Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002508.845ON1237123762480.0
KAFR0B039508.845ON1246103319260.0
NCAS0C003908.845ON1164114118670.0
TDEL0B005308.845ON1301117618440.0
ZYRO0G14278g8.845ON1250110418310.0
SAKL0D01342g8.845ON1270108318220.0
KLTH0C03762g8.845ON1206109817830.0
Kwal_27.102328.845ON1209123516790.0
NDAI0K003908.845ON1495113016320.0
Suva_13.4688.845ON141889516190.0
YMR280C (CAT8)8.845ON143390115650.0
Smik_13.4938.845ON1433123015590.0
Skud_13.4528.845ON143290115560.0
CAGL0M03025g8.845ON1254108715020.0
KLLA0D01452g8.845ON144574115140.0
ABL121C8.845ON1285105214291e-175
Ecym_46168.845ON157784111651e-135
SAKL0D05654g1.277ON919682267e-18
AFR096W1.277ON852492258e-18
Ecym_63401.277ON952492213e-17
Kpol_1016.201.277ON1086512152e-16
KLLA0F14322g1.277ON717592113e-16
ZYRO0G15136g1.277ON1027492098e-16
KLTH0D03564g1.277ON862502052e-15
Suva_6.1611.277ON832732042e-15
TPHA0I028201.277ON1044532043e-15
Kwal_26.7397singletonOFF201491893e-15
YJL089W (SIP4)1.277ON829531981e-14
KAFR0A014801.277ON725491962e-14
Skud_10.1251.277ON833531962e-14
Smik_10.1531.277ON829531935e-14
TDEL0D014501.277ON945491901e-13
KNAG0B018401.277ON10721011901e-13
NDAI0G055301.277ON1186491892e-13
TBLA0D054201.277ON757491802e-12
CAGL0L03377g1.277ON1209491812e-12
NCAS0A094101.277ON932491676e-11
KNAG0E017602.231ON9022171409e-08
KNAG0D006906.279ON875551354e-07
SAKL0G11902g5.235ON906711354e-07
NDAI0F012206.279ON960481328e-07
Smik_12.775.235ON903511283e-06
NDAI0I023505.235ON889481273e-06
Smik_6.4526.279ON878451273e-06
YPL248C (GAL4)6.279ON881451273e-06
TPHA0F013802.231ON8902291274e-06
KLLA0C10923g5.235ON775491255e-06
YLR014C (PPR1)5.235ON904611255e-06
Kwal_23.29055.235ON881591256e-06
TDEL0E039105.235ON862581246e-06
Skud_12.825.235ON899601247e-06
Kpol_1018.306.279ON881471247e-06
NCAS0D041906.279ON890431248e-06
KAFR0J006905.235ON864491231e-05
NCAS0D025405.235ON890481231e-05
KLTH0G07898g5.235ON866581221e-05
Kpol_495.213.109ON1085861221e-05
NCAS0G011006.279ON935471221e-05
Suva_16.596.279ON895431212e-05
Smik_11.2102.547ON1169891212e-05
Skud_11.1902.547ON1171891212e-05
TBLA0G018006.279ON1154521212e-05
SAKL0E08998g2.231ON8232211202e-05
TDEL0C044802.231ON8522251192e-05
TPHA0H019806.279ON993531193e-05
Suva_10.945.235ON906481193e-05
ZYRO0A10956g5.235ON855721193e-05
NDAI0C034505.59ON7762861184e-05
TBLA0G026102.231ON10001761174e-05
KAFR0F014901.128ON6582641175e-05
KLTH0H02684g6.279ON749471175e-05
Suva_6.2851.128ON7862311175e-05
NDAI0A087907.17ON1059501176e-05
KNAG0B051205.235ON888561157e-05
SAKL0A09856g2.547ON1020511158e-05
KLTH0H16170gna 1ON619341158e-05
Skud_9.372.231ON9542111159e-05
Skud_10.101.128ON8331751159e-05
KLLA0E13993gsingletonON678441141e-04
KLTH0G09108g2.231ON7822121141e-04
KLLA0F04609g2.231ON9162161141e-04
SAKL0C02024gsingletonON898481141e-04
KAFR0C039002.654ON8181731141e-04
KLTH0B00352gsingletonON934331141e-04
TPHA0C049808.879ON852431141e-04
ZYRO0E08272g6.279ON794451131e-04
YJL206C1.128ON7582781132e-04
KLTH0D07260g2.547ON979641132e-04
Suva_9.592.231ON9262111122e-04
NDAI0I007406.279ON1033531122e-04
Smik_9.392.231ON10122121122e-04
Kpol_1039.112.231ON9922161122e-04
SAKL0D00264g8.879ON848411112e-04
Smik_10.251.128ON7721751112e-04
YIL130W (ASG1)2.231ON9642071112e-04
NCAS0A047502.547ON1141511113e-04
YKL038W (RGT1)2.547ON1170511113e-04
KNAG0A071002.547ON1286861113e-04
NDAI0B038502.231ON9302181113e-04
Ecym_53972.231ON8262451103e-04
TDEL0E00160singletonON631431103e-04
KLTH0D02222gna 2ON847471103e-04
Suva_11.1872.547ON1171511103e-04
KLTH0B08580g5.59ON6342031103e-04
TBLA0B079205.59ON7673341094e-04
SAKL0A02860g6.279ON745431085e-04
Kwal_23.43705.59ON6922151085e-04
TBLA0A097606.75ON1530611086e-04
TPHA0A045403.109ON1178401086e-04
Kwal_23.47542.231ON8122211086e-04
NDAI0F00110singletonON508341077e-04
Kpol_1002.52.547ON958681077e-04
AAL175W8.879ON883821077e-04
ZYRO0A00440g8.879ON850461078e-04
KLLA0F19602g8.283ON603331068e-04
KLLA0A09119g4.113ON1082631078e-04
KAFR0G025406.60ON855711069e-04
NCAS0C002208.879ON839411060.001
YGR288W (MAL13)na 3ON473321040.001
AER370W2.231ON8011641050.001
TDEL0B004808.879ON835411050.001
KNAG0E002107.17ON948331050.001
KAFR0F010406.279ON834451040.001
KLLA0D12672g6.279ON865451040.002
Ecym_7440na 4ON898411040.002
NCAS0B065502.231ON906331040.002
KLLA0F02750g3.109ON1148601040.002
KAFR0J017102.231ON848331040.002
Ecym_2522na 5ON926431040.002
NDAI0K018002.547ON1210511040.002
TBLA0C040504.113ON1207441040.002
KNAG0J002108.879ON861441030.002
NCAS0A088401.380ON1478591040.002
Suva_15.773.109ON1029561030.002
KAFR0L021308.879ON882411030.002
CAGL0L01903g2.547ON1287361030.002
KLTH0E00440gsingletonON6881861020.002
KLTH0B10076gsingletonON6881861020.002
NDAI0G041403.109ON1001441020.003
KLTH0E03256gsingletonON6741151020.003
CAGL0M12298g7.17ON9941481020.003
NDAI0D00900singletonON865331020.003
Kwal_47.17681na 6ON8542901020.003
KLTH0E14454gna 4ON902331020.003
KLLA0D10153gsingletonON655381010.003
Kwal_14.778na 7ON6652211010.003
NCAS0D04860singletonON701401010.003
TBLA0G011308.879ON1132371010.003
TPHA0F026306.75ON1262491010.004
SAKL0A08074g6.75ON11461241010.004
CAGL0G08844g2.231ON847411010.004
YGL013C (PDR1)4.113ON1068851010.004
ZYRO0E05676g2.547ON1066981010.004
Suva_4.4996.154ON450491000.004
KLTH0E16500g8.879ON833561010.004
CAGL0D02904g5.235ON887601010.004
Skud_2.3726.154ON452491000.004
TBLA0G005106.60ON935851000.004
ZYRO0C18150g1.128ON571381000.004
Kwal_34.15751na 1ON628341000.004
KLTH0E05786gna 8ON817461000.004
Kwal_56.23308singletonOFF438116990.005
TBLA0F012003.109ON1086681000.005
Ecym_81598.879ON908531000.005
KAFR0B014502.547ON1088511000.005
NDAI0B025208.283ON7101501000.005
Skud_15.643.109ON1032571000.005
SAKL0C09944g3.109ON1061361000.005
TPHA0C021808.423ON886551000.005
TPHA0A06090singletonON847331000.005
Kpol_1061.113.264ON73390990.005
NDAI0K001508.879ON953291000.006
CAGL0F07909g3.109ON1049361000.006
TBLA0C062306.60ON79530990.006
AGL099C8.416ON74736990.006
YOR162C (YRR1)6.60ON81075990.006
TDEL0G039706.75ON103549990.006
KAFR0G024506.75ON106849990.006
TBLA0E034803.109ON104691990.006
Ecym_6141na 9ON11435910.006
ZYRO0G21626g6.154ON41341980.006
CAGL0F02519g1.128ON832176990.006
CAGL0F07865g8.423ON84433990.006
Suva_13.498.879ON88248990.006
KLLA0C18953gna 7ON703209990.006
KLLA0F25630g2.547ON1007125990.006
KLTH0B09746gna 10ON725117990.006
Kpol_538.528.879ON90734990.007
Smik_16.20na 3ON47330980.007
TBLA0A012101.380ON142239990.007
CAGL0A00451g4.113ON110743990.007
Kwal_27.96888.879ON84129990.007
TBLA0A007302.654ON1037121990.007
TPHA0N002307.17ON123234990.007
SAKL0B10538g7.56ON70183980.007
CAGL0E05434g7.56ON81665980.007
Ecym_31126.75ON1144118990.007
CAGL0I07755g3.109ON105336990.007
Smik_2.3836.154ON44847980.008
KLLA0A04169g8.423ON77533980.008
KNAG0A025508.423ON73033980.008
KLLA0D00484g6.0ON100467980.008
SAKL0H00682gna 11ON92234980.008
YDR213W (UPC2)8.423ON91334980.008
TPHA0L020502.654ON880227980.008
CAGL0L04400g6.60ON98733980.008
SAKL0A00704gna 5ON71843980.009
TBLA0B04800singletonON77727980.009
YML099C (ARG81)8.879ON88052980.009
Smik_17.27singletonON68844970.009
Smik_4.4608.423ON91833980.009
NDAI0D027306.75ON122549980.009
Skud_15.3266.60ON81870970.010
YBR297W (MAL33)na 12ON46844970.010
KAFR0I002307.17ON104551970.010
Kwal_26.81092.547ON97051970.010
KNAG0E004507.56ON710179970.010
YBR240C (THI2)6.154ON45047960.010
KNAG0K008203.109ON105070970.011
Suva_2.3818.423ON91833970.011
Skud_4.4758.423ON91333970.011
ZYRO0C00726g7.17ON1035148970.011
AGR280C6.75ON1106104970.011
NCAS0A03070singletonON65633970.011
TDEL0E00300singletonON63734970.011
ZYRO0E06270g2.565ON91246970.011
Smik_1.137.17ON104633970.012
SAKL0B01870gsingletonON100934970.012
NCAS0I002707.17ON94447970.012
NDAI0E034608.423ON94949970.012
KLLA0D10197g8.879ON85641970.012
TDEL0A02690singletonON72244970.012
Kpol_1061.198.416ON110756970.012
TPHA0L010608.423ON97333970.012
AFL160C6.279ON64845960.012
TDEL0B063602.547ON98150970.013
TBLA0G00490singletonON91848970.013
NCAS0C027308.423ON77533960.014
KAFR0G025206.61ON83844960.014
NDAI0I019406.75ON126049960.014
Kwal_26.7095na 2ON83833960.014
KNAG0E041507.17ON113646960.014
TPHA0N004407.56ON75744960.014
KLTH0F07854g8.423ON78833960.014
Skud_9.220singletonON79333960.014
KAFR0C049807.17ON95142960.015
Smik_7.2774.113ON106939960.015
ZYRO0A13596gsingletonON64833960.015
Smik_2.438na 12ON46929950.015
Suva_10.3646.60ON70748960.016
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00250
         (1237 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.8...  2411   0.0  
KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {...   746   0.0  
NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845     723   0.0  
TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.84...   714   0.0  
ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa...   709   0.0  
SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} simil...   706   0.0  
KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} simil...   691   0.0  
Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR28...   651   0.0  
NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845    633   0.0  
Suva_13.468 Chr13 complement(809712..812654,812694..814007) [425...   628   0.0  
YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}...   607   0.0  
Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] ...   605   0.0  
Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa] ...   603   0.0  
CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa]...   583   0.0  
KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} simil...   587   0.0  
ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON} ...   555   e-175
Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {...   453   e-135
SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly...    92   7e-18
AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic ho...    91   8e-18
Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}...    90   3e-17
Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON} (51828...    87   2e-16
KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON} unip...    86   3e-16
ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa...    85   8e-16
KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly...    84   2e-15
Suva_6.161 Chr6 complement(283370..284500,284547..284764,284948....    83   2e-15
TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {...    83   3e-15
Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OF...    77   3e-15
YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zi...    81   1e-14
KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.2...    80   2e-14
Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089...    80   2e-14
Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089...    79   5e-14
TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.2...    78   1e-13
KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1....    78   1e-13
NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON}            77   2e-13
TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa] ...    74   2e-12
CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]...    74   2e-12
NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa] ...    69   6e-11
KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.2...    59   9e-08
KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.2...    57   4e-07
SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} simi...    57   4e-07
NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {O...    55   8e-07
Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {O...    54   3e-06
NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235     54   3e-06
Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C ...    54   3e-06
YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}  G...    54   3e-06
TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {O...    54   4e-06
KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {...    53   5e-06
YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON} ...    53   5e-06
Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C (...    53   6e-06
TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.2...    52   6e-06
Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {O...    52   7e-06
Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 b...    52   7e-06
NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279     52   8e-06
KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5....    52   1e-05
NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {O...    52   1e-05
KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} simila...    52   1e-05
Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON} (71447.....    52   1e-05
NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {O...    52   1e-05
Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}...    51   2e-05
Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL03...    51   2e-05
Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL03...    51   2e-05
TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {...    51   2e-05
SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {...    51   2e-05
TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.2...    50   2e-05
TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.2...    50   3e-05
Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {O...    50   3e-05
ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} simila...    50   3e-05
NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59      50   4e-05
TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {...    50   4e-05
KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {O...    50   5e-05
KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {...    50   5e-05
Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C ...    50   5e-05
NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]...    50   6e-05
KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON}               49   7e-05
SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa] ...    49   8e-05
KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]...    49   8e-05
Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)    49   9e-05
Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}...    49   9e-05
KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]...    49   1e-04
KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly...    49   1e-04
KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {...    49   1e-04
SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {...    49   1e-04
KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.6...    49   1e-04
KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON...    49   1e-04
TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON} Anc_8...    49   1e-04
ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} simila...    48   1e-04
YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON} Pu...    48   2e-04
KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {...    48   2e-04
Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W (R...    48   2e-04
NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {...    48   2e-04
Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W (R...    48   2e-04
Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON} (29727....    48   2e-04
SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON...    47   2e-04
Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}...    47   2e-04
YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc c...    47   2e-04
NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2....    47   3e-04
YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}  RGT1Gluc...    47   3e-04
KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]...    47   3e-04
NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {O...    47   3e-04
Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar t...    47   3e-04
TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON}                 47   3e-04
KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly...    47   3e-04
Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL03...    47   3e-04
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    47   3e-04
TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa] ...    47   4e-04
SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {...    46   5e-04
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    46   5e-04
TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]...    46   6e-04
TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON} Anc_...    46   6e-04
Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W...    46   6e-04
NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON}                 46   7e-04
Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON} (11943.....    46   7e-04
AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic ...    46   7e-04
ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON...    46   8e-04
KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]...    45   8e-04
KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa] ...    46   8e-04
KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {O...    45   9e-04
NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879       45   0.001
YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}  MAL13MAL...    45   0.001
AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic ...    45   0.001
TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879...    45   0.001
KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17 ...    45   0.001
KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {O...    45   0.001
KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]...    45   0.002
Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}...    45   0.002
NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa] ...    45   0.002
KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa] ...    45   0.002
KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {...    45   0.002
Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar...    45   0.002
NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON} Anc_2...    45   0.002
TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {...    45   0.002
KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.87...    44   0.002
NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON} Anc_...    45   0.002
Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {...    44   0.002
KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8....    44   0.002
CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} simi...    44   0.002
KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON...    44   0.002
KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some s...    44   0.002
NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3....    44   0.003
KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {...    44   0.003
CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa...    44   0.003
NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON}               44   0.003
Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {...    44   0.003
KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]...    44   0.003
KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some s...    44   0.003
Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON} ...    44   0.003
NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON}               44   0.003
TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8....    44   0.003
TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {...    44   0.004
SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} simil...    44   0.004
CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {...    44   0.004
YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON} ...    44   0.004
ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa] ...    44   0.004
Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON...    43   0.004
KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} simi...    44   0.004
CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {...    44   0.004
Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON...    43   0.004
TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.6...    43   0.004
ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some...    43   0.004
Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig ...    43   0.004
KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly...    43   0.004
Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa] {...    43   0.005
TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3....    43   0.005
Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar t...    43   0.005
KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2....    43   0.005
NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {O...    43   0.005
Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {...    43   0.005
SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa] ...    43   0.005
TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {O...    43   0.005
TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa] ...    43   0.005
Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {O...    43   0.005
NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON...    43   0.006
CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some ...    43   0.006
TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6...    43   0.006
AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON} S...    43   0.006
YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON} ...    43   0.006
TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6....    43   0.006
KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6....    43   0.006
TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3....    43   0.006
Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON} ...    40   0.006
ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]...    42   0.006
CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly...    43   0.006
CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {...    43   0.006
Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}...    43   0.006
KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some...    43   0.006
KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} som...    43   0.006
KLTH0B09746g Chr2 complement(801412..803589) [2178 bp, 725 aa] {...    43   0.006
Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON} (126243...    43   0.007
Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}...    42   0.007
TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1....    43   0.007
CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar...    43   0.007
Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}...    43   0.007
TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2....    43   0.007
TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.1...    43   0.007
SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} simila...    42   0.007
CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} simila...    42   0.007
Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar ...    43   0.007
CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa] ...    43   0.007
Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON...    42   0.008
KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {...    42   0.008
KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {O...    42   0.008
KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserv...    42   0.008
SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON...    42   0.008
YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol...    42   0.008
TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {...    42   0.008
CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa] ...    42   0.008
SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON...    42   0.009
TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa] ...    42   0.009
YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}  A...    42   0.009
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    42   0.009
Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.009
NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6....    42   0.009
Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {...    42   0.010
YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}  MAL33MAL-a...    42   0.010
KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17...    42   0.010
Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {O...    42   0.010
KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}...    42   0.010
YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}  ...    42   0.010
KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa] ...    42   0.011
Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W ...    42   0.011
Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W ...    42   0.011
ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar...    42   0.011
AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON...    42   0.011
NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON}               42   0.011
TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON}                 42   0.011
ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly...    42   0.011
Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W (R...    42   0.012
SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakl...    42   0.012
NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}...    42   0.012
NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423     42   0.012
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    42   0.012
TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON}               42   0.012
Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON} (51386...    42   0.012
TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8....    42   0.012
AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON} S...    42   0.012
TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa] ...    42   0.013
TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON}                42   0.013
NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423     42   0.014
KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {O...    42   0.014
NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75     42   0.014
Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C...    42   0.014
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    42   0.014
TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON...    42   0.014
KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {...    42   0.014
Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON...    42   0.014
KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.1...    42   0.015
Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {O...    42   0.015
ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]...    42   0.015
Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W ...    41   0.015
Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {...    42   0.016
YLR278C Chr12 complement(699999..704024) [4026 bp, 1341 aa] {ON}...    42   0.016
KAFR0A04940 Chr1 (975356..978913) [3558 bp, 1185 aa] {ON} Anc_6....    42   0.017
KLLA0F09559g Chr6 complement(876719..878695) [1977 bp, 658 aa] {...    41   0.017
Skud_12.361 Chr12 complement(641047..645075) [4029 bp, 1342 aa] ...    42   0.017
Skud_7.274 Chr7 complement(472171..475413) [3243 bp, 1080 aa] {O...    42   0.017
CAGL0F09229g Chr6 complement(908186..910693) [2508 bp, 835 aa] {...    41   0.017
Suva_10.376 Chr10 complement(660780..664688) [3909 bp, 1302 aa] ...    42   0.017
Skud_5.331 Chr5 complement(543439..543951) [513 bp, 170 aa] {ON}...    40   0.017
NCAS0F00370 Chr6 complement(61819..65148) [3330 bp, 1109 aa] {ON...    41   0.018
TBLA0G01100 Chr7 complement(279553..281454) [1902 bp, 633 aa] {O...    41   0.018
Suva_10.323 Chr10 complement(566314..568755) [2442 bp, 813 aa] {...    41   0.018
ZYRO0A03058g Chr1 (247954..250164) [2211 bp, 736 aa] {ON} simila...    41   0.018
Smik_12.357 Chr12 complement(638342..642208) [3867 bp, 1288 aa] ...    41   0.018
SAKL0G07634g Chr7 (636596..639364) [2769 bp, 922 aa] {ON} some s...    41   0.019
Skud_2.427 Chr2 (769889..771295) [1407 bp, 468 aa] {ON} YGR288W ...    41   0.019
KLLA0E19603g Chr5 complement(1739869..1741914) [2046 bp, 681 aa]...    41   0.019
SAKL0D01100g Chr4 complement(81235..84057) [2823 bp, 940 aa] {ON...    41   0.019
KLTH0E08778g Chr5 complement(795841..798462) [2622 bp, 873 aa] {...    41   0.020
Kwal_23.3122 s23 complement(166388..168754) [2367 bp, 788 aa] {O...    41   0.020
ACL195C Chr3 complement(19204..19533) [330 bp, 109 aa] {ON} NOHB...    38   0.020
KLLA0A10329g Chr1 (903873..905792) [1920 bp, 639 aa] {ON} conser...    41   0.020
AGL233C Chr7 complement(260414..263032) [2619 bp, 872 aa] {ON} N...    41   0.021
KNAG0M00970 Chr13 (169393..172926) [3534 bp, 1177 aa] {ON} Anc_6...    41   0.021
KLLA0F22990g Chr6 (2134385..2138146) [3762 bp, 1253 aa] {ON} uni...    41   0.021
Skud_7.627 Chr7 (1048240..1049664) [1425 bp, 474 aa] {ON} YBR297...    41   0.021
Kwal_23.6425 s23 (1574518..1576725) [2208 bp, 735 aa] {ON} YKL22...    41   0.022
Suva_4.265 Chr4 (467625..470438) [2814 bp, 937 aa] {ON} YBR033W ...    41   0.022
KAFR0F03410 Chr6 complement(677156..680143) [2988 bp, 995 aa] {O...    41   0.022
TDEL0D05150 Chr4 (932888..935878) [2991 bp, 996 aa] {ON} Anc_3.1...    41   0.023
Kpol_455.10 s455 (12074..14566) [2493 bp, 830 aa] {ON} (12074..1...    41   0.023
KLLA0E18129g Chr5 (1613115..1615712) [2598 bp, 865 aa] {ON} simi...    41   0.023
KLLA0A06039g Chr1 (557368..559341) [1974 bp, 657 aa] {ON} weakly...    41   0.023
TDEL0H04340 Chr8 complement(746566..749535) [2970 bp, 989 aa] {O...    41   0.024
NCAS0C04780 Chr3 (974254..976998) [2745 bp, 914 aa] {ON}               41   0.026
TBLA0A05850 Chr1 complement(1446872..1448845) [1974 bp, 657 aa] ...    41   0.026
Suva_1.14 Chr1 (25653..28790) [3138 bp, 1045 aa] {ON} YAL051W (R...    41   0.026
SAKL0H13024g Chr8 complement(1119585..1121849) [2265 bp, 754 aa]...    41   0.026
KLLA0C04620g Chr3 complement(422705..426514) [3810 bp, 1269 aa] ...    41   0.026
KLLA0C17050g Chr3 (1490472..1493339) [2868 bp, 955 aa] {ON} cons...    41   0.027
KNAG0A02300 Chr1 (214177..216363) [2187 bp, 729 aa] {ON}  gene e...    41   0.027
Smik_13.36 Chr13 complement(71547..74189) [2643 bp, 880 aa] {ON}...    41   0.028
Ecym_4153 Chr4 complement(330831..333281) [2451 bp, 816 aa] {ON}...    40   0.029
SAKL0D14520g Chr4 complement(1192788..1195739) [2952 bp, 983 aa]...    40   0.030
TPHA0C02220 Chr3 (504550..506658) [2109 bp, 702 aa] {ON} Anc_8.4...    40   0.030
Skud_13.43 Chr13 complement(73880..76522) [2643 bp, 880 aa] {ON}...    40   0.030
Ecym_5017 Chr5 (36647..39583) [2937 bp, 978 aa] {ON} similar to ...    40   0.031
Smik_18.3 Chr18 complement(3105..5219) [2115 bp, 704 aa] {ON} YK...    40   0.032
SAKL0C03938g Chr3 complement(377431..379773) [2343 bp, 780 aa] {...    40   0.033
Skud_1.10 Chr1 (24510..27632) [3123 bp, 1040 aa] {ON} YAL051W (R...    40   0.033
KAFR0H01800 Chr8 complement(333664..336048) [2385 bp, 794 aa] {O...    40   0.034
NCAS0D02960 Chr4 complement(563406..566924) [3519 bp, 1172 aa] {...    40   0.036
Smik_15.342 Chr15 complement(595611..595820,595851..598070) [243...    40   0.036
SAKL0H25146g Chr8 complement(2185695..2187632) [1938 bp, 645 aa]...    40   0.036
KLLA0F20680g Chr6 (1924148..1926511) [2364 bp, 787 aa] {ON} weak...    40   0.036
Kpol_1009.5 s1009 complement(10170..13706) [3537 bp, 1178 aa] {O...    40   0.036
SAKL0H24860g Chr8 complement(2162455..2165370) [2916 bp, 971 aa]...    40   0.037
CAGL0B03421g Chr2 complement(336071..340138) [4068 bp, 1355 aa] ...    40   0.039
Ecym_4286 Chr4 (613587..615470) [1884 bp, 627 aa] {ON} similar t...    40   0.039
TBLA0A07010 Chr1 (1713923..1716046) [2124 bp, 707 aa] {ON}             40   0.040
KLTH0G15180g Chr7 (1326581..1329871) [3291 bp, 1096 aa] {ON} sim...    40   0.042
KLTH0D01804g Chr4 complement(173650..175608) [1959 bp, 652 aa] {...    40   0.042
Kpol_345.3 s345 complement(7411..11517) [4107 bp, 1368 aa] {ON} ...    40   0.042
ADR365W Chr4 (1355407..1357512) [2106 bp, 701 aa] {ON} Syntenic ...    40   0.043
ADR403C Chr4 complement(1429115..1432027) [2913 bp, 970 aa] {ON}...    40   0.045
CAGL0H01507g Chr8 complement(147689..150073) [2385 bp, 794 aa] {...    40   0.046
Kwal_47.18089 s47 complement(680481..682718) [2238 bp, 745 aa] {...    40   0.046
TPHA0N01100 Chr14 (231308..232501) [1194 bp, 397 aa] {ON} Anc_6....    40   0.047
TDEL0D03610 Chr4 (664819..666993) [2175 bp, 724 aa] {ON} Anc_3.2...    40   0.047
TDEL0F05470 Chr6 (1017743..1020175) [2433 bp, 810 aa] {ON} Anc_8...    40   0.047
NCAS0E02310 Chr5 (452368..454524) [2157 bp, 718 aa] {ON} Anc_7.56      40   0.047
Smik_18.8 Chr18 (12069..14396) [2328 bp, 775 aa] {ON} YOR172W (R...    40   0.047
Smik_12.289 Chr12 complement(540824..543262) [2439 bp, 812 aa] {...    40   0.049
CAGL0C01199g Chr3 complement(121944..124712) [2769 bp, 922 aa] {...    40   0.049
TDEL0H03950 Chr8 (674423..676411) [1989 bp, 662 aa] {ON} Anc_7.5...    40   0.050
Kpol_1031.47 s1031 (125242..127926) [2685 bp, 894 aa] {ON} (1252...    40   0.050
TBLA0C03390 Chr3 complement(814708..818028) [3321 bp, 1106 aa] {...    40   0.050
Suva_7.268 Chr7 complement(460629..463631) [3003 bp, 1000 aa] {O...    40   0.051
CAGL0L04576g Chr12 (528957..531554) [2598 bp, 865 aa] {ON} simil...    40   0.051
NCAS0A03580 Chr1 complement(712039..715380) [3342 bp, 1113 aa] {...    40   0.051
KLTH0A03498g Chr1 complement(301696..303915) [2220 bp, 739 aa] {...    40   0.052
Skud_12.296 Chr12 complement(540407..542851) [2445 bp, 814 aa] {...    40   0.053
Ecym_2263 Chr2 (518089..519615) [1527 bp, 508 aa] {ON} similar t...    40   0.054
YLR228C Chr12 complement(600019..602463) [2445 bp, 814 aa] {ON} ...    40   0.054
YBR033W Chr2 (301944..304703) [2760 bp, 919 aa] {ON}  EDS1Putati...    40   0.054
KNAG0A02290 Chr1 (211626..214028) [2403 bp, 800 aa] {ON}               40   0.055
SAKL0D14542g Chr4 complement(1195951..1198791) [2841 bp, 946 aa]...    40   0.055
CAGL0G09757g Chr7 (930351..934622) [4272 bp, 1423 aa] {ON} some ...    40   0.058
CAGL0K05841g Chr11 (573144..577262) [4119 bp, 1372 aa] {ON} simi...    40   0.058
Kpol_260.2 s260 complement(3488..5758) [2271 bp, 756 aa] {ON} co...    40   0.059
ZYRO0D14432g Chr4 complement(1222977..1226489) [3513 bp, 1170 aa...    40   0.062
Skud_15.546 Chr15 (990335..991963) [1629 bp, 542 aa] {ON} YOR380...    39   0.062
Kwal_14.931 s14 complement(119423..122608) [3186 bp, 1061 aa] {O...    40   0.063
KNAG0E00780 Chr5 (140071..142353) [2283 bp, 760 aa] {ON} Anc_5.5...    39   0.066
KLTH0F03300g Chr6 complement(283918..285474) [1557 bp, 518 aa] {...    39   0.067
CAGL0J07150g Chr10 complement(688858..691926) [3069 bp, 1022 aa]...    39   0.067
NDAI0C04840 Chr3 (1117201..1120047) [2847 bp, 948 aa] {ON} Anc_8...    39   0.067
ZYRO0E00572g Chr5 (35940..38456) [2517 bp, 838 aa] {ON} similar ...    39   0.067
KLLA0A02585g Chr1 complement(226562..227674) [1113 bp, 370 aa] {...    39   0.067
KAFR0A03060 Chr1 complement(626316..628898) [2583 bp, 860 aa] {O...    39   0.069
NDAI0K02840 Chr11 (640461..643634) [3174 bp, 1057 aa] {ON} Anc_6...    39   0.069
Ecym_5662 Chr5 complement(1338979..1341174) [2196 bp, 731 aa] {O...    39   0.070
Skud_7.638 Chr7 (1060062..1061483) [1422 bp, 473 aa] {ON} YFL052...    39   0.071
Kpol_529.15 s529 complement(38664..41510) [2847 bp, 948 aa] {ON}...    39   0.073
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    39   0.073
ZYRO0A09350g Chr1 (749695..752076) [2382 bp, 793 aa] {ON} simila...    39   0.075
YKL222C Chr11 complement(3503..5620) [2118 bp, 705 aa] {ON} Prot...    39   0.078
CAGL0A04455g Chr1 (437546..440842) [3297 bp, 1098 aa] {ON} simil...    39   0.080
TDEL0B07490 Chr2 complement(1314447..1317044) [2598 bp, 865 aa] ...    39   0.080
SAKL0B06732g Chr2 complement(578508..581144) [2637 bp, 878 aa] {...    39   0.081
Skud_7.646 Chr7 (1073386..1074795) [1410 bp, 469 aa] {ON} YPR196...    39   0.081
ZYRO0G00308g Chr7 (20674..22623) [1950 bp, 649 aa] {ON} similar ...    39   0.082
ZYRO0G19338g Chr7 complement(1601895..1603856) [1962 bp, 653 aa]...    39   0.084
KNAG0I01450 Chr9 (277513..281943) [4431 bp, 1476 aa] {ON}              39   0.084
TDEL0D00260 Chr4 complement(44685..46628) [1944 bp, 647 aa] {ON}       39   0.090
YLR256W Chr12 (646415..650923) [4509 bp, 1502 aa] {ON}  HAP1Zinc...    39   0.092
KLLA0F10373g Chr6 (957948..958994) [1047 bp, 348 aa] {ON} some s...    39   0.092
Skud_2.145 Chr2 (271582..274335) [2754 bp, 917 aa] {ON} YBR033W ...    39   0.093
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    39   0.096
YAL051W Chr1 (48564..51707) [3144 bp, 1047 aa] {ON}  OAF1Oleate-...    39   0.096
KLTH0C10098g Chr3 complement(836528..838843) [2316 bp, 771 aa] {...    39   0.096
TDEL0A03890 Chr1 (695880..698375) [2496 bp, 831 aa] {ON} Anc_5.5...    39   0.098
Ecym_8404 Chr8 complement(834988..837645) [2658 bp, 885 aa] {ON}...    39   0.10 
Kpol_1049.19 s1049 (38439..41270) [2832 bp, 943 aa] {ON} (38439....    39   0.10 
Kwal_56.24566 s56 (1057546..1059813) [2268 bp, 755 aa] {ON} [con...    39   0.11 
YOR172W Chr15 (654210..656570) [2361 bp, 786 aa] {ON}  YRM1Zn2-C...    39   0.11 
Kpol_1061.42 s1061 complement(116430..119819) [3390 bp, 1129 aa]...    39   0.11 
SAKL0B04620g Chr2 complement(406622..407710) [1089 bp, 362 aa] {...    38   0.11 
Ecym_2345 Chr2 (676841..678754) [1914 bp, 637 aa] {ON} similar t...    39   0.11 
NCAS0F01070 Chr6 (211085..213799) [2715 bp, 904 aa] {ON} Anc_5.5...    39   0.11 
ZYRO0G22550g Chr7 complement(1856064..1858238) [2175 bp, 724 aa]...    39   0.11 
Smik_12.327 Chr12 (590984..595495) [4512 bp, 1503 aa] {ON} YLR25...    39   0.11 
TPHA0O00600 Chr15 complement(107944..112062) [4119 bp, 1372 aa] ...    39   0.12 
Kwal_55.20674 s55 complement(515392..516147) [756 bp, 252 aa] {O...    38   0.12 
Smik_15.561 Chr15 (997239..998879) [1641 bp, 546 aa] {ON} YOR380...    39   0.12 
TBLA0A04280 Chr1 complement(1059254..1061932) [2679 bp, 892 aa] ...    39   0.12 
Smik_25.2 Chr25 (2105..4462) [2358 bp, 785 aa] {ON} YER184C (REAL)     39   0.12 
NCAS0H00780 Chr8 complement(140472..143201) [2730 bp, 909 aa] {O...    39   0.12 
Kpol_467.1 s467 (471..4340) [3870 bp, 1289 aa] {ON} (471..4340) ...    39   0.12 
KAFR0I02030 Chr9 complement(416471..420172) [3702 bp, 1233 aa] {...    39   0.12 
YOR380W Chr15 (1051290..1052930) [1641 bp, 546 aa] {ON}  RDR1Tra...    39   0.12 
Kwal_23.4016 s23 (529580..531466) [1887 bp, 628 aa] {ON} YKL015W...    39   0.12 
KNAG0M00620 Chr13 (99320..100699) [1380 bp, 459 aa] {ON} Anc_6.1...    38   0.12 
KAFR0E02410 Chr5 (489279..491354) [2076 bp, 691 aa] {ON} Anc_7.5...    39   0.12 
KLTH0E06666g Chr5 (611348..614188) [2841 bp, 946 aa] {ON} conser...    39   0.13 
Kwal_14.2619 s14 (835443..838946) [3504 bp, 1167 aa] {ON} YLR256...    39   0.13 
Ecym_7239 Chr7 (501580..504774) [3195 bp, 1064 aa] {ON} similar ...    39   0.13 
KAFR0C03730 Chr3 (759382..761757) [2376 bp, 791 aa] {ON}               39   0.13 
TDEL0C05680 Chr3 complement(1020646..1022721) [2076 bp, 691 aa] ...    39   0.14 
SAKL0D07898g Chr4 complement(653332..657066) [3735 bp, 1244 aa] ...    39   0.14 
YOR363C Chr15 complement(1020222..1023212) [2991 bp, 996 aa] {ON...    39   0.14 
Kwal_YGOB_0.139 s0 complement(61752..63560,63594..65507) [3723 b...    39   0.14 
NDAI0G05260 Chr7 (1277631..1282376) [4746 bp, 1581 aa] {ON} Anc_...    39   0.14 
NCAS0A01630 Chr1 complement(317259..320390) [3132 bp, 1043 aa] {...    39   0.14 
NCAS0F00310 Chr6 (49514..52084) [2571 bp, 856 aa] {ON}                 39   0.14 
TPHA0K01100 Chr11 (228134..231619) [3486 bp, 1161 aa] {ON} Anc_6...    39   0.14 
Kwal_8.580 s8 (13266..15182) [1917 bp, 638 aa] {ON} [contig 311]...    38   0.14 
YOL089C Chr15 complement(150398..153490) [3093 bp, 1030 aa] {ON}...    39   0.14 
TBLA0G00520 Chr7 (108060..110696) [2637 bp, 878 aa] {ON} Anc_6.6...    39   0.14 
KAFR0G03520 Chr7 complement(728360..729694) [1335 bp, 444 aa] {O...    38   0.14 
Smik_12.157 Chr12 complement(317470..319404) [1935 bp, 644 aa] {...    38   0.15 
KAFR0C03660 Chr3 complement(745068..747611) [2544 bp, 847 aa] {O...    38   0.15 
NDAI0D03540 Chr4 complement(838966..842289) [3324 bp, 1107 aa] {...    39   0.15 
KLTH0H11572g Chr8 complement(989095..992808) [3714 bp, 1237 aa] ...    39   0.15 
NDAI0H01990 Chr8 complement(481983..485468) [3486 bp, 1161 aa] {...    39   0.15 
NCAS0A07610 Chr1 complement(1512914..1515982) [3069 bp, 1022 aa]...    38   0.15 
Kwal_26.6805 s26 (71596..74430) [2835 bp, 944 aa] {ON} YAL051W (...    38   0.15 
Smik_13.183 Chr13 (304049..304060,304064..306787) [2736 bp, 911 ...    38   0.15 
Suva_15.3 Chr15 complement(4971..6152) [1182 bp, 393 aa] {ON} YK...    38   0.16 
Skud_12.166 Chr12 complement(320672..322621) [1950 bp, 649 aa] {...    38   0.16 
SAKL0G19470g Chr7 complement(1677759..1680254) [2496 bp, 831 aa]...    38   0.16 
NCAS0H03420 Chr8 complement(648059..650767) [2709 bp, 902 aa] {O...    38   0.16 
TBLA0D04050 Chr4 (1007986..1009809) [1824 bp, 607 aa] {ON} Anc_8...    38   0.16 
TBLA0A05860 Chr1 (1449582..1452014) [2433 bp, 810 aa] {ON}             38   0.16 
AFR117C Chr6 complement(646829..650287) [3459 bp, 1152 aa] {ON} ...    38   0.16 
YLR266C Chr12 complement(675619..677724) [2106 bp, 701 aa] {ON} ...    38   0.16 
NDAI0C00260 Chr3 (40019..43144) [3126 bp, 1041 aa] {ON} Anc_2.65...    38   0.18 
Smik_3.209 Chr3 (306620..309118) [2499 bp, 832 aa] {ON} YCR106W ...    38   0.18 
TPHA0F02550 Chr6 (559614..562013) [2400 bp, 799 aa] {ON} Anc_6.6...    38   0.18 
Ecym_2672 Chr2 (1294580..1296799) [2220 bp, 739 aa] {ON} similar...    38   0.19 
Suva_13.186 Chr13 (302887..305571) [2685 bp, 894 aa] {ON} YMR019...    38   0.19 
SAKL0H13266g Chr8 (1138536..1140362) [1827 bp, 608 aa] {ON} some...    38   0.19 
CAGL0H06875g Chr8 complement(682518..684626) [2109 bp, 702 aa] {...    38   0.19 
SAKL0G14256g Chr7 (1230063..1232306) [2244 bp, 747 aa] {ON} cons...    38   0.19 
NDAI0E03850 Chr5 (846504..848810) [2307 bp, 768 aa] {ON} Anc_7.56      38   0.19 
ZYRO0D06688g Chr4 (577455..577507,577577..579311) [1788 bp, 595 ...    38   0.20 
Kwal_YGOB_gneas1 s33 complement(285483..287042) [1560 bp, 519 aa...    38   0.20 
ZYRO0G00374g Chr7 complement(28649..30553) [1905 bp, 634 aa] {ON...    38   0.20 
AER183C Chr5 complement(975879..978518) [2640 bp, 879 aa] {ON} N...    38   0.21 
KAFR0D04590 Chr4 (900318..902840) [2523 bp, 840 aa] {ON} Anc_5.3...    38   0.21 
KLTH0C07480g Chr3 (645219..647546) [2328 bp, 775 aa] {ON} simila...    38   0.21 
TPHA0F00830 Chr6 complement(188299..191877) [3579 bp, 1192 aa] {...    38   0.21 
Skud_15.532 Chr15 complement(959437..962439) [3003 bp, 1000 aa] ...    38   0.21 
KAFR0A03180 Chr1 complement(655176..657716) [2541 bp, 846 aa] {O...    38   0.21 
Skud_15.334 Chr15 (602966..605338) [2373 bp, 790 aa] {ON} YOR172...    38   0.22 
KAFR0E02330 Chr5 (468300..470414) [2115 bp, 704 aa] {ON} Anc_5.5...    38   0.22 
TPHA0B03630 Chr2 (844571..848860) [4290 bp, 1429 aa] {ON} Anc_1....    38   0.23 
Kpol_538.42 s538 complement(89752..93018) [3267 bp, 1088 aa] {ON...    38   0.23 
Smik_26.8 Chr26 (8892..9242) [351 bp, 117 aa] {ON} YER184C (REAL)      35   0.23 
Suva_2.187 Chr2 complement(320833..323187) [2355 bp, 784 aa] {ON...    38   0.23 
TBLA0H03910 Chr8 complement(943931..946234) [2304 bp, 767 aa] {O...    38   0.23 
KLLA0D05038g Chr4 (433653..435674) [2022 bp, 673 aa] {ON} simila...    38   0.23 
Kwal_0.142 s0 complement(63621..65507) [1887 bp, 629 aa] {OFF} Y...    37   0.24 
YER184C Chr5 complement(556296..558680) [2385 bp, 794 aa] {ON} P...    38   0.24 
TPHA0E00880 Chr5 complement(177030..180164) [3135 bp, 1044 aa] {...    38   0.24 
KNAG0A04550 Chr1 (642548..645208) [2661 bp, 886 aa] {ON} Anc_8.4...    38   0.24 
SAKL0B12518g Chr2 (1072142..1073932) [1791 bp, 596 aa] {ON} cons...    37   0.24 
TBLA0D01670 Chr4 complement(413360..416416) [3057 bp, 1018 aa] {...    38   0.24 
NDAI0C04790 Chr3 complement(1100952..1104053) [3102 bp, 1033 aa]...    38   0.25 
AGL361C Chr7 complement(24101..26191) [2091 bp, 696 aa] {ON} NOH...    37   0.25 
ZYRO0E05412g Chr5 (410945..414679) [3735 bp, 1244 aa] {ON} simil...    38   0.26 
NDAI0D03550 Chr4 complement(843265..846621) [3357 bp, 1118 aa] {...    38   0.26 
Ecym_4144 Chr4 complement(306206..308728) [2523 bp, 840 aa] {ON}...    37   0.26 
YDR034C Chr4 complement(509737..512109) [2373 bp, 790 aa] {ON}  ...    37   0.26 
TDEL0B06260 Chr2 (1104557..1108300) [3744 bp, 1247 aa] {ON} Anc_...    38   0.26 
KAFR0C01320 Chr3 (273213..276233) [3021 bp, 1006 aa] {ON} Anc_3....    37   0.26 
Skud_3.181 Chr3 (293773..296268) [2496 bp, 831 aa] {ON} YCR106W ...    37   0.26 
TBLA0I02540 Chr9 (590352..594131) [3780 bp, 1259 aa] {ON} Anc_8....    37   0.27 
TBLA0H00680 Chr8 complement(144914..147556) [2643 bp, 880 aa] {O...    37   0.27 
