjct: 342 VPFAPFKLLKDRGV----------WAPLGIMFFICFVYQM 371

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.449 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,428,187
Number of extensions: 2266490
Number of successful extensions: 9048
Number of sequences better than 10.0: 296
Number of HSP's gapped: 9214
Number of HSP's successfully gapped: 314
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)