KAFR0E01250 Chr5 complement(249538..251748) [2211 bp, 736 aa] {O...    37   0.27 
Skud_13.173 Chr13 (298693..298722,298729..301461) [2763 bp, 920 ...    37   0.28 
ACL058W Chr3 (261723..264176) [2454 bp, 817 aa] {ON} NOHBY305; N...    37   0.29 
Suva_8.421 Chr8 complement(757924..760932) [3009 bp, 1002 aa] {O...    37   0.29 
AGL091W Chr7 (535317..537917) [2601 bp, 866 aa] {ON} Syntenic ho...    37   0.29 
TPHA0E01290 Chr5 (258004..260562) [2559 bp, 852 aa] {ON} Anc_5.3...    37   0.29 
NDAI0B01680 Chr2 (398598..401372) [2775 bp, 924 aa] {ON} Anc_2.547     37   0.29 
Suva_8.225 Chr8 (404288..406693) [2406 bp, 801 aa] {ON} YOR172W ...    37   0.30 
SAKL0D13464g Chr4 (1116277..1118340) [2064 bp, 687 aa] {ON} weak...    37   0.30 
Skud_12.335 Chr12 (592952..597391) [4440 bp, 1479 aa] {ON} YLR25...    37   0.30 
Smik_4.696 Chr4 (1232828..1235677) [2850 bp, 949 aa] {ON} YDR421...    37   0.30 
KNAG0C05980 Chr3 complement(1164771..1167677) [2907 bp, 968 aa] ...    37   0.30 
KLLA0F04213g Chr6 (400673..402979) [2307 bp, 768 aa] {ON} simila...    37   0.30 
KLLA0A03443g Chr1 (311628..314555) [2928 bp, 975 aa] {ON} simila...    37   0.30 
NDAI0A03410 Chr1 complement(778569..781511) [2943 bp, 980 aa] {O...    37   0.31 
NCAS0A15020 Chr1 (2957420..2959849) [2430 bp, 809 aa] {ON} Anc_7...    37   0.31 
Ecym_5131 Chr5 (278980..281292) [2313 bp, 770 aa] {ON} similar t...    37   0.31 
Smik_15.67 Chr15 complement(113506..116598) [3093 bp, 1030 aa] {...    37   0.32 
YOR337W Chr15 (954344..956623) [2280 bp, 759 aa] {ON}  TEA1Ty1 e...    37   0.32 
ADR404C Chr4 complement(1432320..1434947) [2628 bp, 875 aa] {ON}...    37   0.32 
Smik_15.547 Chr15 complement(966368..969355) [2988 bp, 995 aa] {...    37   0.32 
Skud_16.500 Chr16 (874371..876485) [2115 bp, 704 aa] {ON} YKL222...    37   0.32 
TBLA0E01900 Chr5 (462299..464821) [2523 bp, 840 aa] {ON} Anc_7.5...    37   0.32 
ZYRO0G17512g Chr7 complement(1447970..1449541) [1572 bp, 523 aa]...    37   0.32 
ZYRO0G10252g Chr7 (819658..822768) [3111 bp, 1036 aa] {ON} simil...    37   0.33 
CAGL0L09691g Chr12 complement(1041796..1044270) [2475 bp, 824 aa...    37   0.33 
Kwal_23.6529 s23 (1627853..1629649) [1797 bp, 598 aa] {ON} YDR03...    37   0.34 
Suva_10.18 Chr10 complement(36048..38576) [2529 bp, 842 aa] {ON}...    37   0.34 
SAKL0H01958g Chr8 complement(193079..195055) [1977 bp, 658 aa] {...    37   0.34 
NCAS0A12580 Chr1 complement(2481447..2483561) [2115 bp, 704 aa] ...    37   0.34 
Smik_16.15 Chr16 complement(14421..15812) [1392 bp, 463 aa] {ON}...    37   0.34 
TBLA0B07050 Chr2 (1669768..1671996) [2229 bp, 742 aa] {ON}             37   0.34 
Skud_6.15 Chr6 complement(24031..25701) [1671 bp, 556 aa] {ON} Y...    37   0.35 
ZYRO0B02574g Chr2 complement(204817..206541) [1725 bp, 574 aa] {...    37   0.35 
SAKL0H00660g Chr8 complement(78740..81478) [2739 bp, 912 aa] {ON...    37   0.35 
AGR061C Chr7 complement(831052..832890) [1839 bp, 612 aa] {ON} S...    37   0.35 
Kwal_47.17506 s47 (431921..434695) [2775 bp, 924 aa] {ON} YGL013...    37   0.35 
AGL083W Chr7 (550291..552861) [2571 bp, 856 aa] {ON} Syntenic ho...    37   0.36 
TBLA0E01110 Chr5 (243534..246755) [3222 bp, 1073 aa] {ON} Anc_6....    37   0.36 
TPHA0F02540 Chr6 (556797..559178) [2382 bp, 793 aa] {ON} Anc_6.6...    37   0.37 
KLLA0C03201g Chr3 complement(286973..288925) [1953 bp, 650 aa] {...    37   0.38 
KNAG0G02130 Chr7 complement(482333..484231) [1899 bp, 632 aa] {O...    37   0.39 
Skud_2.39 Chr2 complement(80293..83772) [3480 bp, 1159 aa] {ON} ...    37   0.39 
NDAI0A05750 Chr1 complement(1302180..1304459) [2280 bp, 759 aa] ...    37   0.39 
KLTH0G13200g Chr7 (1133333..1133382,1133450..1135100) [1701 bp, ...    37   0.39 
KLTH0C00880g Chr3 complement(85841..89098) [3258 bp, 1085 aa] {O...    37   0.40 
YBL066C Chr2 complement(96669..100115) [3447 bp, 1148 aa] {ON}  ...    37   0.40 
Kwal_56.23058 s56 complement(381390..383717) [2328 bp, 775 aa] {...    37   0.41 
TDEL0G04090 Chr7 complement(744499..746730) [2232 bp, 743 aa] {O...    37   0.41 
YFL052W Chr6 (28232..29629) [1398 bp, 465 aa] {ON} Putative zinc...    37   0.42 
Kwal_47.17233 s47 (309658..312504) [2847 bp, 948 aa] {ON} [conti...    37   0.42 
Smik_2.50 Chr2 complement(90559..94011) [3453 bp, 1150 aa] {ON} ...    37   0.42 
Suva_2.51 Chr2 complement(93709..97176) [3468 bp, 1155 aa] {ON} ...    37   0.42 
Kpol_463.14 s463 (38999..40429) [1431 bp, 476 aa] {ON} (38999..4...    37   0.42 
TDEL0F02330 Chr6 complement(429974..433234) [3261 bp, 1086 aa] {...    37   0.43 
KNAG0M00120 Chr13 complement(12320..14965) [2646 bp, 881 aa] {ON}      37   0.43 
NDAI0F02050 Chr6 complement(503400..504740) [1341 bp, 446 aa] {O...    37   0.43 
Suva_8.387 Chr8 (696078..698357) [2280 bp, 759 aa] {ON} YOR337W ...    37   0.43 
SAKL0F16522g Chr6 (1361716..1363842) [2127 bp, 708 aa] {ON} some...    37   0.44 
AFR171W Chr6 (752589..754427) [1839 bp, 612 aa] {ON} NOHBY629; N...    37   0.44 
Suva_15.415 Chr15 (726296..728899) [2604 bp, 867 aa] {ON} YCR106...    37   0.45 
YPR196W Chr16 (931376..932788) [1413 bp, 470 aa] {ON} Putative m...    37   0.45 
NDAI0D01770 Chr4 (411567..413924) [2358 bp, 785 aa] {ON} Anc_5.322     37   0.45 
KNAG0H00250 Chr8 (37360..40050) [2691 bp, 896 aa] {ON} Anc_2.654...    37   0.47 
KLTH0E07854g Chr5 (719642..722458) [2817 bp, 938 aa] {ON} weakly...    37   0.48 
Kpol_1042.6 s1042 (9848..11548,11550..11612,11615..12193) [2343 ...    37   0.48 
SAKL0C05918g Chr3 complement(558911..561538) [2628 bp, 875 aa] {...    37   0.48 
Suva_8.216 Chr8 complement(389549..391894) [2346 bp, 781 aa] {ON...    37   0.49 
KNAG0M02120 Chr13 (395195..397021) [1827 bp, 608 aa] {ON} Anc_2....    37   0.52 
Sklu_YGOB_gneas1 Chr3 complement(352893..354335) [1443 bp, 480 a...    36   0.52 
KLLA0D12650g Chr4 complement(1073580..1075535) [1956 bp, 651 aa]...    37   0.52 
SAKL0F11616g Chr6 complement(901066..902841) [1776 bp, 591 aa] {...    36   0.52 
NCAS0B02930 Chr2 (504501..506606) [2106 bp, 701 aa] {ON} Anc_8.416     37   0.53 
Skud_20.3 Chr20 (4504..5916) [1413 bp, 470 aa] {ON} YBR297W (REAL)     36   0.54 
Kpol_1061.26 s1061 (69833..73657) [3825 bp, 1274 aa] {ON} (69833...    37   0.54 
KAFR0A02130 Chr1 (447063..449186) [2124 bp, 707 aa] {ON} Anc_2.5...    36   0.55 
Suva_10.351 Chr10 (613486..614460) [975 bp, 324 aa] {ON} YLR256W...    36   0.56 
KNAG0A04480 Chr1 complement(626229..629270) [3042 bp, 1013 aa] {...    37   0.57 
KAFR0C03230 Chr3 complement(655300..656520) [1221 bp, 406 aa] {O...    36   0.57 
Smik_2.151 Chr2 (282822..285581) [2760 bp, 919 aa] {ON} YBR033W ...    36   0.58 
Smik_15.350 Chr15 (610312..612666) [2355 bp, 784 aa] {ON} YOR172...    36   0.59 
NCAS0B02860 Chr2 complement(488982..491591) [2610 bp, 869 aa] {O...    36   0.59 
SAKL0D02596g Chr4 (204347..206599) [2253 bp, 750 aa] {ON} conser...    36   0.59 
TDEL0D06620 Chr4 (1197405..1199084) [1680 bp, 559 aa] {ON}             36   0.60 
Smik_23.3 Chr23 complement(4675..6111) [1437 bp, 478 aa] {ON} YB...    36   0.61 
Smik_11.240 Chr11 (395459..395932,395981..398437) [2931 bp, 976 ...    36   0.61 
Kwal_56.24670 s56 complement(1099601..1101532) [1932 bp, 643 aa]...    36   0.62 
Skud_4.287 Chr4 complement(501344..503698) [2355 bp, 784 aa] {ON...    36   0.62 
KNAG0D03520 Chr4 complement(642517..645609) [3093 bp, 1030 aa] {...    36   0.63 
NCAS0A00300 Chr1 (43991..46324) [2334 bp, 777 aa] {ON} Anc_1.26 ...    36   0.63 
KNAG0F03040 Chr6 complement(576753..580325) [3573 bp, 1190 aa] {...    36   0.63 
Smik_4.453 Chr4 complement(820614..823172) [2559 bp, 852 aa] {ON...    36   0.64 
YDR207C Chr4 complement(865012..867522) [2511 bp, 836 aa] {ON}  ...    36   0.66 
YKL015W Chr11 (408544..411483) [2940 bp, 979 aa] {ON}  PUT3Trans...    36   0.66 
ZYRO0C18282g Chr3 (1431515..1433665) [2151 bp, 716 aa] {ON} cons...    36   0.66 
NCAS0H01240 Chr8 (235885..237312) [1428 bp, 475 aa] {ON} Anc_6.154     36   0.67 
Kpol_1028.82 s1028 complement(183595..186372) [2778 bp, 925 aa] ...    36   0.67 
ABL099W Chr2 (212830..215232) [2403 bp, 800 aa] {ON} Syntenic ho...    36   0.68 
NCAS0I02410 Chr9 (451205..453964) [2760 bp, 919 aa] {ON} Anc_3.1...    36   0.68 
ZYRO0D14058g Chr4 (1188615..1190891) [2277 bp, 758 aa] {ON} simi...    36   0.69 
NDAI0H01580 Chr8 (382179..384908) [2730 bp, 909 aa] {ON} Anc_5.5...    36   0.69 
KLLA0F00572g Chr6 complement(42710..44503) [1794 bp, 597 aa] {ON...    36   0.70 
TBLA0C01120 Chr3 complement(233451..237911) [4461 bp, 1486 aa] {...    36   0.72 
Ecym_2732 Chr2 (1410290..1413886) [3597 bp, 1198 aa] {ON} simila...    36   0.73 
CAGL0K11902g Chr11 complement(1149210..1151705) [2496 bp, 831 aa...    36   0.73 
Kpol_1023.41 s1023 (88566..91013) [2448 bp, 815 aa] {ON} (88566....    36   0.73 
KLLA0F02387g Chr6 complement(213669..215852) [2184 bp, 727 aa] {...    36   0.74 
ADR405C Chr4 complement(1435702..1438125) [2424 bp, 807 aa] {ON}...    36   0.75 
Smik_2.290 Chr2 complement(527416..530511) [3096 bp, 1031 aa] {O...    36   0.75 
SAKL0F00418g Chr6 (34751..36430) [1680 bp, 559 aa] {ON} conserve...    36   0.75 
Suva_15.245 Chr15 complement(416757..419414) [2658 bp, 885 aa] {...    36   0.76 
TPHA0D01900 Chr4 complement(395128..397812) [2685 bp, 894 aa] {O...    36   0.76 
ZYRO0C13882g Chr3 complement(1093041..1095542) [2502 bp, 833 aa]...    36   0.77 
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    36   0.78 
Ecym_3392 Chr3 (741359..743902) [2544 bp, 847 aa] {ON} similar t...    36   0.79 
Kwal_26.6732 s26 (43580..45610) [2031 bp, 676 aa] {ON} [contig 4...    36   0.79 
Skud_8.113 Chr8 complement(188347..190992) [2646 bp, 881 aa] {ON...    36   0.80 
YDR421W Chr4 (1312040..1314892) [2853 bp, 950 aa] {ON}  ARO80Zin...    36   0.80 
Smik_8.127 Chr8 complement(190428..193079) [2652 bp, 883 aa] {ON...    36   0.80 
Smik_6.23 Chr6 complement(37285..38955) [1671 bp, 556 aa] {ON} Y...    36   0.81 
YLR098C Chr12 complement(337527..339473) [1947 bp, 648 aa] {ON} ...    36   0.82 
Skud_4.469 Chr4 complement(831562..834189) [2628 bp, 875 aa] {ON...    36   0.82 
NCAS0A10550 Chr1 (2100725..2102950) [2226 bp, 741 aa] {ON} Anc_3...    36   0.83 
TDEL0H00590 Chr8 complement(101024..103477) [2454 bp, 817 aa] {O...    36   0.83 
YLL054C Chr12 complement(32673..35204) [2532 bp, 843 aa] {ON} Pu...    36   0.85 
NCAS0A06710 Chr1 (1324253..1326562) [2310 bp, 769 aa] {ON} Anc_5...    36   0.85 
TBLA0G00730 Chr7 complement(165589..167994) [2406 bp, 801 aa] {O...    36   0.86 
YMR019W Chr13 (312156..315005) [2850 bp, 949 aa] {ON}  STB4Putat...    36   0.86 
SAKL0H16544g Chr8 (1454826..1454875,1454943..1456692) [1800 bp, ...    36   0.87 
YHR056C Chr8 complement(215183..217834) [2652 bp, 883 aa] {ON}  ...    36   0.88 
CAGL0D03850g Chr4 (384689..387193) [2505 bp, 834 aa] {ON} weakly...    36   0.89 
TPHA0C04280 Chr3 complement(922743..926132) [3390 bp, 1129 aa] {...    36   0.89 
Skud_15.502 Chr15 (894741..897020) [2280 bp, 759 aa] {ON} YOR337...    36   0.90 
KLLA0C14212g Chr3 complement(1229219..1232341) [3123 bp, 1040 aa...    36   0.91 
Smik_15.515 Chr15 (903950..906229) [2280 bp, 759 aa] {ON} YOR337...    36   0.92 
Kwal_23.6537 s23 complement(1632048..1633706) [1659 bp, 552 aa] ...    35   0.94 
KAFR0G01220 Chr7 (276857..279406) [2550 bp, 849 aa] {ON} Anc_1.2...    36   0.95 
Kpol_1071.10 s1071 (22248..24344) [2097 bp, 698 aa] {ON} (22248....    35   0.95 
Suva_8.436 Chr8 (788699..790336) [1638 bp, 545 aa] {ON} YOR380W ...    35   0.96 
TDEL0F05400 Chr6 complement(1005960..1007603) [1644 bp, 547 aa] ...    35   0.96 
NDAI0A06990 Chr1 (1593540..1596476) [2937 bp, 978 aa] {ON} Anc_3...    36   0.96 
NCAS0B08200 Chr2 (1561174..1563801) [2628 bp, 875 aa] {ON} Anc_1...    35   0.98 
Kwal_14.1631 s14 (397794..399125) [1332 bp, 443 aa] {ON} YBR240C...    35   0.98 
Suva_2.374 Chr2 complement(656129..658624) [2496 bp, 831 aa] {ON...    35   0.98 
Suva_10.182 Chr10 complement(342360..344330) [1971 bp, 656 aa] {...    35   1.0  
AGL206C Chr7 complement(311846..314053) [2208 bp, 735 aa] {ON} N...    35   1.0  
TBLA0A10770 Chr1 complement(2681017..2683137) [2121 bp, 706 aa] ...    35   1.0  
KLTH0H16236g Chr8 (1400457..1402148) [1692 bp, 563 aa] {ON} cons...    35   1.1  
Kpol_1061.37 s1061 complement(102667..104616) [1950 bp, 649 aa] ...    35   1.1  
Skud_7.2 Chr7 (5094..6749) [1656 bp, 551 aa] {ON} YLR098C (REAL)       35   1.1  
TDEL0C05790 Chr3 (1045249..1047057) [1809 bp, 602 aa] {ON}             35   1.1  
TPHA0G00380 Chr7 complement(65673..68294) [2622 bp, 873 aa] {ON}       35   1.1  
KLLA0A03421g Chr1 (308414..311056) [2643 bp, 880 aa] {ON} weakly...    35   1.1  
KLTH0A00484g Chr1 (42443..44149) [1707 bp, 568 aa] {ON} conserve...    35   1.1  
KLTH0E00176g Chr5 (8605..10311) [1707 bp, 568 aa] {ON} conserved...    35   1.1  
Smik_4.269 Chr4 complement(491110..493446) [2337 bp, 778 aa] {ON...    35   1.1  
NCAS0E02620 Chr5 complement(523279..526626) [3348 bp, 1115 aa] {...    35   1.1  
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...    35   1.1  
Kwal_55.20722 s55 (530982..533465) [2484 bp, 827 aa] {ON} YCR106...    35   1.2  
KAFR0E01300 Chr5 (259207..261690) [2484 bp, 827 aa] {ON} Anc_5.3...    35   1.2  
KNAG0M00130 Chr13 complement(15079..17142) [2064 bp, 687 aa] {ON}      35   1.2  
KAFR0B02820 Chr2 complement(576317..578311) [1995 bp, 664 aa] {O...    35   1.2  
KLTH0C00814g Chr3 (76637..79141) [2505 bp, 834 aa] {ON} similar ...    35   1.2  
Skud_11.214 Chr11 (389377..389855,389895..392361) [2946 bp, 981 ...    35   1.2  
KNAG0I00780 Chr9 (138564..140417) [1854 bp, 617 aa] {ON} Anc_2.3...    35   1.2  
Skud_6.7 Chr6 (12394..13791) [1398 bp, 465 aa] {ON} YPR196W (REAL)     35   1.2  
KNAG0B01720 Chr2 complement(314126..315787) [1662 bp, 553 aa] {O...    35   1.2  
ZYRO0D14080g Chr4 (1191418..1194183) [2766 bp, 921 aa] {ON} weak...    35   1.2  
SAKL0G04884g Chr7 (400351..403143) [2793 bp, 930 aa] {ON} simila...    35   1.2  
ZYRO0C04686g Chr3 complement(367483..369435) [1953 bp, 650 aa] {...    35   1.3  
KLLA0D11286g Chr4 complement(964642..966678) [2037 bp, 678 aa] {...    35   1.3  
Suva_2.121 Chr2 (211466..214381) [2916 bp, 971 aa] {ON} YBL005W ...    35   1.3  
KLTH0H01672g Chr8 complement(148024..150129) [2106 bp, 701 aa] {...    35   1.3  
NDAI0J00440 Chr10 complement(78052..80523) [2472 bp, 823 aa] {ON...    35   1.3  
Suva_5.324 Chr5 (529581..530993) [1413 bp, 470 aa] {ON} YFL052W ...    35   1.3  
KLTH0A07766g Chr1 (654163..655980) [1818 bp, 605 aa] {ON} conser...    35   1.3  
KLTH0F08074g Chr6 (701778..703685) [1908 bp, 635 aa] {ON} some s...    35   1.4  
SAKL0D03586g Chr4 (290224..292629) [2406 bp, 801 aa] {ON} simila...    35   1.5  
SAKL0A06072g Chr1 (551181..552518) [1338 bp, 445 aa] {ON} simila...    35   1.5  
KNAG0I00560 Chr9 complement(93785..95776) [1992 bp, 663 aa] {ON}...    35   1.5  
TBLA0F02920 Chr6 (700340..703111) [2772 bp, 923 aa] {ON} Anc_7.5...    35   1.5  
KLLA0E20307g Chr5 (1806005..1809364) [3360 bp, 1119 aa] {ON} uni...    35   1.5  
KLTH0H05720g Chr8 (505672..507006) [1335 bp, 444 aa] {ON} simila...    35   1.5  
TBLA0H00520 Chr8 complement(101556..102506) [951 bp, 316 aa] {ON}      35   1.6  
TDEL0B04000 Chr2 (715716..716981) [1266 bp, 421 aa] {ON} Anc_6.1...    35   1.6  
KLTH0C10516g Chr3 (871091..872776) [1686 bp, 561 aa] {ON} simila...    35   1.6  
Ecym_4686 Chr4 complement(1336279..1339581) [3303 bp, 1100 aa] {...    35   1.6  
KLLA0A01804g Chr1 complement(159689..162526) [2838 bp, 945 aa] {...    35   1.6  
KAFR0B06340 Chr2 (1311310..1313904) [2595 bp, 864 aa] {ON} Anc_8...    35   1.6  
Ecym_3395 Chr3 complement(750356..753481) [3126 bp, 1041 aa] {ON...    35   1.6  
AAL057C Chr1 complement(246899..249328) [2430 bp, 809 aa] {ON} S...    35   1.6  
KLTH0H11704g Chr8 complement(1003625..1007182) [3558 bp, 1185 aa...    35   1.6  
Kwal_14.915 s14 (110216..112684) [2469 bp, 822 aa] {ON} YKL015W ...    35   1.7  
ZYRO0B00242g Chr2 (12202..14118) [1917 bp, 638 aa] {ON} conserve...    35   1.7  
Skud_4.695 Chr4 (1233000..1235864) [2865 bp, 954 aa] {ON} YDR421...    35   1.7  
CAGL0F05357g Chr6 (541830..543635) [1806 bp, 601 aa] {ON} some s...    35   1.7  
KLTH0D03718g Chr4 complement(362790..364790) [2001 bp, 666 aa] {...    35   1.8  
Kpol_534.28 s534 (64772..66079) [1308 bp, 435 aa] {ON} (64772..6...    35   1.8  
Kpol_1033.15 s1033 complement(32885..34586,34699..34781) [1785 b...    35   1.8  
Suva_16.25 Chr16 complement(31437..31868) [432 bp, 143 aa] {ON} ...    33   1.8  
SAKL0F16588g Chr6 complement(1369763..1371610) [1848 bp, 615 aa]...    35   1.8  
Ecym_5015 Chr5 (29616..32099) [2484 bp, 827 aa] {ON} similar to ...    35   1.9  
Skud_2.106 Chr2 (200722..203754) [3033 bp, 1010 aa] {ON} YBL005W...    35   1.9  
YBL005W Chr2 (217470..220400) [2931 bp, 976 aa] {ON}  PDR3Transc...    35   2.0  
ZYRO0D04422g Chr4 (366583..368877) [2295 bp, 764 aa] {ON} simila...    35   2.0  
Smik_6.15 Chr6 (22860..24260) [1401 bp, 466 aa] {ON} YFL052W (REAL)    34   2.0  
KLLA0C16489g Chr3 (1444456..1446642) [2187 bp, 728 aa] {ON} cons...    35   2.1  
KAFR0B06270 Chr2 complement(1288724..1290085) [1362 bp, 453 aa] ...    34   2.1  
TDEL0C01880 Chr3 (332932..334554) [1623 bp, 540 aa] {ON} Anc_7.3...    34   2.1  
NCAS0A03570 Chr1 complement(708718..711654) [2937 bp, 978 aa] {O...    35   2.2  
CAGL0M11440g Chr13 complement(1127298..1129025) [1728 bp, 575 aa...    34   2.2  
NCAS0A12720 Chr1 (2510574..2512853) [2280 bp, 759 aa] {ON} Anc_2...    34   2.4  
TBLA0H00720 Chr8 (157413..159269) [1857 bp, 618 aa] {ON} Anc_8.4...    34   2.4  
Kpol_2001.16 s2001 (44110..46518) [2409 bp, 802 aa] {ON} (44110....    34   2.4  
Kwal_26.7014 s26 complement(164333..166297) [1965 bp, 654 aa] {O...    34   2.4  
Kpol_1042.7 s1042 (12882..15233) [2352 bp, 783 aa] {ON} (12882.....    34   2.5  
AER291C Chr5 complement(1172383..1174374) [1992 bp, 663 aa] {ON}...    34   2.5  
Smik_12.6 Chr12 complement(17429..19966) [2538 bp, 845 aa] {ON} ...    34   2.5  
NDAI0H03240 Chr8 complement(775826..777718) [1893 bp, 630 aa] {O...    34   2.6  
NCAS0A09540 Chr1 (1901080..1902609) [1530 bp, 509 aa] {ON} Anc_1...    34   2.6  
TPHA0M01040 Chr13 complement(202491..204803) [2313 bp, 770 aa] {...    34   2.7  
NDAI0B01540 Chr2 complement(359639..362050) [2412 bp, 803 aa] {O...    34   2.8  
CAGL0F03025g Chr6 (295783..298569) [2787 bp, 928 aa] {ON} simila...    34   2.8  
Suva_7.100 Chr7 (194100..195035) [936 bp, 311 aa] {ON} YGL162W (...    33   2.8  
Suva_10.10 Chr10 complement(16722..18389) [1668 bp, 555 aa] {ON}...    34   2.8  
Kwal_23.3178 s23 (185722..187557) [1836 bp, 611 aa] {ON} YDR207C...    34   2.9  
NDAI0I02190 Chr9 (501867..504074) [2208 bp, 735 aa] {ON} Anc_6.6...    34   3.0  
Kwal_26.7448 s26 complement(369897..372041) [2145 bp, 714 aa] {O...    34   3.0  
YCR106W Chr3 (310958..313456) [2499 bp, 832 aa] {ON}  RDS1Putati...    34   3.1  
TBLA0C01910 Chr3 complement(448085..448684,448765..451611) [3447...    34   3.1  
KLTH0C10032g Chr3 complement(830334..832934) [2601 bp, 866 aa] {...    34   3.2  
TBLA0G02350 Chr7 complement(605666..610141) [4476 bp, 1491 aa] {...    34   3.2  
SAKL0C03960g Chr3 (380387..383488) [3102 bp, 1033 aa] {ON} conse...    34   3.2  
ZYRO0D12518g Chr4 (1055521..1058166) [2646 bp, 881 aa] {ON} simi...    34   3.3  
KLTH0H00968g Chr8 (103482..105353) [1872 bp, 623 aa] {ON} simila...    34   3.3  
TPHA0M00150 Chr13 (29607..31919) [2313 bp, 770 aa] {ON}                34   3.4  
SAKL0D12254g Chr4 complement(1013532..1017065) [3534 bp, 1177 aa...    34   3.6  
KAFR0A06690 Chr1 complement(1354262..1357255) [2994 bp, 997 aa] ...    34   3.7  
Smik_7.108 Chr7 (193038..193934) [897 bp, 298 aa] {ON} YGL162W (...    33   3.7  
YGL162W Chr7 (198138..199037) [900 bp, 299 aa] {ON}  SUT1Transcr...    33   3.7  
KLTH0D07898g Chr4 (672516..674534) [2019 bp, 672 aa] {ON} weakly...    33   3.8  
Skud_7.108 Chr7 (203544..204437) [894 bp, 297 aa] {ON} YGL162W (...    33   3.9  
TDEL0G00830 Chr7 complement(170169..172229) [2061 bp, 686 aa] {O...    33   3.9  
TDEL0G04920 Chr7 complement(912754..914844) [2091 bp, 696 aa] {O...    33   3.9  
SAKL0A01386g Chr1 (132287..134599) [2313 bp, 770 aa] {ON} conser...    33   4.0  
KNAG0B02380 Chr2 complement(466392..469595) [3204 bp, 1067 aa] {...    33   4.2  
Kwal_26.6664 s26 complement(11094..12833) [1740 bp, 579 aa] {ON}...    33   4.2  
KNAG0F02830 Chr6 (536483..538723) [2241 bp, 746 aa] {ON}               33   4.3  
Suva_2.598 Chr2 (1064757..1067654) [2898 bp, 965 aa] {ON} YDR421...    33   4.4  
KNAG0E03440 Chr5 complement(686366..687367) [1002 bp, 333 aa] {O...    33   4.7  
ZYRO0C11880g Chr3 (929030..930943) [1914 bp, 637 aa] {ON} simila...    33   4.9  
ZYRO0E00638g Chr5 complement(44716..48036) [3321 bp, 1106 aa] {O...    33   4.9  
KLLA0A03091g Chr1 (276333..277484) [1152 bp, 383 aa] {ON} some s...    33   5.0  
NCAS0C04280 Chr3 complement(882224..883384) [1161 bp, 386 aa] {O...    33   5.0  
KLTH0B09262g Chr2 (758773..761235) [2463 bp, 820 aa] {ON} weakly...    33   5.0  
Klac_YGOB_3960 Chr3 (291786..293297,293300..294220) [2433 bp, 81...    33   5.1  
TDEL0G04100 Chr7 complement(746975..749074) [2100 bp, 699 aa] {O...    33   5.3  
AGR369W Chr7 (1412833..1415988) [3156 bp, 1051 aa] {ON} Syntenic...    33   5.3  
SAKL0F11198g Chr6 complement(873587..875866) [2280 bp, 759 aa] {...    33   5.4  
CAGL0I02552g Chr9 (227257..230274) [3018 bp, 1005 aa] {ON} weakl...    33   5.7  
KAFR0L01720 Chr12 (313720..316545) [2826 bp, 941 aa] {ON} Anc_7....    33   5.9  
NCAS0B05110 Chr2 complement(951685..953485,953561..953643) [1884...    33   5.9  
KLLA0A09251g Chr1 (808253..810319) [2067 bp, 688 aa] {ON} simila...    33   6.0  
KLLA0D00396g Chr4 complement(36277..37362) [1086 bp, 361 aa] {ON...    33   6.1  
Skud_10.110 Chr10 complement(196907..198793) [1887 bp, 628 aa] {...    33   6.3  
CAGL0L09383g Chr12 (1020856..1021956) [1101 bp, 366 aa] {ON} som...    33   6.5  
TDEL0C01380 Chr3 (237170..237949) [780 bp, 259 aa] {ON} Anc_8.10...    32   6.9  
TBLA0C00140 Chr3 complement(17689..19599) [1911 bp, 636 aa] {ON}...    33   7.4  
KNAG0B02770 Chr2 complement(535162..536295) [1134 bp, 377 aa] {O...    32   7.6  
Suva_13.267 Chr13 (430766..431449) [684 bp, 227 aa] {ON} YMR090W...    32   7.6  
Suva_11.213 Chr11 (392506..392993,393045..395514) [2958 bp, 985 ...    33   8.2  
Suva_3.130 Chr3 complement(194488..197535) [3048 bp, 1015 aa] {O...    33   8.6  
AGL348W Chr7 (56615..58804) [2190 bp, 729 aa] {ON} NOHBY723; No ...    32   9.1  
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    32   9.6  

>KNAG0J00250 Chr10 (33322..37035) [3714 bp, 1237 aa] {ON} Anc_8.845
            YMR280C
          Length = 1237

 Score = 2411 bits (6248), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1186/1237 (95%), Positives = 1186/1237 (95%)

Query: 1    MRFLCLLFTGVFGLPVFSVQRRTKLMYAGESESWHFLAILYVGWNRSFSPGPLDGTSRSG 60
            MRFLCLLFTGVFGLPVFSVQRRTKLMYAGESESWHFLAILYVGWNRSFSPGPLDGTSRSG
Sbjct: 1    MRFLCLLFTGVFGLPVFSVQRRTKLMYAGESESWHFLAILYVGWNRSFSPGPLDGTSRSG 60

Query: 61   WCEGCLTLTHSCIRLYFTYLVVAGDNKIVMSKKSGAAVNTPAASITTSDAAGGTENTVRE 120
            WCEGCLTLTHSCIRLYFTYLVVAGDNKIVMSKKSGAAVNTPAASITTSDAAGGTENTVRE
Sbjct: 61   WCEGCLTLTHSCIRLYFTYLVVAGDNKIVMSKKSGAAVNTPAASITTSDAAGGTENTVRE 120

Query: 121  EVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCR 180
            EVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCR
Sbjct: 121  EVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCR 180

Query: 181  LKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMN 240
            LKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT                  AMN
Sbjct: 181  LKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTESLEERIRELESENRRLLAMN 240

Query: 241  DLKEQQLFKIPEDIQSVVDVDAELNSSNQTKNMYATHVCDGICCQDTKLHSRPVATNFNL 300
            DLKEQQLFKIPEDIQSVVDVDAELNSSNQTKNMYATHVCDGICCQDTKLHSRPVATNFNL
Sbjct: 241  DLKEQQLFKIPEDIQSVVDVDAELNSSNQTKNMYATHVCDGICCQDTKLHSRPVATNFNL 300

Query: 301  NDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIR 360
            NDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIR
Sbjct: 301  NDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIR 360

Query: 361  QVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNF 420
            QVFGFTSKQCLYTV                    MILQNSSNFDILTSVNLWHLENLSNF
Sbjct: 361  QVFGFTSKQCLYTVSLLSSLKDDLPPPNLLKNSKMILQNSSNFDILTSVNLWHLENLSNF 420

Query: 421  FQNVLKLNILPXXXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFK 480
            FQNVLKLNILP             ALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFK
Sbjct: 421  FQNVLKLNILPDDDDHLKKNDDHLALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFK 480

Query: 481  ADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLM 540
            ADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLM
Sbjct: 481  ADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLM 540

Query: 541  YVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSA 600
            YVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSA
Sbjct: 541  YVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSA 600

Query: 601  VLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTD 660
            VLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTD
Sbjct: 601  VLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTD 660

Query: 661  KMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKL 720
            KMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKL
Sbjct: 661  KMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKL 720

Query: 721  PKKYQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM 780
            PKKYQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM
Sbjct: 721  PKKYQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM 780

Query: 781  NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFE 840
            NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFE
Sbjct: 781  NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFE 840

Query: 841  DNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKIN 900
            DNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKIN
Sbjct: 841  DNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKIN 900

Query: 901  YYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKR 960
            YYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKR
Sbjct: 901  YYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKR 960

Query: 961  EGQGNTTESTQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQP 1020
            EGQGNTTESTQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQP
Sbjct: 961  EGQGNTTESTQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQP 1020

Query: 1021 IPDRTSLPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMM 1080
            IPDRTSLPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMM
Sbjct: 1021 IPDRTSLPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMM 1080

Query: 1081 FLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLL 1140
            FLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLL
Sbjct: 1081 FLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLL 1140

Query: 1141 NEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNKPMDQNSNFTYNYKSSVENNEGLTLEA 1200
            NEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNKPMDQNSNFTYNYKSSVENNEGLTLEA
Sbjct: 1141 NEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNKPMDQNSNFTYNYKSSVENNEGLTLEA 1200

Query: 1201 IRGGETSTQRVSNGHIRVNRQRQSDAVDDLFSWQNST 1237
            IRGGETSTQRVSNGHIRVNRQRQSDAVDDLFSWQNST
Sbjct: 1201 IRGGETSTQRVSNGHIRVNRQRQSDAVDDLFSWQNST 1237

>KAFR0B03950 Chr2 complement(823760..827500) [3741 bp, 1246 aa] {ON}
            Anc_8.845 YMR280C
          Length = 1246

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/1033 (44%), Positives = 625/1033 (60%), Gaps = 103/1033 (9%)

Query: 277  HVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAI 336
            HVCDGICC D KLH +PVATN+N  DPTS+SFEQ+EAPGL+AA+A+  I+N E++TQLAI
Sbjct: 243  HVCDGICCTD-KLHPQPVATNYN--DPTSISFEQSEAPGLVAAKALKSINNQEEATQLAI 299

Query: 337  LVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMI 396
            LVSLS+PRSTEEILFIPQLLAKIRQV GFTSKQCLYTV                     +
Sbjct: 300  LVSLSVPRSTEEILFIPQLLAKIRQVHGFTSKQCLYTVSLLSSLKNSLPSPKSD----FL 355

Query: 397  LQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPXXXXXXXXXXXXXALSEIDELVALY 456
            + NS N  +L + N+W + +L+ FF ++LK NI               +  +ID+L  LY
Sbjct: 356  MDNSQNSLLLKNTNIWQINDLNVFFTDLLKFNI-----SNDSKTSTLLSFDDIDDLTNLY 410

Query: 457  FKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGIL 516
            F +WS+ IP+ NE+EF + Y  FK       +   S+  N+ + K FGC L V+CQMG+L
Sbjct: 411  FNHWSNLIPVLNEEEFFNRYNNFKIQCQSFIQGNQSN--NLRDYKFFGCFLMVMCQMGLL 468

Query: 517  IKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDII 576
            IK K  K+ +  F K+L+YYH L Y+LPKN  +   TTSIK+VQ+L+L+LFYHLN G+I 
Sbjct: 469  IKLKEHKSNNSLF-KILTYYHQLTYILPKNPVYDFATTSIKSVQLLALLLFYHLNMGNIE 527

Query: 577  QIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636
            QIY+LRG IISMA QLRLHRCPSAVLTGSGS M +LEQ NRR LFW IYYLDVF SLQLG
Sbjct: 528  QIYELRGNIISMAHQLRLHRCPSAVLTGSGSTMQKLEQSNRRLLFWTIYYLDVFSSLQLG 587

Query: 637  VPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFK 694
            VPRL+KD+EIECALP+ +     D +DG  ++LEGT+S+ SL++ R AKVLGNI+DSIFK
Sbjct: 588  VPRLLKDYEIECALPVDNTT-TMDAIDGTSIKLEGTVSQISLTLFRFAKVLGNIVDSIFK 646

Query: 695  RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNHEN---LILVLLFF 751
            RNMS SI+ QV  IHENALD+WR++LP+++QFKL+ NG ++L  L+ EN   + L++ +F
Sbjct: 647  RNMSTSISRQVALIHENALDNWRSRLPEQFQFKLDVNGTINLNDLDTENSDTIFLIVFYF 706

Query: 752  LVKSMIYMPLSSAITELANN-PKVKNDYYMNHK--VSHTSLQQSINALLSVFKNINNQYL 808
            L K MI++P+ S   +L +   +  ND   N +   S+ SLQQS N +L+  + I ++YL
Sbjct: 707  LAKCMIHLPVCSTKVDLEDKVTETGNDVIYNDRFSTSYVSLQQSTNTMLNALRMIRDKYL 766

Query: 809  PLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWH 868
            P+P N SRT+TRF L+SAKGSL+Y KGG LF DNK LLL  +Q+IE +RKL+LPGII WH
Sbjct: 767  PMPFNVSRTLTRFTLISAKGSLDYIKGGSLFIDNKKLLLDCVQDIEANRKLDLPGIISWH 826

Query: 869  SLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSK-TKRKQSKED 927
            SLKLLDL +NLFL       +K+EK LQKK+NYYNK+MGKPL+ +LP  K T + +   +
Sbjct: 827  SLKLLDLTLNLFLQNSNTKPEKIEKLLQKKLNYYNKLMGKPLVKNLPIQKRTNQNKGNNN 886

Query: 928  LFTANKKRKQQVKTELSTLE---VKRE---PQQVQLLKREGQGNTTE---STQSAFVEAL 978
               + KK K++++ ++++L    +  E   P     L  +   NT     +TQ+ F EAL
Sbjct: 887  DEPSRKKVKKELENDINSLHPILIDNEGVTPSDAAPLINKTNSNTNNPVVTTQNEFAEAL 946

Query: 979  QLDPILNANIYNFSGTDLSNFFISNQNGDVPRE--------SREPAVQQPIPDRTSLPAT 1030
            Q+DPILN++ Y FS  DL+  F S++   +            ++P     IP  + +   
Sbjct: 947  QVDPILNSDYYQFSNLDLATLFNSDKLNKINSHHGSSINLIDQKPFNDSLIPKFSQVNTA 1006

Query: 1031 NTSVVT---------GFDSLPK--PENSKPAKDAIGPSLKKG--YPSFIGTKSHNNSVST 1077
            + S +           F+  P     N +  ++ +G S        S +   S+N S++T
Sbjct: 1007 SNSTLNMEQLLRNQGKFNISPNIFSPNFQSKENLLGNSKVNNNLLYSNLKNNSNNQSLTT 1066

Query: 1078 MMMFLNNDYPFSSMNLNALYAPDGYKESSAQPG--------KQFTLNTGEPHSTY----- 1124
            MMM LNN+ PFSS+N N   +    + ++A           KQ   N  E  +       
Sbjct: 1067 MMMLLNNEIPFSSINSNTGESGVNKQNANATENDNVETINFKQDLTNKNESGNMLSTENY 1126

Query: 1125 --DFGMIVDASLGLAPLLNEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNKPMDQNSNF 1182
              DF  I+D SLGLAPLL    +  G+    N   +S  + TG+ +   V          
Sbjct: 1127 LSDFSYIIDGSLGLAPLLANPFKPTGENNLVN---VSSIETTGQCINPKV---------- 1173

Query: 1183 TYNYKSSVENNEGLTLEAIRGGETSTQRVSNGHIRV-------------------NRQRQ 1223
              + +SS  N +   L    G      R  NG+  +                    ++R+
Sbjct: 1174 -LSSQSSDANKDDTDLNLENGAVQRRPRRYNGNFGLGGTGMNSNFSVSDLLRPDDQKKRE 1232

Query: 1224 SDAVDDLFSWQNS 1236
             + ++DLF+WQNS
Sbjct: 1233 KETLNDLFNWQNS 1245

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 51/77 (66%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCR KK +CD ++PQCS CA+VGFECK+SDKL R ++PRGYT           
Sbjct: 27  RVTQACDRCRSKKTRCDGRKPQCSQCAAVGFECKVSDKLIRKAYPRGYTESIEERVRELE 86

Query: 231 XXXXXXXAMNDLKEQQL 247
                  A+ DLKEQQ+
Sbjct: 87  AENRRLLALCDLKEQQI 103

>NCAS0C00390 Chr3 (57333..60827) [3495 bp, 1164 aa] {ON} Anc_8.845
          Length = 1164

 Score =  723 bits (1867), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/1141 (40%), Positives = 635/1141 (55%), Gaps = 120/1141 (10%)

Query: 167  DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXX 226
            D+  R +QACDRCR KK +CD KRPQCS CA VGFECK+SDKL R SFPRGYT       
Sbjct: 72   DSNLRIAQACDRCRSKKTRCDGKRPQCSQCAIVGFECKISDKLQRKSFPRGYTETLEEKV 131

Query: 227  XXXXXXXXXXXAM---NDLKEQQLFKIP-----EDIQSVVDVDAELNSSNQTKNMYATHV 278
                       A+   N L+ Q+   I      E++ S+    A   +     N+  T  
Sbjct: 132  RELENENRRLLAICQFNKLQSQKNDTIDNSTTQEEVYSIRSNSASSTAIETDSNI--TTC 189

Query: 279  CDGICCQDTK--LHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAI 336
             D  C  DT   LH +PV+T    N    +SFEQNEAPGL A +A+  ++NHEQSTQLA 
Sbjct: 190  LDTNCNNDTHNHLHMKPVSTKPPQN---IISFEQNEAPGLSAVKALKSMANHEQSTQLAT 246

Query: 337  LVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMI 396
            LV+L+IPRST+EILFIPQLL+KIRQ FGFTSK CLYTV                     +
Sbjct: 247  LVALAIPRSTDEILFIPQLLSKIRQNFGFTSKHCLYTVSLLSSLKPNLPPPKMIANNLEM 306

Query: 397  LQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPXXXXXXXXXXXXXALSEIDELVALY 456
             +   N   L   NLW  ++LS F    LKL+ L                 E+DEL+  +
Sbjct: 307  TKKLLN--QLKITNLWKFDDLSQFINQYLKLDPLNQKNSNDLLNQI-----EMDELINFF 359

Query: 457  FKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLENI-LNIKIFGCLLTVICQMGI 515
            F+ W+D IPI N++EF SNY  FK DL    ++  SS  N+ +N KIFGC+L ++CQMG+
Sbjct: 360  FQDWNDIIPIINKEEFLSNYNAFKLDLKNSERDKLSS--NLKMNYKIFGCILVLMCQMGL 417

Query: 516  LIKYKNFKNKSP---KFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNT 572
            L K K    KS      + +++YYH L+  LP N++F + T SI  +++  LILFY+LN 
Sbjct: 418  LTKIKATNGKSSPNIHLKSIMAYYHQLIANLPINNFFQIATISIPQLKLYVLILFYNLNV 477

Query: 573  GDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCS 632
            GDI  IY+LRG IISM+QQLRLHRCPSAVL+GS   M++L+Q NRR LFW IY LD   S
Sbjct: 478  GDISAIYELRGRIISMSQQLRLHRCPSAVLSGSSLTMNKLDQSNRRILFWTIYSLDALSS 537

Query: 633  LQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVVRCAKVLGNILDSI 692
            LQLGVPRL+KD+EIECALP++ E    DK   ++LEGT+S FSL++ R +K+LGNILD I
Sbjct: 538  LQLGVPRLLKDYEIECALPITMEDKERDKT-KIKLEGTVSPFSLAIFRFSKILGNILDMI 596

Query: 693  FKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNH-------ENLI 745
            FKRNM+ES+T+ V  IHENALD WR  LP+   FKLN  G +DL  ++        +NLI
Sbjct: 597  FKRNMTESMTKSVSLIHENALDQWRYDLPEDLTFKLNIQGSIDLNVMHQGNSTPGKKNLI 656

Query: 746  LVLLFFLVKSMIYMPLSSAITELANNP-KVKNDYYMNHKVSHTSLQQSINALLSVFKNIN 804
            L+  +F   SMI++P+ +A       P  VKN        S+ +LQ +IN +L+V + +N
Sbjct: 657  LMFFYFFAVSMIHLPVVAA------RPLDVKNAMPDRSSSSYIALQHAINTMLNVLELLN 710

Query: 805  NQ----YLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLE 860
            NQ    YLP+P+N SR   R AL+S++G L+Y KGG LF DNK LLL VI+ +E+DR L+
Sbjct: 711  NQPKNYYLPVPINMSRLQIRSALISSRGMLDYIKGGALFLDNKTLLLQVIKNLERDRTLD 770

Query: 861  LPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTK 920
            LPG++ WHSLKL DL + LF+    I  +KL+K L+KK NYYNK+MGKP   +  ++ + 
Sbjct: 771  LPGVVSWHSLKLFDLTITLFIQNSNIKLEKLDKILEKKSNYYNKLMGKPTSNNTNNNISS 830

Query: 921  RKQSKEDLFTANKKRKQQVKTELSTLEVKREP------------QQVQLLKREGQGNTTE 968
                        KKRKQ+   E+ST      P             Q  +L  +   N   
Sbjct: 831  ------------KKRKQET-IEISTPSPTSPPLKKMSKKSKSPILQSTILPSQTLQNYNN 877

Query: 969  STQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNG---DVPRESREPAVQQPIPDRT 1025
            + Q+   +ALQ DPILN+N YNFS  DLSN+F  N+N     +P+ +    V    P + 
Sbjct: 878  NIQNQLADALQFDPILNSNSYNFSNFDLSNYFQPNENEKTVQLPKLTTNNNVTNEDPTKY 937

Query: 1026 SLPATNTSVVTG-----FDSLPKP----------ENSKPAKDAIGPSLKKGYPSFIGTKS 1070
                 N + VTG       +L  P          +N+         +       F+  + 
Sbjct: 938  K-ELFNPTAVTGTSLLNLSTLASPGTSTGLTTTSDNNNILTKGNNNNNNNTNTVFLNNRD 996

Query: 1071 HN--NSVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTYD--- 1125
            +N  +++STMMM +NN+ PFS++NL+ L+      E   + G++      +P +T D   
Sbjct: 997  NNSTDNLSTMMMLVNNEIPFSNLNLSELWNNKLSTEDKDKQGQE----QNQPRNTNDDVG 1052

Query: 1126 -----FGMIVDASLGLAPLLNEAPEIPGQPEFFNSDEMSPSQLTGKLMPMAVNK---PMD 1177
                 +G  VDASLGLAPLL  A        F   DE      + K  P ++ K   P+ 
Sbjct: 1053 MTNSNYGYFVDASLGLAPLLELANN--DNNNFILDDESKTISHSSK-TPESILKDEDPVI 1109

Query: 1178 QNSNFTYNYKSSVENNEGLTLEAIRGGETSTQRVSNGHI--RVNRQRQSDAVDDLFSWQN 1235
             ++N  +N  ++         E  R  +T       G +  +    R+ + +D+LF+W N
Sbjct: 1110 HHNNLLFNQLNTSN-------EKPRHLQTEPNYPPKGKLNQKTPFARKKENIDELFNWHN 1162

Query: 1236 S 1236
            +
Sbjct: 1163 T 1163

>TDEL0B00530 Chr2 (95898..99803) [3906 bp, 1301 aa] {ON} Anc_8.845
            YMR280C
          Length = 1301

 Score =  714 bits (1844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 457/1176 (38%), Positives = 653/1176 (55%), Gaps = 163/1176 (13%)

Query: 110  AAGGTENTVREEVTGLLPNEGKKSLKELKD------TLSPISRPSSSTTANGDGAEPLLS 163
            + G ++ ++    + LL + G + ++  K         +P  RP  +T  +   +   ++
Sbjct: 30   SGGSSQVSISHSPSVLLDDNGSEDVRSAKRKSPSLLAGTPSQRPRLNTEVSEVASYTSVN 89

Query: 164  SRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXX 223
            S  ++  R +QACDRCR KK +CD KRPQCS CA+VGFEC++SDKL+R +FPRGYT    
Sbjct: 90   SAANSNLRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLSRRAFPRGYTETLE 149

Query: 224  XXXXXXXXXXXXXXAMNDLKEQQLFKI---PEDIQSVVDVDA----ELNSSNQTK----- 271
                          A+ D+KEQQ+  +   P + + +   D     EL  +N  +     
Sbjct: 150  ERVRELEAENRRLVALCDIKEQQIHLVSHFPTNKKKIGGNDEQMLQELTGANNGRLRISS 209

Query: 272  -NMY-----------------------------ATHVCDGICCQDTKLHSRPVATNFNLN 301
             N++                               H CD + C + KLHS+PV+TN  LN
Sbjct: 210  TNLFLLNKARDGKQPATISNGDDHMTKPDHEHTGKHRCDELDCNN-KLHSKPVSTN--LN 266

Query: 302  DPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQ 361
            DPT++SFEQNEAPGL A +A+  ++  EQSTQLA LV+LS+PRSTEEILFIPQLLA+I Q
Sbjct: 267  DPTAISFEQNEAPGLPAVKALTSMATREQSTQLATLVALSVPRSTEEILFIPQLLARIIQ 326

Query: 362  VFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNFF 421
            + GFTSKQCLY+V                      L      D L + NLW ++NL  FF
Sbjct: 327  IHGFTSKQCLYSVSLLASLKNNLPGPQ--------LVKWDELDYLKTTNLWEVDNLDKFF 378

Query: 422  QNVLKLNILPXXXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKA 481
               LK NIL              ++ EIDELV L+F  W+  IPI +++EF S Y   K 
Sbjct: 379  HETLKFNIL-RPGVSDDGESLGLSIKEIDELVNLFFDSWAVHIPILDKEEFFSYYDKLKK 437

Query: 482  DLMK---LSKNGPSSL---ENILNIKIFGCLLTVICQMGILIKYKNFKNKSPK--FEKLL 533
            D+     L + GPS+      I++ KIF C+L  +CQMG+L K K  K  S    + KL 
Sbjct: 438  DISTQPGLFQEGPSNFARRNKIISYKIFACILFTVCQMGLLTKVKGEKITSADSPYVKLT 497

Query: 534  SYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLR 593
            SYYH  + ++  N YFGV+TTS++++Q LSL+LFY +NTG++  IY+LRG ++SMAQQLR
Sbjct: 498  SYYHRAISLIYLNPYFGVLTTSLQSLQFLSLLLFYFVNTGNVSAIYELRGRVVSMAQQLR 557

Query: 594  LHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLS 653
            LHRCPSAVL GSGS M++ EQG+RR LFW IYYLDVF +LQLGVPRLIKD EIECALP++
Sbjct: 558  LHRCPSAVLGGSGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVA 617

Query: 654  SEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHEN 711
                    + G  ++LEG +S+FSL+++R AKVLGNILD++FKR M+ES+++++  IHEN
Sbjct: 618  ENDDREVSLAGQMIRLEGRVSQFSLAIIRFAKVLGNILDTVFKRGMTESVSKKLALIHEN 677

Query: 712  ALDSWRTKLPKKYQFKLNANGMVDLEHLNH-----------ENLILVLLFFLVKSMIYMP 760
            ALD+WR  LP +  F++  NG ++++  N            E ++L++ +FL K MI++P
Sbjct: 678  ALDNWRRGLPAELIFEIEVNGTINMDKFNEMKQNNATVENVEQMVLLVSYFLAKCMIHLP 737

Query: 761  LSSAI--------------TELANNPKVKNDYYMNHKVSHTSLQQSINALLSVFKNINNQ 806
            + +                 E  N+   ++++ +    S+  LQQ+ N +L+V +++ + 
Sbjct: 738  VVATRPLPSSDDPNSDIKEEEEVNDKNGESNFAIRSSSSYVLLQQATNTMLNVLESLKSI 797

Query: 807  YLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIP 866
            YLPLP N +RT  RFAL+SA+GSLEY KGG LF DNK LLL V++ IE+DRKLE+PG+I 
Sbjct: 798  YLPLPFNVARTKARFALLSARGSLEYIKGGALFLDNKALLLDVVKSIEEDRKLEIPGVIS 857

Query: 867  WHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITS---LPSSKTKRKQ 923
            WH LKLLD+ ++L L  P    +KL++ L+KK+NYY+++MG+P++ +      +  KR+ 
Sbjct: 858  WHGLKLLDMTISLLLQPPNTKVEKLDRLLKKKLNYYSRVMGRPILKTSSLRQEANGKRRN 917

Query: 924  SKEDLFTANKKRKQQVKTELSTLEVKREPQQVQ-LLKREGQGNTTE-------------- 968
            S +D  + +   +    T L+ +  K +   V+  +K E + + T               
Sbjct: 918  SSDDKLSRSGTEENFRATNLTPISSKSDGSPVEKKIKLEDESSDTSNALVDKSYTDDLSS 977

Query: 969  ---------STQSAFVEALQLDPILNANIYNFSGTDLSNFF--------------ISNQN 1005
                     STQ+A  EAL LDP+LN NI   S  DL+ FF               +NQN
Sbjct: 978  SANQPQVPASTQTAIAEALHLDPVLNNNI--LSVADLAAFFGGNMPAAGGNQHSSYTNQN 1035

Query: 1006 GDVP---RESREPAVQQPIPDRTSLPATNTSVVTGFDSLPK-PENSKPAKDAIGPSLKKG 1061
               P   R+ +EPA    +       A   S VTG D L + P N+    D   PS   G
Sbjct: 1036 DFAPKHMRKEKEPAAFSDL-------AHKKSSVTGVDGLFRVPSNADFLMDEYYPS---G 1085

Query: 1062 YPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQP----------GK 1111
                  T  +NN+ +    F  +D       +N  +   G  +S+             G 
Sbjct: 1086 TSHINLTLFNNNANNHDDTFGLSDGHGKDTGVNTNFNVKGGHQSTNHSHLTNFNDRLQGN 1145

Query: 1112 QFTL-NTGEPHSTYDFGMIVDASLGLAPLLNEAPEI 1146
            Q    N+G  +S  DF   VDASLGLAPLL+ +PE+
Sbjct: 1146 QLGFTNSGNMNSGSDFNFAVDASLGLAPLLDWSPEM 1181

>ZYRO0G14278g Chr7 complement(1141297..1145049) [3753 bp, 1250 aa]
            {ON} similar to uniprot|Q75DZ4 Ashbya gossypii ABL121C
            ABL121Cp and similar to YMR280C uniprot|P39113
            Saccharomyces cerevisiae YMR280C CAT8 Zinc cluster
            transcriptional activator
          Length = 1250

 Score =  709 bits (1831), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/1104 (40%), Positives = 626/1104 (56%), Gaps = 159/1104 (14%)

Query: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
            R +QACDRCR KK +CD KRPQCS CA+VGFECK+SD+L+R +FPRGYT           
Sbjct: 99   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDRLSRRAFPRGYTETLEERVRELE 158

Query: 231  XXXXXXXAMNDLKEQQLF----------------KIPEDIQSVVDVDAELNSSN------ 268
                   A+ D+KEQQ+                 ++  ++QS       ++S+N      
Sbjct: 159  AENRRLVALCDIKEQQIHLFSQQHSPGGRRKDDERMLRELQSANGGSLNISSTNLYLLNT 218

Query: 269  ----------------QTKNMYATHVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNE 312
                             T+     HVCDG+CC   KLH +PV+TN  LNDPTSVSFEQ+E
Sbjct: 219  GSHQRQGPQGPQQQEQLTQQKRQPHVCDGLCCAG-KLHVKPVSTN--LNDPTSVSFEQSE 275

Query: 313  APGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLY 372
            APGL A +A+  ++  EQS QLA LV+LS+PRSTEEILFIPQLLA+IRQ++GFTSKQCLY
Sbjct: 276  APGLPAVQALTSVATREQSNQLATLVALSVPRSTEEILFIPQLLARIRQIYGFTSKQCLY 335

Query: 373  TVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPX 432
            TV                      L      + L S NLW +++L  FF  + K   L  
Sbjct: 336  TVSLLSSLKSSLPEPH--------LVKHEPLETLASTNLWEMDDLEQFFAEIFKFK-LES 386

Query: 433  XXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLM------KL 486
                         LSEI+EL++++F++ S  IPI  + EF   +  FK +++      K 
Sbjct: 387  KSPSSYKGGAQLNLSEIEELISIFFEHSSIHIPILVKDEFYHYFNQFKENVLQNLEFLKT 446

Query: 487  SKNGPS---SLENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLMY 541
               GP+       I++ KIFGC++ ++CQ+G+L  IK +N    S K  +L SYYH  + 
Sbjct: 447  PLQGPALTARRGKIISYKIFGCIILMLCQLGLLSKIKAENLGATS-KHHRLASYYHKAIS 505

Query: 542  VLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAV 601
            ++  N YFGV++TS++++Q LSL+LFY LN G++  IY+LRG ++SMAQQLRLHRCPSAV
Sbjct: 506  LVYMNPYFGVLSTSLQSLQFLSLVLFYFLNIGNVSAIYELRGRVVSMAQQLRLHRCPSAV 565

Query: 602  LTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDK 661
            L G+GS M++ EQG+RR LFW IYYLDVF +LQLGVPRLIKD EIECALP++     T  
Sbjct: 566  LGGAGSTMNKREQGDRRVLFWGIYYLDVFSALQLGVPRLIKDFEIECALPVADNDDRTVN 625

Query: 662  MDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTK 719
            + G  ++LEG ++ +SL+++R +KVLGNILDSIFKR M+ESIT+QV  IHENALD+WR  
Sbjct: 626  LAGQQIRLEGQVTNYSLAIIRFSKVLGNILDSIFKRGMTESITKQVSLIHENALDNWRHG 685

Query: 720  LPKKYQFKLNANGMVDLEHLNH-----------ENLILVLLFFLVKSMIYMPL------- 761
            LPK+  F+L+ NG ++++  N            EN+ L++++FL K MI++P+       
Sbjct: 686  LPKELIFELDVNGTINIDEFNRLKQMNVTVERSENMTLLVMYFLAKCMIHLPVVATRPLP 745

Query: 762  ---------SSAITELANNPKVKNDYYMNHKV-------SHTSLQQSINALLSVFKNINN 805
                     +S  T   NN + ++     ++        S+  LQQ+ N +L+V +++  
Sbjct: 746  TNDSNDTGETSNATSNGNNVRARDPSTERNQAAADRSSSSYVLLQQATNTMLNVLESLKT 805

Query: 806  QYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGII 865
             +LPLPLN SRT  RFAL+SA+GSLEY KGG LF DNK LLL VI+++E+DRKL+LPG+I
Sbjct: 806  LFLPLPLNISRTKARFALLSARGSLEYTKGGALFLDNKSLLLDVIKDLEEDRKLDLPGVI 865

Query: 866  PWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKR---K 922
             W+SLKLLD+++NL L  P     KL++ L+KK+NYYN++MG+P +   P+SK       
Sbjct: 866  SWNSLKLLDMSINLLLQPPNTEVGKLDRLLKKKLNYYNRLMGRPTVKQEPASKGHDLTPA 925

Query: 923  QSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTE-------------- 968
             SK++  T   KR   +K E +++ +   PQQ Q ++        E              
Sbjct: 926  SSKDEEDTPAAKR---IKIEETSIPLAV-PQQQQHMQAPAPVMVQEKQQPQPQPQPQPQP 981

Query: 969  ------------STQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPA 1016
                          Q+AF EALQLDP+LN+N+ +F     +  +  +   D P + +  A
Sbjct: 982  QPQLQPQPQQLQLPQTAFAEALQLDPVLNSNV-SFQNAPPTTLY--DGPHDQPHQYQHHA 1038

Query: 1017 VQQP----IPDRTS--------LPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPS 1064
              QP    +  R+S        +P+T   ++   DS     N       +G  L    PS
Sbjct: 1039 QTQPQDPHLDTRSSDKLHGLFKVPSTADFLMD--DSANSQLNFLLGTTELG-VLDPSQPS 1095

Query: 1065 FIGTKSHNNSVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQPGKQFTLNTGEPHSTY 1124
            +      NN  S   + +NN  P S +NL+ L+  +G   S+ QP            ++ 
Sbjct: 1096 YT-----NNPGSGSAIGINN-MP-SGLNLSNLFDLEG---STDQPPTNTNATQATQANSG 1145

Query: 1125 DFGMIVDASLGLAPLLNEAPEIPG 1148
             F   VDASLGLAPLL   P+  G
Sbjct: 1146 GFNFAVDASLGLAPLLAWTPDHNG 1169

>SAKL0D01342g Chr4 (101095..104907) [3813 bp, 1270 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1270

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/1083 (40%), Positives = 603/1083 (55%), Gaps = 144/1083 (13%)

Query: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
            R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGYT           
Sbjct: 86   RVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 145

Query: 231  XXXXXXXAMNDLKEQQLFKIP-------------EDIQSVVDVDAELNSSNQ--TKNMY- 274
                   A+ DLKE+QL  +              ED Q +  + A    S +  + N+Y 
Sbjct: 146  AENRRLVALCDLKEEQLHLVSKYSNKRTSEISENEDEQILQQLSAANGGSLRVSSTNLYL 205

Query: 275  -------------------ATHVCDGICCQDT---KLHSRPVATNFNLNDPTSVSFEQNE 312
                                T  C+G+ C  +    +H +PV+TN  LNDPTS+SFEQNE
Sbjct: 206  LNKTTPGDQQDEEDQMSSKTTVDCNGVGCNHSHQPNIHDKPVSTN--LNDPTSISFEQNE 263

Query: 313  APGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLY 372
            APGL A +A+  ++NHE S QLA LV+LS+PRSTEEIL IPQLLA+I QV G TSKQ LY
Sbjct: 264  APGLPAVKALTSMANHEHSVQLATLVALSVPRSTEEILLIPQLLARIGQVHGLTSKQSLY 323

Query: 373  TVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNILPX 432
            T                     + L   +N D+L S NLW ++++  FFQ V K +I   
Sbjct: 324  TASLLASLKES-----------IPLTLPTNVDMLKSTNLWEVDDVIQFFQTVFKFDI--- 369

Query: 433  XXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLS----- 487
                          +EID LV+ +F  W + IPI ++ EF + Y  FK DLM  +     
Sbjct: 370  QAESSTTSQDHLIATEIDGLVSDFFSQWYNFIPILDKDEFYNYYNKFKTDLMDPNFFDDE 429

Query: 488  KNGPSSLENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLMYVLPK 545
            KN  +     ++ KIFGC+L +ICQMG++  +K +N    + K+ +L++YY  ++  L  
Sbjct: 430  KNLFNKRNKSISYKIFGCILLIICQMGLISKVKAENLP-ATNKYSQLMAYYDIVVRQLMM 488

Query: 546  NSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGS 605
            N YF + +TSI+++Q  SL LFY LN G++  +YDLRG ++SM+QQLRLHRCPSAVL G+
Sbjct: 489  NPYFNLKSTSIQSLQFTSLQLFYFLNIGEVSSVYDLRGKVVSMSQQLRLHRCPSAVLGGN 548

Query: 606  GSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG- 664
            GS + + +QG RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP++        + G 
Sbjct: 549  GSAVSKAQQGERRILFWGIYYLDVFSALQLGVPRLLKDHEIECALPVADNDDQKVNLAGQ 608

Query: 665  -VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKK 723
             + LEG +S  SLSV+R AKVLGNILDSIFKR MS S+T+Q+  +HENALD+WR  LP++
Sbjct: 609  MIALEGRVSMLSLSVIRFAKVLGNILDSIFKRGMSASLTKQISLVHENALDNWRRGLPQQ 668

Query: 724  YQFKLNANGMVDLEHLNH-------------ENLILVLLFFLVKSMIYMPLSSAITELAN 770
             +F+L+ NG ++++  NH             EN  L++L+F+ K MI++P+  A   L N
Sbjct: 669  LKFELDVNGTINMDEFNHLKQLDTSGNMYSKENKSLMVLYFMAKCMIHLPV-VAKRPLVN 727

Query: 771  NPKV-------KNDYYMNHKVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFAL 823
            +P+         N+       S+  LQQ+ N LL+VF ++ N Y P+P+N SRT TRF+L
Sbjct: 728  DPEQSPESSTPSNNCGDRSSSSYVLLQQATNTLLNVFTSLRNVYPPIPINVSRTKTRFSL 787

Query: 824  VSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLG 883
            +SA+GSLEY KGG LF+DNK LLL +++E+E D+KLELPG + WHSLKLLD++++L L  
Sbjct: 788  LSARGSLEYTKGGALFQDNKALLLDLVKELEVDKKLELPGTLSWHSLKLLDMSISLILQP 847

Query: 884  PTINSDKLEKFLQKKINYYNKI------MGKPLITSLPSSKTKRKQSKED-------LFT 930
                 +KLEK LQ+K+NYYNK+      +G     S P   +KRK  +         L  
Sbjct: 848  ANTKPEKLEKMLQRKLNYYNKLTNRRSNLGGGRSASSPGGNSKRKLDENQGSAEPPKLTP 907

Query: 931  ANKKRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTE--------STQSAFVEALQLDP 982
            A+ K       ++   +    P  V+ + +  Q ++ +        + Q++  EA  LDP
Sbjct: 908  ASSKGDTPPDKKIKLEDTGFVP--VRAVSQHSQSDSEKFENFQPPVAPQNSIAEAFHLDP 965

Query: 983  ILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQPIPDRTSLPATNTSVVTGFDSLP 1042
            +LN N   FS TDL+ FF +N NG+VP   R       I    +    N +     ++L 
Sbjct: 966  VLNNNP--FSNTDLNAFFNTN-NGNVPAALRSGGSLFNIAATAAASGNNANSTAPSNTLN 1022

Query: 1043 K-----PENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNALY 1097
            +     P N    KD         Y +  G  S   ++  +    +N  P     LN   
Sbjct: 1023 EGLFKVPSNGDFLKD---------YYNVPGASSSQLNLLFLNNNASNGKP----QLNG-- 1067

Query: 1098 APDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLLNEAPE-IPGQPEFFNSD 1156
                   SSA  G Q      + +    FG  VDAS GLAPLL  +P   P  P   N++
Sbjct: 1068 -------SSAHSGTQ-----AQNNDNNGFGFAVDASWGLAPLLEWSPAGKPVDPGTCNAN 1115

Query: 1157 EMS 1159
            E S
Sbjct: 1116 ENS 1118

>KLTH0C03762g Chr3 (324666..328286) [3621 bp, 1206 aa] {ON} similar to
            uniprot|P39113 Saccharomyces cerevisiae YMR280C CAT8 Zinc
            cluster transcriptional activator
          Length = 1206

 Score =  691 bits (1783), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1098 (39%), Positives = 605/1098 (55%), Gaps = 164/1098 (14%)

Query: 160  PLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
            P  S  P +  R +QACDRCR KK +CD KRPQCS CA+VGFECK+SDKL+R +FPRGYT
Sbjct: 58   PTASVTPSSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGFECKVSDKLSRRAFPRGYT 117

Query: 220  XXXXXXXXXXXXXXXXXXAMNDLKEQQLF--------KIPEDIQSVVDVDAE-LNSSN-- 268
                              A+ DLK++Q+         K PE   +  +   E L+SSN  
Sbjct: 118  ETLEERVRELEAENRRLVALCDLKDEQMHLVYKYSSNKRPEPSSTEEEQMLEQLSSSNGG 177

Query: 269  ----QTKNMY-------------ATHVCDGICCQDTK---LHSRPVATNFNLNDPTSVSF 308
                 + N+Y               H C GI C  T    LH +PV+T   L+DPT++SF
Sbjct: 178  SLRVSSTNLYLLNKTSPAGHEVPENHKCQGIDCNHTSHPHLHEKPVSTT--LSDPTTISF 235

Query: 309  EQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSK 368
            EQ+EAPGL A +A+  ++NHE STQLA LV+LS+PRSTEEILFIPQLLA++ QV G TSK
Sbjct: 236  EQHEAPGLPAVKALSSMANHEYSTQLACLVALSVPRSTEEILFIPQLLARLGQVHGLTSK 295

Query: 369  QCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLN 428
            QCLYT                      ++  +     L   +LW +++   FF++  K N
Sbjct: 296  QCLYTASLLASLKEPSQA---------VVPTTDGLTELKCTSLWEIDDPMRFFKDSCKFN 346

Query: 429  ILPXXXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADL----- 483
            +               ++SEI++L+++YF+     IP+ NE EF   Y  FK  L     
Sbjct: 347  L------GSDNDVELLSISEIEDLISIYFEECHALIPVLNENEFYKYYNKFKESLTVDPN 400

Query: 484  -MKLSKNGPSSLENILNIKIFGCLLTVICQMGIL--IKYKNFKNKSPKFEKLLSYYHHLM 540
                + +  +     ++ KIF C+L V+CQ+GI+  +K +    KS KF ++++YY++ +
Sbjct: 401  FFGKANSSFAHRSKSISYKIFACILLVVCQLGIMSKVKREQLPAKS-KFSRIMAYYNNAI 459

Query: 541  YVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSA 600
              L  N YF V TTS+KT+Q++SL+LFY LN G++  +Y+LRG I+SMAQQLRLHRCPSA
Sbjct: 460  LALKLNPYFSVKTTSVKTLQLMSLLLFYFLNVGEVSSVYELRGTIVSMAQQLRLHRCPSA 519

Query: 601  VLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTD 660
            VL   GS M + EQG+RR LFW IYYLDVF +LQLGVPRL+KDHEIECALP+S   H   
Sbjct: 520  VLGTEGSTMSKSEQGDRRLLFWGIYYLDVFSALQLGVPRLLKDHEIECALPISENGHPGV 579

Query: 661  KMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRT 718
             +    ++LEG +SEFSLS++R +K+LGNILDSIFKR M+ SI +QV  IHENALDSWR 
Sbjct: 580  SLADQVIRLEGQVSEFSLSLLRFSKILGNILDSIFKRGMTSSIAQQVALIHENALDSWRR 639

Query: 719  KLPKKYQFKLNANGMVDLEHLNH--------------ENLILVLLFFLVKSMIYMPLSSA 764
             LPK   F+L+ NG +++E LN               +N  L++L+FLVK ++++P+ +A
Sbjct: 640  GLPKNLTFELDVNGTINMEELNSGSHWKKDYSTAPSCDNRTLMVLYFLVKCLVHLPVLAA 699

Query: 765  ITELANNPKVKNDYYM----------NHKVSHTSLQQSINALLSVFKNINNQYLPLPLNS 814
               L    +V  D  +              S+  LQQ+ N  LSV  ++ +++LPL LN 
Sbjct: 700  KPLLGGASEVDTDATLAFDDASSGADRSSSSYVLLQQATNTFLSVQSSLKSRHLPLALNL 759

Query: 815  SRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLD 874
             R   RFAL+SA+G LEY KGG LF+ NK LLL V++E+E  ++LE+PG + WHSL LLD
Sbjct: 760  PRIKARFALLSARGILEYTKGGALFQGNKALLLDVVKELETTKRLEIPGSLSWHSLILLD 819

Query: 875  LAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANK- 933
            +AV+L +  P   + KL+K L+ K++YYNK+MG+    ++ S+K K+++    L  A K 
Sbjct: 820  MAVSLIMQPPHTKAGKLDKLLEAKLSYYNKLMGRS--ANVASTKRKKEEDNTSLSNATKL 877

Query: 934  ---------KRKQQVKTELSTLEVKREPQQVQLLKREGQ--GNTTE----------STQS 972
                       +++VK E  T +V   P  V+     GQ  GNT E             S
Sbjct: 878  TPLSSDSSSPSEKRVKLE-HTDKVGETPVGVE---NTGQPNGNTQEHYAATWSNQNQPHS 933

Query: 973  AFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQPIPDRTSLPATNT 1032
               EA  LDP+LN N   FS  DL+ FF S  NG              +P+ +     + 
Sbjct: 934  TVAEAFHLDPVLNNN--PFSNGDLTAFF-STDNG--------------MPNLSG--GASM 974

Query: 1033 SVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMM-----------F 1081
              + G D      +S    DA              T + N+  ST+             F
Sbjct: 975  LNMVGVDQ----AHSTAGNDA------------QNTVNANSQQSTLFNDGLFRVPSNGDF 1018

Query: 1082 LNNDY--PFSSMN-LNALYAPDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAP 1138
            L + Y  P +S + LN +    G   S+ +  KQ   NT +P     FG  VDASLGLAP
Sbjct: 1019 LKDYYRVPGASSSQLNLMLMGSGSSGSNQRQAKQQQTNTTDP----GFGFTVDASLGLAP 1074

Query: 1139 LLNEAPEIPGQPEFFNSD 1156
            LL  +PE   +P    SD
Sbjct: 1075 LLAWSPEAAQEPIAETSD 1092

>Kwal_27.10232 s27 (251015..254644) [3630 bp, 1209 aa] {ON} YMR280C
            (CAT8) - Zinc-cluster protein involved in activating
            gluconeogenic genes; related to Gal4p [contig 39] FULL
          Length = 1209

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/1235 (36%), Positives = 641/1235 (51%), Gaps = 210/1235 (17%)

Query: 145  SRPSSSTTANGDGAE---PLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGF 201
            ++P ++ +A  + A    P+ S+ P +  R +QACDRCR KK +CD KRPQCS CA+VGF
Sbjct: 40   AQPRTNNSAAPNAARSISPVTSATPTSNYRVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 99

Query: 202  ECKLSDKLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMNDLKEQQLFKI----------P 251
            ECK+SDKL+R +FPRGYT                  A+ DLK++Q+  +          P
Sbjct: 100  ECKVSDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKDEQMHLVSKYSSNKRHEP 159

Query: 252  EDIQSVVDVDAELNSSN-----QTKNMY-------------ATHVCDGICCQDTK---LH 290
               +    ++   NS        + N+Y               H C G+ C       LH
Sbjct: 160  SSTEEGRMLEQLSNSDGGSLRVSSTNLYLLNKTTPAVQDGSELHKCQGLGCNHASHPHLH 219

Query: 291  SRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEIL 350
             +PV+T+  L+DP ++SFEQNEAPGL A +A++ ++NHE S QLA LV+LS+PRST+EIL
Sbjct: 220  EKPVSTS--LSDPAAISFEQNEAPGLPAVKALNTMANHEYSAQLAYLVALSVPRSTDEIL 277

Query: 351  FIPQLLAKIRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVN 410
            FIPQLLA++ QV G TSKQCLY+                        Q S ++  L   +
Sbjct: 278  FIPQLLARLGQVHGLTSKQCLYSASLLAALKESSQTS---------FQGSPDYKDLKDKS 328

Query: 411  LWHLENLSNFFQNVLKLNILPXXXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEK 470
            LW +++   FF+   K N+                +SEI+EL+++YF      IP+ NE 
Sbjct: 329  LWEIDDCMTFFKTGCKFNL------TSSKDAECLTISEIEELISIYFGECHALIPVLNEA 382

Query: 471  EFNSNYRVFKADL------MKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFKN 524
            EF   Y  FK++L       K S    +     ++ KIF C+L VICQ G++ K K  + 
Sbjct: 383  EFYKYYNKFKSNLTTDPEFFKTSTPSFAQRSKSISYKIFACILLVICQFGLMAKVK--RE 440

Query: 525  KSP---KFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDL 581
            + P   KF  L+SYY + +  L  N YF V  TSI+T+Q+LSL+LFY+LN G++  +Y++
Sbjct: 441  QLPTKNKFSLLMSYYSNALLALKTNPYFSVKNTSIQTLQLLSLLLFYYLNVGEVSSVYEI 500

Query: 582  RGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLI 641
            RG ++SMAQQLRLHRCPSAVL   GS M + EQG+RR LFW IYYLDVF +LQLGVPRL+
Sbjct: 501  RGTVVSMAQQLRLHRCPSAVLGTEGSTMSKSEQGDRRLLFWGIYYLDVFGALQLGVPRLL 560

Query: 642  KDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSE 699
            KDHEIECALP+S   H    +    ++LEG +SE SLS++R +K+LGNILDSIFKR M+ 
Sbjct: 561  KDHEIECALPISEHAHAGVSLADQVIKLEGQVSELSLSLLRFSKILGNILDSIFKRGMTS 620

Query: 700  SITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHL-----NHENL---------I 745
            S  +QV  IHENALD+WR  LPK   F+L+ NG + +E L     N+++          I
Sbjct: 621  SAAQQVALIHENALDNWRRGLPKNLTFELDVNGTIKIEELTGSAQNNQDFTKNASSDKKI 680

Query: 746  LVLLFFLVKSMIYMPLSSAITELANNPKVKND----------YYMNHKVSHTSLQQSINA 795
            L+LL+FLVK ++++P+ +A   L  + +   D                 S+  LQQ+ N 
Sbjct: 681  LMLLYFLVKCLVHLPVLAAKPLLGGSSEPDKDATPAFDDASSGADRSSSSYVLLQQATNT 740

Query: 796  LLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEK 855
             LSV      ++LPL ++  R   RFAL+SA+G LEY KGG LF+DNK LLL V++E+E 
Sbjct: 741  FLSVQSCFKTRHLPLAIDLPRIKARFALLSARGILEYTKGGALFQDNKALLLEVVKELEA 800

Query: 856  DRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLP 915
             +KLELPG + WHSL LLD+A  L +  P   +DKL+K L+ ++NYYNK+MG+  +T   
Sbjct: 801  SKKLELPGSLSWHSLILLDMATLLIMQPPQTKTDKLDKLLETRLNYYNKLMGRSTLT--- 857

Query: 916  SSKTKRKQSKEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTESTQS--- 972
             S  KRK  + D  T+   +   + +E +T   KR    +++      GN   +++S   
Sbjct: 858  -SNGKRKNEENDA-TSKVSKLTPLSSEYNTPSDKR----IKVESIGSSGNVPSNSESVHH 911

Query: 973  ---------------------AFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRE 1011
                                 A  EA  LDP+LN N   FS  DL+ FF  N +  +P+ 
Sbjct: 912  FDDIQNDKFSTNWPSNNPQPNAIAEAFHLDPVLNGNP--FSNGDLTAFF--NSDNGIPQI 967

Query: 1012 SREPAVQQPIPDRTSLPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSH 1071
                +V                 + G  +    E +    +A G     G P  + T  +
Sbjct: 968  GGGSSVLN---------------LAGIGAANSNELNNNNNEAAG-----GGPRKVATTVN 1007

Query: 1072 NN--SVSTMMMFLNNDYPF---SSMNLNALY-----------APDGYKESSAQPGKQFTL 1115
            +    V +   FL + Y     SS  LN ++           AP+  K +   PG     
Sbjct: 1008 DGLFRVPSNGDFLKDYYRIPGASSSQLNLMFMGPGNTGANQNAPNNQKNNFTVPG----- 1062

Query: 1116 NTGEPHSTYDFGMIVDASLGLAPLLNEAPEI--PGQPEFF------NSDEMSPSQLTGKL 1167
                      FG  VDASLGLAPLL  +PE   P  PE        +SD +S ++L    
Sbjct: 1063 ----------FGFTVDASLGLAPLLAWSPEAPQPSMPEIAQNADRRDSDPLSRTRLPSAT 1112

Query: 1168 MPMA-VNKPMDQNSNFTY---NYKSSVEN-----NEGLTLEAI------RGGETSTQRVS 1212
            +P +     + Q+SN  +    Y+S+  N     ++ L   AI        G       S
Sbjct: 1113 IPASDPTHVISQDSNNVHLREQYRSNSFNQLYAQDQSLDDTAITIPTRSHRGPRRRWNSS 1172

Query: 1213 NGHIRV----NRQR-------QSDAVDDLFSWQNS 1236
            NG   +    +R R       +++   DLF WQNS
Sbjct: 1173 NGTTVITPNSDRPRNPPSSESENENYKDLFRWQNS 1207

>NDAI0K00390 Chr11 (84641..89128) [4488 bp, 1495 aa] {ON} Anc_8.845
          Length = 1495

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/1130 (37%), Positives = 587/1130 (51%), Gaps = 237/1130 (20%)

Query: 130  GKKSLKELKDTLSPISRPSSSTTANGDGAEPLL-SSRPDAAGRASQACDRCRLKKIKCDL 188
            G  ++   K  L  IS  SS+ T +   +  +  S+  + + R SQACDRCR KK +CD 
Sbjct: 61   GNSNMAVSKRKLDSISNSSSTDTKDDSVSISITDSTSGNYSKRISQACDRCRSKKTRCDG 120

Query: 189  KRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMNDLKEQQLF 248
            KRPQCS CA VGFECK+SDKL R S+PRGYT                  A+ +LK+ QL 
Sbjct: 121  KRPQCSQCAIVGFECKVSDKLQRKSYPRGYTETLEEKIRELQTENKRLLAIYNLKQNQLS 180

Query: 249  -------------------KIPEDIQSVVDV-DAELNSSNQTK-------------NMYA 275
                                +  +  S   + D   N SN+T              N+ +
Sbjct: 181  VSSSSSSTSPNKKGNGNDCAVQSNSTSTSAINDTNENGSNETAMKEIIQSQLIPLTNINS 240

Query: 276  THVCDGI----------CCQDT-------------------KLHS-------RPVATNFN 299
             H  D I          CC  T                   KLH         P   + N
Sbjct: 241  VH--DPIQNNDDNTHTDCCNHTIKTINPDNNNNYSTHTTNGKLHRDTNDHHLHPKPVSTN 298

Query: 300  LNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKI 359
             N   S+SFEQNEAPGL   +A+  + N E++TQLA LVSL+IPRSTEEILFIPQ+LAK+
Sbjct: 299  SNGLNSISFEQNEAPGLSTVKALKSMVNDEKNTQLATLVSLAIPRSTEEILFIPQILAKV 358

Query: 360  RQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSN 419
            RQ FGFTSK CLYTV                        ++ N + L + NLW    L  
Sbjct: 359  RQNFGFTSKHCLYTVSLLSSLKSFLSNSNNSISAASA--DNKNLETLKNTNLWKFNALFQ 416

Query: 420  FFQNVLKLNILPXXXXXXXXXXXXX------------------ALSEIDELVALYFKYWS 461
            FF   LKL+ L                                + SEIDEL+ L+F+ WS
Sbjct: 417  FFTAFLKLDFLDSSLEKQNKGKKNGKVNNNNNNSANQDGISPLSSSEIDELLKLFFQNWS 476

Query: 462  DSIPIFNEKEFNSNYRVFKADLM--KLSKNGPSSLENILNIKIFGCLLTVICQMGIL--- 516
            D + + NEKEF   Y VFK+DL    +SK    SL  ++N KIFG ++ + CQMG+L   
Sbjct: 477  DFVLMINEKEFYQYYSVFKSDLQNNNISK---MSLSTLMNYKIFGLIILLFCQMGLLSKI 533

Query: 517  ------IKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHL 570
                   K KNFK +    +K+++YYH+L+  L  N +F +   +++++++LSLILFY+L
Sbjct: 534  KLSSNNTKSKNFKQQY-HLKKVMNYYHNLINKLMWNEFFKISNVTLQSLKLLSLILFYNL 592

Query: 571  NTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVF 630
            + G+I  IY+LR  +ISM+QQLRLHRCPSAVL GS  K+ +LEQ NRR LFW IYYLD+F
Sbjct: 593  HMGNISNIYELRSKVISMSQQLRLHRCPSAVLCGSTLKIHKLEQSNRRLLFWNIYYLDIF 652

Query: 631  CSLQLGVPRLIKDHEIECALPL--------------SSEIHNTDKMDGVQLEGTMSEFSL 676
             SLQLGVPRL+KDHEIECALP+              S+  +  +  + ++LEG +S  SL
Sbjct: 653  ASLQLGVPRLLKDHEIECALPIPMDTDSKSDNQSQRSAATNAENDDNKIKLEGCVSHLSL 712

Query: 677  SVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDL 736
             ++R ++++GNILD IFKRNM+ES+T+ +  IH +ALD WR  LP   +F LN NG +DL
Sbjct: 713  VIIRYSQIVGNILDMIFKRNMTESMTKSIALIHIHALDDWRNTLPSNLKFDLNVNGSIDL 772

Query: 737  ------EHLNHE-------NLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYMNH- 782
                  ++LN E        L+++ L+F   +MI+MP+ ++       P V+ND  +N  
Sbjct: 773  SSFIDQQNLNEEEQRTQQQKLLVIFLYFFGVNMIHMPVVASRPL----PLVEND-SLNQI 827

Query: 783  ----KVSHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLL 838
                  S+ +LQ + N +L+V   ++  Y+PLP+N SRTM RF+++SA G L++ KGG L
Sbjct: 828  PDRSSSSYIALQHATNTMLNVLDLLSPTYVPLPINMSRTMVRFSMISACGMLDFIKGGSL 887

Query: 839  FEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKK 898
            F +NK LL  V++ IE DR L+LPG+I WHSLKL DL + LF     I  +KL+K L+KK
Sbjct: 888  FLENKALLAQVVKNIETDRFLDLPGVISWHSLKLFDLTLTLFFQNTNIKLEKLDKLLEKK 947

Query: 899  INYYNKIMGKPLI--------TSLPSSKTKRKQSKEDLFTANKKRKQQVKTE-------- 942
             NYYN++MGKP++        T++P+S +   ++  DL  A+KK+K  V TE        
Sbjct: 948  SNYYNRLMGKPIVRNPAEKNSTTVPASMSAVDET--DLPRADKKKKDIVDTENEYVSSVP 1005

Query: 943  ------------------------------LSTLEV------KREPQQVQLLKREGQG-- 964
                                          L+T+E+      KR+ +Q+  + ++ +   
Sbjct: 1006 DTNNIVVKQTPEEWDTSTKTNVKDSTLAHKLTTIELPSTDKKKRKQEQISPVNKKAKKAE 1065

Query: 965  ------------NTTEST---------QSAFVEALQLDPILNANIYNFSGTDLSNFFIS- 1002
                        ++T ST         Q+ F +ALQ DPILN+N +NFS  DLS+ F + 
Sbjct: 1066 QEVSQTQVGVPRSSTSSTAQNSNYANIQNQFADALQFDPILNSNSFNFSNLDLSSLFKTV 1125

Query: 1003 ------NQNGDVP-RESREPAVQQPIPDRTSLPATNTSVVTGFDSLPKPE 1045
                    N  VP + S +P     I   T++P       T   S P P+
Sbjct: 1126 DKDSQKTNNLQVPTQNSDQPVAANGI--STTVP------TTSIQSFPTPK 1167

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 65/220 (29%), Positives = 84/220 (38%), Gaps = 65/220 (29%)

Query: 1074 SVSTMMMFLNNDYPFSSMNLNALYAPDGYKES--------------SAQPGKQFTLN-TG 1118
            S+STMMM +NN+ PFSS+NL+ L  P   K S              S + G    LN  G
Sbjct: 1283 SLSTMMMLINNEIPFSSVNLSELLKPSESKTSNDNASNGISANSHNSLEFGNTLKLNQNG 1342

Query: 1119 EPHSTY-------------------------DFGMIVDASLGLAPLL------NEAPEIP 1147
              + T                          D+   VDASLGLAPLL      N  PE  
Sbjct: 1343 NSNVTTNGTSMNQVEIPSTLIADSLTDTPIPDYNYFVDASLGLAPLLETQRRHNSFPET- 1401

Query: 1148 GQPEFFNSDEM-------SPSQLTGKLMPMAVNKPMDQNSNFTYN----YKSSVENNEGL 1196
             QP    S+ M       S +      MP   N       N  YN      SS +    L
Sbjct: 1402 SQPLVNTSNAMNLGNASLSSTANNNNTMPSIAN-------NVGYNNPPLLSSSKQKPRHL 1454

Query: 1197 TLEAIRGGETSTQRVSNGHIRVNRQRQSDAVDDLFSWQNS 1236
                          +SN + R + +R+ + ++DLFSWQNS
Sbjct: 1455 PTNDTGDILNFNGDLSNLNFRRDVRRKRENLEDLFSWQNS 1494

>Suva_13.468 Chr13 complement(809712..812654,812694..814007) [4257
           bp, 1418 aa] {ON} YMR280C (REAL)
          Length = 1418

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/895 (42%), Positives = 513/895 (57%), Gaps = 130/895 (14%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCR KK +CD KRPQCS CA+VGFEC++SDKL R ++P+GYT           
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 123

Query: 231 XXXXXXXAMNDLKEQQLFKI-----PEDIQSVVD-------VDAELNSS-------NQTK 271
                  A+ D+KEQQ+  +     P  + + V         DA LN S       NQT 
Sbjct: 124 AENKRLLALCDIKEQQINLVSQSRPPTSLDNTVSDNFKQDLKDAPLNLSSTNIYLLNQTV 183

Query: 272 N------------------MYAT--------HVCDGICCQDTKLHSRPVATNFNLNDPTS 305
           N                  + AT        HVCDG+ C +  LH++P +T+  LNDPT+
Sbjct: 184 NKQLQNGKIDTNRSDSTMGLLATSPPLPQKDHVCDGVSCTNN-LHAKPTSTS--LNDPTA 240

Query: 306 VSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGF 365
           +SFEQNEAPGL A +A+  ++ H++STQLA LVSLSIPRSTEEILFIPQLL +IRQ+FGF
Sbjct: 241 ISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 300

Query: 366 TSKQCLYTVXXXXXXXXX--XXXXXXXXXXXMILQNSSN--FDILTSVNLWHLENLSNFF 421
            SKQCLYTV                       I +N  +   +   + +L    +L  F 
Sbjct: 301 NSKQCLYTVSLLSSLKNRLPAPKLLLSSTSTKIKENDDSKFLNTFETTSLAEFGDLKKFL 360

Query: 422 QNVLKLNILPXXXXXXXXXXXXX-----ALSEIDELVALYFKYWSDSIPIFNEKEF---- 472
            + LK +I                    +L+EI EL+ L+FK+WS+ + I N   F    
Sbjct: 361 IS-LKFDINSFSNQQPEVQNNKSDNDLLSLNEIKELLHLFFKFWSNQVSILNNDHFLLYF 419

Query: 473 NSNYRVFKADLMKLSKNGPSSLENILNIKIFGCLLTVICQMGILIKYKNFK-------NK 525
           N+   V KA  ++L K   +      N +IF   L ++ QMG+LIK K  K       N+
Sbjct: 420 NNFVEVIKALPLELKKTNGTKTHATTNHQIFALKLLIMLQMGLLIKVKREKIKDTVPGNQ 479

Query: 526 SPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGM 584
           + KF KL+ YYH +  ++PKN YF  + TTS+ ++Q+LSL  FY LN GDI  IY LRG 
Sbjct: 480 NSKFAKLMVYYHQVSSIIPKNPYFLNMSTTSLPSLQLLSLTSFYFLNVGDIPAIYGLRGR 539

Query: 585 IISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKD 643
           I+SM+QQLRLHRCPSAVL+  S   + R EQ  RR LFW +YY+DVF SLQLGVPRL+KD
Sbjct: 540 IVSMSQQLRLHRCPSAVLSVHSNPVLQRFEQSERRLLFWAVYYIDVFASLQLGVPRLLKD 599

Query: 644 HEIECALPLSSEIHNTDKMDG-----------VQLEGTMSEFSLSVVRCAKVLGNILDSI 692
            +IECALP+S ++   D++             +QL+G +S FSL ++R AK+LGNILDSI
Sbjct: 600 FDIECALPIS-DVEFEDQLASENEKTKNKTKKIQLQGQVSSFSLQIIRFAKILGNILDSI 658

Query: 693 FKRNM-SESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNHENL------- 744
           FKR M  E +T +V  +HENALD+WR +LP+ Y F++  NG V+L+ +   N        
Sbjct: 659 FKRGMMDERVTSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDDIRANNSRNTEAKF 718

Query: 745 -----------ILVLLFFLVKSMIYMPLSSAI---TELANNPKVKNDYYMN--------- 781
                      +L+L +FL KSMI++P+ +       + N+ K K+  + N         
Sbjct: 719 DRKDIICFEKNVLLLFYFLAKSMIHLPVIATKPLPKTVDNSTKKKHSMFNNDTKSINNQD 778

Query: 782 HKV--------------SHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAK 827
           H V              S+  LQQ+ NA L++F++IN+ YLPLPLN SRT+ RF+L+ A+
Sbjct: 779 HSVVDVDMTSPAIRTSSSYIILQQATNATLTLFQSINSVYLPLPLNVSRTLIRFSLLCAR 838

Query: 828 GSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTIN 887
           GSLEY KGG LF DNK LLL  I++IE DR L+LPG+  WH+LKL D+ +NL L  P + 
Sbjct: 839 GSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGVASWHTLKLFDMTINLLLKAPNVK 898

Query: 888 SDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKTE 942
            ++L+KFL+KK+NYYN++MG P  T+  S      QSK     AN  R   VK E
Sbjct: 899 VERLDKFLEKKLNYYNRLMGLPPTTTTSSEPLFSSQSKNT--PANGSRSSIVKRE 951

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 50/130 (38%), Gaps = 42/130 (32%)

Query: 1057 SLKKGYPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNA-LYAPDGYKESSAQPGKQFTL 1115
            S++K  P F      N S++ +M  LNND  FS++++N  LY  D  +   A        
Sbjct: 1144 SMEKSSPIF--NNKSNYSLTKLMRLLNNDNSFSNISINNFLYQNDSSRHDPAIKAAANVS 1201

Query: 1116 NTGEPHST---------------------------------------YDFGMIVDASLGL 1136
            +   P ST                                        D+  IVDASLGL
Sbjct: 1202 SNFNPASTASNTSRSSITGNKKNGMDNCDINDFGNFNNFMTNVNYSGVDYDYIVDASLGL 1261

Query: 1137 APLLNEAPEI 1146
            APLL + P+I
Sbjct: 1262 APLLVDTPDI 1271

>YMR280C Chr13 complement(827028..831329) [4302 bp, 1433 aa] {ON}
           CAT8Zinc cluster transcriptional activator necessary for
           derepression of a variety of genes under
           non-fermentative growth conditions, active after diauxic
           shift, binds carbon source responsive elements
          Length = 1433

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/901 (42%), Positives = 504/901 (55%), Gaps = 135/901 (14%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCR KK +CD KRPQCS CA+VGFEC++SDKL R ++P+GYT           
Sbjct: 65  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 231 XXXXXXXAMNDLKEQQLFKIPEDI-QSVVD-----------VDAELNSS-------NQTK 271
                  A+ D+KEQQ+  + +   Q+  D            DA LN S       NQT 
Sbjct: 125 AENKRLLALCDIKEQQISLVSQSRPQTSTDNTINGNFKHDLKDAPLNLSSTNIYLLNQTV 184

Query: 272 N--------------------------MYATHVCDGICCQDTKLHSRPVATNFNLNDPTS 305
           N                           +  H+CDG+ C +  LH +P +T+  LNDPT+
Sbjct: 185 NKQLQNGKMDGDNSGSAMSPLGAPPPPPHKDHLCDGVSCTN-HLHVKPTSTS--LNDPTA 241

Query: 306 VSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGF 365
           +SFEQ+EAPGL A +A+  ++ H++STQLA LVSLSIPRSTEEILFIPQLL +IRQ+FGF
Sbjct: 242 ISFEQDEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 301

Query: 366 TSKQCLYTVXXXXXXX-----------XXXXXXXXXXXXXMILQNSSNFDILTSVNLWHL 414
            SKQCLYTV                                +  +S+      S NL   
Sbjct: 302 NSKQCLYTVSLLSSLKNRLPAPRLLAPSTSTKLKEKDEDKKLDDDSAFVKRFQSTNLSEF 361

Query: 415 ENLSNFFQNVLKLNILPXXXXXXXXXXXXX----ALSEIDELVALYFKYWSDSIPIFNEK 470
            +L  F  + LK NI                   +L+EI EL+ L+FK+WS+ +PI N  
Sbjct: 362 VDLKKFLIS-LKFNINSFSKQSEKPANDQDDELLSLTEIKELLHLFFKFWSNQVPILNND 420

Query: 471 EF----NSNYRVFKA-DLMKLSKNGPSSLENILNIKIFGCLLTVICQMGIL-------IK 518
            F    N+   V K      L  N  +      N +IF   L ++ QMG+L       IK
Sbjct: 421 HFLIYFNNFVEVVKHLSTENLETNNTTKSTVTTNHEIFALKLLMMLQMGLLVKIKMEKIK 480

Query: 519 YKNFKNKSPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQ 577
           Y   KN   K+ +L++YYH L  ++PKN YF  + TTS+ ++Q+LSL  FY+LN GDI  
Sbjct: 481 YTVPKNPKAKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISA 540

Query: 578 IYDLRGMIISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636
           IY +RG I+SMAQQLRLHRCPSAVL+  S   + + EQ  RR LFW IYY+DVF SLQLG
Sbjct: 541 IYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLG 600

Query: 637 VPRLIKDHEIECALP---------LSSEIHNTDK-MDGVQLEGTMSEFSLSVVRCAKVLG 686
           VPRL+KD +IECALP         LS E    DK    +QL+G +S FSL ++R AK+LG
Sbjct: 601 VPRLLKDFDIECALPISDVEYKDQLSMENEKADKKAKKIQLQGQVSSFSLQIIRFAKILG 660

Query: 687 NILDSIFKRNM-SESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLN----- 740
           NILDSIFKR M  E IT +V  +HENALD+WR +LP+ Y F++  NG V+L+ +      
Sbjct: 661 NILDSIFKRGMMDERITSEVALVHENALDNWRNQLPEMYYFQITVNGTVNLDEIRATNQR 720

Query: 741 -------------HENLILVLLFFLVKSMIYMPLSSAI---TELANNPKVKNDYYMN--- 781
                         E  IL+L +FL KSMI++P+ +       + N  K K   + N   
Sbjct: 721 NTETKFDKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNVDNATKKKQSMFNNDSK 780

Query: 782 ------HKV--------------SHTSLQQSINALLSVFKNINNQYLPLPLNSSRTMTRF 821
                 H +              S+  LQQ+ NA L++F+ IN+ YLPLPLN SRT+ RF
Sbjct: 781 GATNQDHMILDVDMTSPAIRTSSSYIILQQATNATLTIFQAINSMYLPLPLNVSRTLIRF 840

Query: 822 ALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFL 881
           +L+ A+GSLEY KGG LF DNK LLL  I++IE DR L+LPGI  WH+LKL D+++NL L
Sbjct: 841 SLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGIASWHTLKLFDMSINLLL 900

Query: 882 LGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKT 941
             P +  ++L+KFL+KK+NYYN++MG P  T+         QSK  L   N++R   VK 
Sbjct: 901 KAPNVKVERLDKFLEKKLNYYNRLMGLPPATTTSLKPLFGSQSKNSL--ENRQRTPNVKR 958

Query: 942 E 942
           E
Sbjct: 959 E 959

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 70/177 (39%), Gaps = 58/177 (32%)

Query: 1026 SLPATNTSVVTGFDSLPK---------PENSKP---AKDAIGPSLKKGYPSFIGTKSHNN 1073
            SLP+    +    DS P+         PENSK     +     +++K   SF      N 
Sbjct: 1112 SLPSNLDLMKDNMDSKPEQLEPVIKQNPENSKNNQFHQKGKSTNMEKNNLSF--NNKSNY 1169

Query: 1074 SVSTMMMFLNNDYPFSSMNLNALYAPDGYKESSAQPG--KQFTLNTG---EPHST----- 1123
            S++ +M  LNND  FS++++N     +    +SA PG  K+   N G   +P ST     
Sbjct: 1170 SLTKLMRLLNNDNSFSNISINNFLYQNDQNSASADPGTNKKAVTNAGANFKPPSTGSNTS 1229

Query: 1124 ----------------------------------YDFGMIVDASLGLAPLLNEAPEI 1146
                                               D+  IVDASLGLAPLL + P+I
Sbjct: 1230 QGSILGSTKHGMDNCDFNDLGNFNNFMTNVNYSGVDYDYIVDASLGLAPLLVDTPDI 1286

>Smik_13.493 Chr13 complement(810035..814336) [4302 bp, 1433 aa] {ON}
            YMR280C (REAL)
          Length = 1433

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1230 (35%), Positives = 617/1230 (50%), Gaps = 262/1230 (21%)

Query: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
            R +QACDRCR KK +CD KRPQCS CA+VGFEC++SDKL R ++P+GYT           
Sbjct: 65   RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 124

Query: 231  XXXXXXXAMNDLKEQQLFKI-----PEDIQSVVD-------VDAELNSS-------NQTK 271
                   A+ D+KEQQ+  +     P  + +  +        DA LN S       NQT 
Sbjct: 125  AENKRLLALCDIKEQQISLVSQSRPPTSMDNTANGSFKQELKDAPLNLSSTNIYLLNQTV 184

Query: 272  NMY--------------------------ATHVCDGICCQDTKLHSRPVATNFNLNDPTS 305
            N                              HVCDGI C +  LH +P +T+  LNDPT+
Sbjct: 185  NKQLQNGKMDSDNSNTVMNSLAAAPLPPQKDHVCDGISCTN-HLHVKPTSTS--LNDPTA 241

Query: 306  VSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGF 365
            +SFEQ+EAPGL A +A+  ++ H++STQLA LVSLSIPRSTEEILFIPQLL +IRQ+FGF
Sbjct: 242  ISFEQDEAPGLPAVKALKLMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 301

Query: 366  TSKQCLYTVXXXXXXX-----------XXXXXXXXXXXXXMILQNSSNFDILTSVNLWHL 414
             SKQCLYTV                               ++  +S+ F    + NL   
Sbjct: 302  NSKQCLYTVSLLSSLKNRLPAPRLLPPSTSTKLKEKGEDKILDDDSAFFKKFQTTNLSEF 361

Query: 415  ENLSNFFQNVLKLNILPXXXXXXX----XXXXXXALSEIDELVALYFKYWSDSIPIFNEK 470
             +L  F  + LK +I                   +L+EI EL+ L+FK+WS+ +PI N  
Sbjct: 362  VDLKGFLVS-LKFDIDSFSKQSENLPNDHDNELLSLTEIKELLHLFFKFWSNQVPILNND 420

Query: 471  EFNSNYRVFKADLMKLSK-NGPSSLENI----LNIKIFGCLLTVICQMGIL-------IK 518
             F   +  F   +  LS  N  +++ N      N ++F   L+++  MG+L       IK
Sbjct: 421  HFLLYFNNFVEVVKDLSSANLKTNVTNTSIVTTNHELFALKLSMMLLMGLLVKIKMEKIK 480

Query: 519  YKNFKNKSPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQ 577
            Y   KN + K+ +L++YYH L  ++PKN YF  + TTS+ ++Q+LSL  FY+LN GDI  
Sbjct: 481  YTVPKNPNSKYARLMAYYHQLSLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISA 540

Query: 578  IYDLRGMIISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636
            IY +RG I+SMAQQLRLHRCPSAVL+  S   + + EQ  RR LFW IYY+DVF SLQLG
Sbjct: 541  IYGVRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLG 600

Query: 637  VPRLIKDHEIECALPLSSEIHNTDKM-----------DGVQLEGTMSEFSLSVVRCAKVL 685
            VPRL+KD +IECALP+S ++   D++             +QL+G +S FSL ++R AK+L
Sbjct: 601  VPRLLKDFDIECALPIS-DVEYKDQLFMENKKTNKKAKKIQLQGQVSSFSLQIIRFAKIL 659

Query: 686  GNILDSIFKRNM-SESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLN---- 740
            GNILDSIFKR M  E IT +V  +HENALD+WR++LPK Y F++  NG V+L+ +     
Sbjct: 660  GNILDSIFKRGMMDERITSEVALVHENALDNWRSQLPKMYYFQITVNGTVNLDEIRVNDS 719

Query: 741  --------------HENLILVLLFFLVKSMIYMPLSSAI--------------TELANNP 772
                           E  IL+L +FL KSMI++P+ +                +  +N+ 
Sbjct: 720  KNIETRFEKKDIILFEKKILLLFYFLAKSMIHLPVIATKPLPKNIDNGTKKKQSVFSNDS 779

Query: 773  KVKNDY-YMNHKVSHTS-----------LQQSINALLSVFKNINNQYLPLPLNSSRTMTR 820
            K  ND  +M   V  TS           LQQ+ NA L +F+ IN  Y+PLPLN SRT+ R
Sbjct: 780  KGSNDQDHMIVDVDMTSPAIRTSSSYIILQQATNATLMIFQTINWMYIPLPLNVSRTLIR 839

Query: 821  FALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLF 880
            F+L+ A+GSLEY KGG LF DNK LLL  I++IE DR L+LPG   WH+LKL D+ +NL 
Sbjct: 840  FSLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLDLPGTASWHTLKLYDMTINLL 899

Query: 881  LLGPTINSDKLEKFLQKKINYYNKIMG---------KPLITSL----PSSKTKRKQSK-- 925
            L  P +  ++L+KFL+KK+NYYN++MG         KP++ S     P ++ ++   K  
Sbjct: 900  LKAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSIKPILGSQSKDSPETRPRKSIVKRE 959

Query: 926  ----EDLFTANKKRKQQVKTELSTLE-----VKREPQQVQLLKREGQGNTTESTQSAFVE 976
                E L+  +  +K     + S +E      KR   +    +    G+  +S  +   +
Sbjct: 960  NPEYEYLYGKDDNKKNNSGPDQSPIENTSNGSKRLKYETDTKRGVDTGSIFKSQNAENFQ 1019

Query: 977  ALQLDPILNANIY--NFSGTDLSNFFISNQNGDVPRESREPAVQQPIPDRTSLPATNTSV 1034
                  +  +N++  +FS TDL+  F    + +    +          DR S  A + ++
Sbjct: 1020 HNNKKTMSTSNLFPFSFSNTDLTALFT---HPEGANGANNNNSNFNGCDRFSTDAADANI 1076

Query: 1035 VT-GF------------DSLPKPENSKPA---------------KDAIG-------PSLK 1059
               GF             + P   N+KP                KD +G       P +K
Sbjct: 1077 ENLGFLNAAPFLQAGNSKTDPNMTNNKPMHMDALFSLPSNLDLMKDNMGSKSERLEPVIK 1136

Query: 1060 KGYPSFIGTKSH-------------------NNSVSTMMMFLNNDYPFSSMNLNALYAPD 1100
            +   S   +K H                   N S++ +M  LNND  FS++++N     +
Sbjct: 1137 QNTESLASSKLHEKNKDSIMENNNLAFNNKSNYSLTKLMRLLNNDNSFSNISINNFLYQN 1196

Query: 1101 GYKESSAQPG--KQFTLNTG---EPHST-------------------------------- 1123
                 S  PG   +   NTG   +P ST                                
Sbjct: 1197 DQSSISRDPGADNKTATNTGSIFKPPSTAGHRSQSSSIGNTNHGVDNCDFNDLGNFNNFM 1256

Query: 1124 -------YDFGMIVDASLGLAPLLNEAPEI 1146
                    D+  IVDASLGLAPLL + P+I
Sbjct: 1257 TNVNYSGVDYDYIVDASLGLAPLLVDTPDI 1286

>Skud_13.452 Chr13 complement(800289..804587) [4299 bp, 1432 aa]
           {ON} YMR280C (REAL)
          Length = 1432

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/901 (42%), Positives = 510/901 (56%), Gaps = 135/901 (14%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCR KK +CD KRPQCS CA+VGFEC++SDKL R ++P+GYT           
Sbjct: 64  RIAQACDRCRSKKTRCDGKRPQCSQCAAVGFECRISDKLLRKAYPKGYTESLEERVRELE 123

Query: 231 XXXXXXXAMNDLKEQQLFKIPED-----IQSVVD-------VDAELNSS-------NQTK 271
                  A+ D+KEQQ+  + +      + S VD        DA LN S       NQT 
Sbjct: 124 AENKRLLALCDIKEQQISLVSQSRPSTSLDSNVDGNCKKELKDAPLNLSSTNIYLLNQTV 183

Query: 272 NMY--------------------------ATHVCDGICCQDTKLHSRPVATNFNLNDPTS 305
           N                              HVCDG+ C + +LH +P +T+  L+DPT+
Sbjct: 184 NKQLQSGKMDNDNSDAAIDSLAASPSPPPKDHVCDGVSCTN-RLHVKPTSTS--LSDPTA 240

Query: 306 VSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGF 365
           +SFEQNEAPGL A +A+  ++ H++STQLA LVSLSIPRSTEEILFIPQLL +IRQ+FGF
Sbjct: 241 ISFEQNEAPGLPAVKALKSMTTHQRSTQLATLVSLSIPRSTEEILFIPQLLTRIRQIFGF 300

Query: 366 TSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFD-----------ILTSVNLWHL 414
            SKQCLYTV                           N D              S +L   
Sbjct: 301 NSKQCLYTVSLLSSLKNRLPAPSILLPSTSTNSKEKNEDKTPNDDSAFLKTFQSTSLSEF 360

Query: 415 ENLSNFFQNVLKLNILPXXXXXXXXXXXXXA----LSEIDELVALYFKYWSDSIPIFNEK 470
            +L  F  + LK +I               +    L+EI EL+ L+FK+WS+ +PI N  
Sbjct: 361 VDLKKFLIS-LKFDIDSFSKQPEKQANGHDSDLLSLTEIKELLHLFFKFWSNQVPILNND 419

Query: 471 EF---NSNYRVFKADLMKLSKNGPSSLEN--ILNIKIFGCLLTVICQMGILIKYKNF--- 522
            F    +N+     D   +S    S+ +N    N +IF   L ++ QMG+LIK K     
Sbjct: 420 HFLLYFNNFVEIIKDFSLISTKANSTTKNNVTTNHEIFTLKLLMMLQMGLLIKIKKDKIK 479

Query: 523 ----KNKSPKFEKLLSYYHHLMYVLPKNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQ 577
               +N + K+ +L+SYYH +  ++PKN YF  + TTS+ ++Q+LSL  FY+LN GDI  
Sbjct: 480 DTVPRNSNAKYIRLMSYYHQISLIIPKNPYFLNMSTTSLPSLQLLSLASFYYLNVGDISA 539

Query: 578 IYDLRGMIISMAQQLRLHRCPSAVLT-GSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636
           IY +RG I+SMAQQLRLHRCPSAVL+  S   + + EQ  RR LFW IYY+DVF SLQLG
Sbjct: 540 IYGIRGRIVSMAQQLRLHRCPSAVLSVHSNPVLQKFEQSERRLLFWAIYYVDVFASLQLG 599

Query: 637 VPRLIKDHEIECALPLSS-------EIHN---TDKMDGVQLEGTMSEFSLSVVRCAKVLG 686
           VPRL+KD +IECALP+S         + N    +K   +QL+G +S FSL ++R AK+LG
Sbjct: 600 VPRLLKDFDIECALPISDVEYKDQLSMENEKMKNKAKKIQLQGQVSSFSLQIIRFAKILG 659

Query: 687 NILDSIFKRN-MSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNHEN-- 743
           NILDSIFKR  M E I+ +V  +HENALD+WR +LP+ Y FK+  NG V+L+ +   N  
Sbjct: 660 NILDSIFKRGMMDERISSEVALVHENALDNWRNQLPEMYYFKITVNGTVNLDEIRANNSR 719

Query: 744 ----------------LILVLLFFLVKSMIYM------PLSSAITELA--------NNPK 773
                            IL+L +FL KSMI++      PLS  +  +         N+ K
Sbjct: 720 DIETPFETKDIILFEKKILLLFYFLAKSMIHLPVIATKPLSKNVDNVMKKKQSMFNNDSK 779

Query: 774 VKNDY-YMNHKVSHTS-----------LQQSINALLSVFKNINNQYLPLPLNSSRTMTRF 821
             N++ +M   V  TS           LQQ+ NA L++F++IN  YLPLPLN SRT+ RF
Sbjct: 780 GTNNHDHMAVDVDMTSPAIRTSSSYIILQQATNATLTIFQSINWMYLPLPLNVSRTLVRF 839

Query: 822 ALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFL 881
           +L+ A+GSLEY KGG LF DNK LLL  I++IE DR LELPGI  WH+LKL D+ +NL L
Sbjct: 840 SLLCARGSLEYTKGGALFLDNKNLLLDTIKDIENDRLLELPGIASWHTLKLFDMTINLLL 899

Query: 882 LGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFTANKKRKQQVKT 941
             P +  ++L+KFL+KK+NYYN++MG PL T+         QSK    T  K RK  VK 
Sbjct: 900 KAPNVKVERLDKFLEKKLNYYNRLMGLPLATTTSLKPLFGFQSKNSPET--KPRKSTVKR 957

Query: 942 E 942
           E
Sbjct: 958 E 958

 Score = 36.6 bits (83), Expect = 0.60,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 1121 HSTYDFGMIVDASLGLAPLLNEAPEI 1146
            +S  D+  IVDASLGLAPLL + P+I
Sbjct: 1260 YSGVDYDYIVDASLGLAPLLVDTPDI 1285

>CAGL0M03025g Chr13 complement(341849..345613) [3765 bp, 1254 aa] {ON}
            similar to uniprot|P39113 Saccharomyces cerevisiae
            YMR280c CAT8 transcription factor involved in
            gluconeogenesis
          Length = 1254

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1087 (37%), Positives = 583/1087 (53%), Gaps = 169/1087 (15%)

Query: 171  RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
            R +QACDRCRLKK KCD K PQCS CA VGFECK+SD+L R SFPRGYT           
Sbjct: 55   RVAQACDRCRLKKTKCDGKIPQCSQCALVGFECKISDRLNRKSFPRGYTETLEERVRELE 114

Query: 231  XXXXXXXAM--NDL---------------KEQQLFKIPEDIQSVVDVDAELN---SSNQT 270
                   A+  +DL               K ++   +  D +     + EL    S +  
Sbjct: 115  TENKRLMALCNSDLGSNTRSDGLEKQSPSKRKRSPSMERDSERGFTENMELQLQQSCSSC 174

Query: 271  KNMYATHVCDGICCQDTKLHSRPVATNFNLNDPTSVSFEQNEAPGLMAARAIDQISNHEQ 330
             N    H C         +H +PV +N  ++  T VSFEQN APGL A +A++ ++  E+
Sbjct: 175  GNSDPNHRC---------VHLKPVVSNIIVDSNTDVSFEQNVAPGLPAVKALNSMAEREE 225

Query: 331  STQLAILVSLSIPRSTEEILFIPQLLAKIRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXX 390
            S QLA+LVSL++PRSTEEILFIPQL+A I++ FGF+SKQ LYTV                
Sbjct: 226  SAQLAMLVSLALPRSTEEILFIPQLMANIQKTFGFSSKQSLYTVSLLSSLKKN------- 278

Query: 391  XXXXMILQNSSNFDILTSVNLWHLENLSNFFQNVLKLNIL--------------PXXXXX 436
                +   NS++ D   S N +  E+   FF  VLK +IL              P     
Sbjct: 279  ----LPTPNSNSSDENLSPNYYVSEDFRPFFYEVLKFDILGETETENGSNRNESPDSTIP 334

Query: 437  XXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLE- 495
                    +  EI  LV +YF+ WS++IPIF+ K F    + FK ++ K    G    E 
Sbjct: 335  NSRSDDLLSWMEIQRLVDVYFECWSNTIPIFSRKLFIKQMKAFKTEVDKF---GDRLFEV 391

Query: 496  ------NILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFE-----KLLSYYHHLMYVLP 544
                   I  +KIF  +L V+CQM +L + K  +  + + E      L+++Y+ L+  + 
Sbjct: 392  YKTEQIKINFLKIFATVLAVMCQMALLSRLKQLEATTQELECKRTQNLIAHYNQLIEKIH 451

Query: 545  KNSYF-GVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVL- 602
             +S+F  + TT+++++Q+LS I FY LN GDI ++Y LRG +ISMAQQLRLHRCPSAVL 
Sbjct: 452  LDSFFQDMSTTTVQSLQLLSFISFYFLNVGDIPRLYQLRGTVISMAQQLRLHRCPSAVLL 511

Query: 603  TGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKM 662
            + SGS M + EQG RR LFW IYYLDVF SLQLGVPRLIKDHEIECALP+S E       
Sbjct: 512  SASGSTMQKFEQGERRLLFWAIYYLDVFYSLQLGVPRLIKDHEIECALPVSEE------- 564

Query: 663  DGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNM-SESITEQVYTIHENALDSWRTKLP 721
            +  QLEG +S+FSL+V+R AKVLGNILDSIFKRNM SE+ TE +  +HE ALD W+ +LP
Sbjct: 565  EDSQLEGRVSDFSLAVIRYAKVLGNILDSIFKRNMMSEAATESMAFVHEKALDIWKNRLP 624

Query: 722  KKYQFKLNANGMVDLEHL-----NHENLI----LVLLFFLVKSMIYMPL---SSAITELA 769
            +KY F+L ANG+ + + L     + ++LI    ++L +FL K MI++P+    SA  E  
Sbjct: 625  EKYGFRLEANGLFNFDELTVVKNSEKDLIEKSSILLFYFLAKCMIHLPVIATRSASLEQQ 684

Query: 770  NNPKVKNDYYMNHKVSHTS-----------LQQSINALLSVFKNINNQYLPLPLNSSRTM 818
              P   +D     K S              +Q++ + +L V    +  YLP P+N SRT 
Sbjct: 685  LQPGTSSDTSETPKESQNKTPTRVCPSYILMQKAASTMLQVMHYTSEYYLPSPINISRTK 744

Query: 819  TRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVN 878
             RFAL++A  ++EY KGG L+ + K LL ++I ++E +RKL+LPGII WHSLKLLD+A+ 
Sbjct: 745  ARFALLTACSAVEYLKGGSLYVETKNLLENLIIKLELERKLDLPGIISWHSLKLLDMALM 804

Query: 879  LFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRK-----QSKEDLFTANK 933
            L L  PT   +KL+K +QKKIN+YN+ MG P +    S K  +K     +S +   T+N 
Sbjct: 805  LLLQSPTTKMEKLDKLVQKKINHYNRQMGIPAMKLSNSRKNNKKIKLENESSQLSSTSNP 864

Query: 934  KRKQQVKTELSTLEVKREPQQVQLLKREGQGNTTESTQSA-------FVEALQLDPILNA 986
              K ++K++    E             +   N  E T +A       F+   +++  + +
Sbjct: 865  IAKGELKSDSVVCE------------EDDNVNDNEVTTTAKLEENNEFINPNKIEQGVTS 912

Query: 987  NI--YNFSGTDLSNFFISNQN-GDVPRESREPAVQQPIPDRTSLPATNTSVVTGFDSLPK 1043
            N   ++FS TDLS  F + ++   VP E+ +   Q  + + +   + +   V       +
Sbjct: 913  NTLAFSFSSTDLSALFNAPESLFKVPNENTQYNQQHEMHNNSISSSHSKEPVN-----KE 967

Query: 1044 PENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYPFSSMNLNALYAPDGYK 1103
             ++ K   +AI          F  T++ + S + +M+ LNN++   S +L       G K
Sbjct: 968  RDSDKQELNAI----------FNETQNRSTSFAKLMLLLNNEHKSLSSSLENDVRNVGNK 1017

Query: 1104 ESSAQPGK---------------QF----TLNTGEPHSTYDFGMIVDASLGLAPLLNEAP 1144
             SS   G+               +F    TL  G      D   I+DASLGLAPLL+E  
Sbjct: 1018 LSSENAGQLPSHGATSGLNSKGNEFLSMNTLYGG------DNDFIIDASLGLAPLLSENN 1071

Query: 1145 EIPGQPE 1151
            EI  Q E
Sbjct: 1072 EIHRQHE 1078

>KLLA0D01452g Chr4 (124018..128355) [4338 bp, 1445 aa] {ON} similar to
            uniprot|Q75DZ4 Ashbya gossypii ABL121C ABL121Cp and
            similar to YMR280C uniprot|P39113 Saccharomyces
            cerevisiae YMR280C CAT8 Zinc cluster transcriptional
            activator
          Length = 1445

 Score =  587 bits (1514), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/741 (43%), Positives = 451/741 (60%), Gaps = 63/741 (8%)

Query: 302  DPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAKIRQ 361
            DP  +SFEQNEAPGL A +A+  +S ++Q TQLA LV++S+PR+TEEILF+PQLLA+I Q
Sbjct: 371  DPYGISFEQNEAPGLPALKALSSLSKYKQGTQLATLVAVSVPRTTEEILFVPQLLARIGQ 430

Query: 362  VFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLSNFF 421
            + GFTSKQC+YT                      I       ++L + NLW ++++ +F+
Sbjct: 431  IHGFTSKQCIYTASVLASLKENN-----------ISSIPPELEVLKNHNLWEIDDVLHFW 479

Query: 422  QNVLKLNILPXXXXXXXXXXXXXALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKA 481
            +NV KL+ +              A  E++EL+ L+F+ W + IP+F++ EFNS Y  FK 
Sbjct: 480  KNVFKLDFMTHTAVDHSSTHLNFA--EVEELMQLFFQDWYELIPLFDKNEFNSYYEKFKL 537

Query: 482  DLMK---LSKNGPSSLEN---ILNIKIFGCLLTVICQMGILIKYKNFKNKSPKFEKLLSY 535
            ++       +   +   N    ++ KIF CLL +I QMG+L K K  K  S K   L+ Y
Sbjct: 538  NVTDPNFFVRKDDTVFNNRTRSISYKIFSCLLIIIVQMGMLSKIKRDKITSGKLSTLMKY 597

Query: 536  YHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLH 595
            Y  LM  +  N YF    TSI+ +Q LS++LFY LN GDI  IY+LRG ++SM+QQLRLH
Sbjct: 598  YDKLMTHIWINPYFNSRNTSIQVLQCLSMLLFYMLNVGDISSIYELRGKVVSMSQQLRLH 657

Query: 596  RCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSE 655
            RCPSAVL G GS + +++QG RR LFW IYYLDVF +LQLGVPRL+KD EIECALP++S+
Sbjct: 658  RCPSAVLGGDGSTVSKVQQGERRILFWSIYYLDVFSALQLGVPRLLKDFEIECALPVTSD 717

Query: 656  IHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENAL 713
                  + G  + LEG +S+FSLSV+R AKV+GNILDS FKR M+ S+T+Q   +HENAL
Sbjct: 718  DDRQVNLAGQMIALEGKVSQFSLSVIRFAKVMGNILDSTFKRGMTTSLTKQAALVHENAL 777

Query: 714  DSWRTKLPKKYQFKLNANGMVDLEHLN-----------------HENLILVLLFFLVKSM 756
            D+WR  L K   F+L+ NG ++++  N                 H +L+L+ L+F+ K M
Sbjct: 778  DNWRHGLQKDLFFQLDVNGTINMDEFNQQKQYSKSLSPRTAAFTHNSLVLMTLYFMAKCM 837

Query: 757  IYMPLSSA---ITELANNP---KVKNDYYMNHKVSHTSLQQSINALLSVFKNINNQYLPL 810
            I++P+ +    + E    P   + +N        S+  LQQ+ N LL+V   +N+ YLPL
Sbjct: 838  IHLPVVATKPLVAEAIQTPTDNQTENGSVDRSLSSYVLLQQATNTLLNVLTALNSIYLPL 897

Query: 811  PLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSL 870
            P+N +RT TRF L SA+GSLEY KGG LF+DNK LLL +++E+E D+KLELPG   WHSL
Sbjct: 898  PINLARTKTRFGLFSARGSLEYTKGGALFQDNKALLLDLVKELETDKKLELPGNTSWHSL 957

Query: 871  KLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMGKPLITSLPSSKTKRKQSKEDLFT 930
            KL DL++NL L     N +K EK +QKKINYYNK+MG+P +        KRK+  +   T
Sbjct: 958  KLFDLSINLILQPVNSNPEKTEKMIQKKINYYNKLMGQPTVA------VKRKRDPK--AT 1009

Query: 931  ANKKRKQQVKTE--------LSTLEVKREPQQVQLLKR-EGQGNTTESTQSAFVEALQLD 981
             N  +K +V+ +        ++T E        +L+K    + N      +   EA Q+D
Sbjct: 1010 ENTSKKVKVEDDHSQDNLHNITTGETTDTVHSEELVKDVPKELNVYPENYTTIEEAFQMD 1069

Query: 982  PILNANIYNFSGTDLSNFFIS 1002
            P+LN N+  FS TDL   F S
Sbjct: 1070 PVLNTNL--FSNTDLKTLFNS 1088

 Score =  103 bits (258), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 53/77 (68%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCR KKI+CD KRPQC+ CA+VGFECK+SDKL+R +FPRGYT           
Sbjct: 178 RVAQACDRCRAKKIRCDGKRPQCTQCAAVGFECKISDKLSRRAFPRGYTETLEERVRELE 237

Query: 231 XXXXXXXAMNDLKEQQL 247
                  A+ DLKE+QL
Sbjct: 238 AENRRLVALCDLKEEQL 254

>ABL121C Chr2 complement(170782..174639) [3858 bp, 1285 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR280C
            (CAT8)
          Length = 1285

 Score =  555 bits (1429), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 388/1052 (36%), Positives = 551/1052 (52%), Gaps = 158/1052 (15%)

Query: 299  NLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAK 358
            NLNDPTS+SFEQ++APGL A +A+  +++HE+S+QLA LV++SIPR+TEEILF+PQLLA+
Sbjct: 277  NLNDPTSISFEQDQAPGLPAVKALSSLASHEESSQLAALVAVSIPRTTEEILFVPQLLAR 336

Query: 359  IRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLS 418
            I Q+ GFTSKQCLYT                        + SS  + L + NLW ++N+ 
Sbjct: 337  IGQMHGFTSKQCLYTASVLASLKEITPR-----------KTSSILEQLKAKNLWEIDNVD 385

Query: 419  NFFQNVLKLNIL-----------------------PXXXXXXXXXXXXXALSEIDELVAL 455
             F    L+++I                                         EI+EL+ L
Sbjct: 386  TFLLEGLQIDIRRGSSGDFNLENPNGYKLENEYHQTKDAHPELQELTPLTFQEIEELIQL 445

Query: 456  YFKYWSDSIPIFNEKEFNSNYRVFKADLMKLS--KNGPSSLEN---ILNIKIFGCLLTVI 510
            +F  W   IPIF+  EF S +  FK ++       +G +  +     ++ KIF CLL  +
Sbjct: 446  FFDDWYSLIPIFDRSEFESYWVKFKDNVSTPGFFTSGDTLFDRRHKSISYKIFACLLLTV 505

Query: 511  CQMGILIKYKNFKN-KSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYH 569
            CQMG++ K K  ++ +  +   L++YY   +  +  N YF   +TSI+++Q+LSL+LFY 
Sbjct: 506  CQMGLMSKVKRERHERGDRLNNLMTYYDRAISHVIMNPYFSSSSTSIQSLQLLSLLLFYF 565

Query: 570  LNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDV 629
            LN GD+  +Y+LRG ++S+ QQLRLHRCPSAVL   GS + +++QG RR LFW +YYLDV
Sbjct: 566  LNVGDVSNVYELRGKVVSLTQQLRLHRCPSAVLGSDGSTVGKIQQGERRVLFWGVYYLDV 625

Query: 630  FCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSLSVVRCAKVLGN 687
            F SLQLGVPRL+KDHEIECALP+SS+  N   + G  + LEG MS FSLS++R +KVLGN
Sbjct: 626  FSSLQLGVPRLMKDHEIECALPVSSDDDNHVNLAGQMIALEGKMSPFSLSIIRFSKVLGN 685

Query: 688  ILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDLEHLNH------ 741
            +LDSIFKR M+ES+T+QV  +HENALD+WR  LP   +F+L+ NG +++E LN       
Sbjct: 686  VLDSIFKRGMTESMTKQVALVHENALDNWRHALPDNLRFQLDVNGTINMEDLNQLKRDYL 745

Query: 742  --------ENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYM------NHKVSHT 787
                     N I + L+FL K MI++P+  A   + + P+   D  +          S+ 
Sbjct: 746  NKDTALKLNNAIFMALYFLAKIMIHLPV-VATKPIIDKPQPVVDTNIPGSQIDRSSSSYV 804

Query: 788  SLQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGGLLFEDNKVLLL 847
             LQQ+ N  L+V  ++++ YLPLPLN +RT TRF LVSA+GSLEY KGG LF+DNK LLL
Sbjct: 805  LLQQATNTFLNVLSSVSSLYLPLPLNITRTKTRFGLVSARGSLEYTKGGALFQDNKNLLL 864

Query: 848  SVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQKKINYYNKIMG 907
             +++++E D+KL +PG I WHSLKLLD+AVNL L  P    +K EK LQKKINYYNK++ 
Sbjct: 865  DLLKDLEADKKLNMPGTISWHSLKLLDMAVNLILQPPNTKPEKQEKLLQKKINYYNKLID 924

Query: 908  KPL--ITSLPS-----------SKTKRKQSKEDLFTANKKR-------------KQQVKT 941
              L    SLP+           +  +    KE   ++ + R             +++VK 
Sbjct: 925  SHLGPTASLPTPGQTAPRKPEPAHARPIPEKEKPPSSKRHRGDDNAAASMPPLLEKKVKL 984

Query: 942  ELSTLEVKREPQQVQLL-----------------------KREGQGNTTESTQSAFVEAL 978
            E     +   P  +  L                       K E +G+   S  +A  EA 
Sbjct: 985  EAPASNMPTPPAPISALHEDVPRVLDGHLGANSSLAVLAAKHEPEGSLHSSAGNAITEAF 1044

Query: 979  QLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQPIPDRTSLPATNTSVVTGF 1038
            QLDPIL      FS TDL +FF  +Q          P   QP P   + P          
Sbjct: 1045 QLDPILQPT--PFSNTDLPSFFGVDQYA-------APPELQPFPAGYAAP---------- 1085

Query: 1039 DSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNNSVSTMMMFLNNDYP-FSSMNLNALY 1097
                   +  P   A GPS   G P  + +K     V +   FL + Y   SS  LN+L+
Sbjct: 1086 -------DKVPQAAAQGPSATAGPP--LSSKDSLFKVPSNGDFLKDYYSGMSSAQLNSLF 1136

Query: 1098 -APDGYKESSAQPGKQFTLNTGEPHSTYDFGMIVDASLGLAPLLNEAPEIPGQPEFFNSD 1156
             APD        P      + G       +G +VDASLGLAPLL  +P  P   +    D
Sbjct: 1137 TAPDRRDVRPRAPQPDRAPSDGL-QQQPGYGFVVDASLGLAPLLAWSPR-PAD-DLLLDD 1193

Query: 1157 EMSP----------SQLTGKLMPMAVNKPMDQNSNFTYNYKSSVENNEGLTLEAIRGGET 1206
            + +           ++L+     M+   P     +      +  + ++G+     R  + 
Sbjct: 1194 KGAKLASARSFTHVNKLSSIPTLMSTQPPPASAPHAKLGQPAPPDQDDGILTIPPR-DQR 1252

Query: 1207 STQRVSNGHIRVNRQRQS--DAVDDLFSWQNS 1236
              +R+ N  +   R   +  D++ DLF WQNS
Sbjct: 1253 GPRRLWNSALNQARPAAALDDSISDLFRWQNS 1284

 Score =  102 bits (254), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 63/106 (59%), Gaps = 7/106 (6%)

Query: 142 SPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGF 201
           SP + P S+T        PL S  P    R +QACDRCR KK +CD KRPQCS CA+VGF
Sbjct: 51  SPAAAPQSTT------GTPLSSLTPTNY-RVAQACDRCRSKKTRCDGKRPQCSQCAAVGF 103

Query: 202 ECKLSDKLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMNDLKEQQL 247
           ECK+SDKL+R +FPRGYT                  A+ DLKE+QL
Sbjct: 104 ECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQL 149

>Ecym_4616 Chr4 complement(1204091..1208824) [4734 bp, 1577 aa] {ON}
            similar to Ashbya gossypii ABL121C
          Length = 1577

 Score =  453 bits (1165), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 317/841 (37%), Positives = 440/841 (52%), Gaps = 150/841 (17%)

Query: 445  ALSEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLM--KLSKNGP---SSLENILN 499
            +  E DE++ L+F  W   IPIF++ EF++ ++ FK ++   +   +G    +     ++
Sbjct: 595  SFQECDEMIHLFFDEWYSLIPIFDKSEFDNYWQKFKENVSTPEFFTSGDTIFAKRHKSIS 654

Query: 500  IKIFGCLLTVICQMGILIKYKNFK-NKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKT 558
             KIF CLL  + QMG++ K K     +  K   L++YY   +  +  N YFG  +TSI++
Sbjct: 655  YKIFACLLVTVVQMGLMTKVKRENLGRRHKLNILMTYYDRALSHIITNPYFGSNSTSIQS 714

Query: 559  VQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRR 618
            +Q+LSL+LFY LN GDI  IY+LRG ++S AQQLRLHRCPSAVL G G  + R++QG RR
Sbjct: 715  LQLLSLLLFYFLNVGDISNIYELRGKVVSFAQQLRLHRCPSAVLGGDGCTVSRIQQGERR 774

Query: 619  TLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDG--VQLEGTMSEFSL 676
             LFW +YYLDVF SLQLGVPRL+KDHEIECALP+SS+      + G  + LEG MS FSL
Sbjct: 775  VLFWGVYYLDVFASLQLGVPRLLKDHEIECALPVSSDSDRQVNLAGQMISLEGKMSPFSL 834

Query: 677  SVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDL 736
            SV+R +KVLGN+LDSIFKR M+ SIT++V  +HENALD+WR  LP   +F+L+ NG +++
Sbjct: 835  SVIRFSKVLGNVLDSIFKRGMTISITKEVALVHENALDNWRHGLPDGLRFQLDVNGTINM 894

Query: 737  EHLNH---------------ENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYMN 781
            +  N                EN I + L+FL KSMI++P+ +    +  + + KND  ++
Sbjct: 895  DEFNQLKHEYLNNDNSKFNKENFIFMTLYFLAKSMIHIPVVAGKPPVDTSVQEKNDPAIS 954

Query: 782  HKVSHTS-----LQQSINALLSVFKNINNQYLPLPLNSSRTMTRFALVSAKGSLEYKKGG 836
             +   +S     LQQ+ N  L+V  ++   YLPLP+N SR  TRF L SA+GSLEY KGG
Sbjct: 955  RQADRSSSSYILLQQATNTFLNVLTSMRTAYLPLPINISRAKTRFGLFSARGSLEYTKGG 1014

Query: 837  LLFEDNKVLLLSVIQEIEKDRKLELPGIIPWHSLKLLDLAVNLFLLGPTINSDKLEKFLQ 896
             LF+DNK LLL++I+E+E DRKL +PG I WHSLKL D+A+NL L  P    +K EK LQ
Sbjct: 1015 ALFQDNKSLLLNLIKELEVDRKLGIPGTISWHSLKLFDMAINLILQPPNTKPEKEEKLLQ 1074

Query: 897  KKINYYNKI------MGKPLITSLP--------------------------SSKTKRKQS 924
            KKI+YYNK+      M   +ITS                             +  KRK  
Sbjct: 1075 KKISYYNKLIDHSVGMHASVITSAAIQHQRQQQQQQQQQQQQQQLHYKENKGNGAKRKPE 1134

Query: 925  KEDLFTANKKRKQQVKTELSTLEVKREPQQVQLLKRE--------------------GQG 964
                 T N    ++VK E  ++++      +  L  +                    GQ 
Sbjct: 1135 IGSSTTTNMSLNKRVKMEEPSVKIPTSNGPLSALHEDDSEMLGKSLRSNTIVSDVPTGQK 1194

Query: 965  NTTE-----STQSAFVEALQLDPILNANIYNFSGTDLSNFFISNQNGDVPRESREPAVQQ 1019
              +E     S  +A  EA QLDP+L+A    FS TDL++F     NG+V   +   A   
Sbjct: 1195 MESEIPVSMSATNAIAEAFQLDPVLHAT--PFSSTDLTSFL----NGEVVTNASMFADTM 1248

Query: 1020 PIPDRTSLPATNTSVVTGFDSLPKPENSKPAKDAIGPSLKKGYPSFIGTKSHNN--SVST 1077
                 T+      + V+G + LP   NS     +IG  +  G PS     S +    V +
Sbjct: 1249 ----HTTGIGGGLTDVSGHNGLPS-NNSLLNMSSIGFGIGSG-PSLANLSSKDGLFKVPS 1302

Query: 1078 MMMFLNNDYP-FSSMNL----------NALYAPDGYK--ESSAQPGKQFTLNTG-EP--- 1120
               FL + Y   SS  L          NAL  P  ++  + S   G+Q  L    EP   
Sbjct: 1303 NGDFLKDYYSGMSSAQLASLFVNGNTENALQKPTDHRRYQPSQSQGQQLHLQPHPEPQRQ 1362

Query: 1121 ----------HSTY-----------------------DFGMIVDASLGLAPLLNEAPEIP 1147
                      H  Y                        +G +VDASLGLA LL  +P+ P
Sbjct: 1363 RQQQQQQHPDHQRYPLEDEPGICEQSKIRTEKKNQQQGYGFVVDASLGLASLLGWSPK-P 1421

Query: 1148 G 1148
            G
Sbjct: 1422 G 1422

 Score =  129 bits (324), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 11/131 (8%)

Query: 299 NLNDPTSVSFEQNEAPGLMAARAIDQISNHEQSTQLAILVSLSIPRSTEEILFIPQLLAK 358
           NLNDPTS+SFEQ++APGL A +A+  ++NHEQS+QLA LV++SIPR+TEEILF+PQLLA+
Sbjct: 383 NLNDPTSISFEQDQAPGLSAVKALSTMANHEQSSQLATLVAMSIPRTTEEILFVPQLLAR 442

Query: 359 IRQVFGFTSKQCLYTVXXXXXXXXXXXXXXXXXXXXMILQNSSNFDILTSVNLWHLENLS 418
           I QV GFTSKQCLYT                     +  Q S   ++L S +LW ++++ 
Sbjct: 443 IGQVHGFTSKQCLYTA-----------SVLASLKEIVPYQTSPELELLRSKSLWEIDDVD 491

Query: 419 NFFQNVLKLNI 429
           +F    L+ + 
Sbjct: 492 SFLSKGLRFSF 502

 Score =  105 bits (263), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 68/111 (61%), Gaps = 5/111 (4%)

Query: 137 LKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSC 196
           ++  LSP    +S+T     G+ PL S  P  + R +QACDRCR KK +CD KRPQCS C
Sbjct: 95  VRGALSPTMVQASATP----GSTPLSSMTP-MSYRVAQACDRCRSKKTRCDGKRPQCSQC 149

Query: 197 ASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMNDLKEQQL 247
           A+VGFECK+SDKL+R +FPRGYT                  A+ DLKE+QL
Sbjct: 150 AAVGFECKISDKLSRRAFPRGYTETLEERVRELEAENRRLVALCDLKEEQL 200

>SAKL0D05654g Chr4 (457485..460244) [2760 bp, 919 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 919

 Score = 91.7 bits (226), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 42/68 (61%), Positives = 47/68 (69%), Gaps = 3/68 (4%)

Query: 152 TANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           T       PLL SR +   R+SQACDRCRLKKIKCD  +P C+SC  VGF C+ SDKLTR
Sbjct: 8   TPTSPKGHPLLLSRQE---RSSQACDRCRLKKIKCDGLKPNCTSCKKVGFHCQTSDKLTR 64

Query: 212 NSFPRGYT 219
             FPRGYT
Sbjct: 65  RGFPRGYT 72

>AFR096W Chr6 (606993..609551) [2559 bp, 852 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL089W (SIP4)
          Length = 852

 Score = 91.3 bits (225), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 41/49 (83%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R+SQACDRCRLKKIKCD  RP C+SC  +G++CK SDKLTR  FPRGYT
Sbjct: 24  RSSQACDRCRLKKIKCDGLRPSCTSCKKIGYQCKTSDKLTRRGFPRGYT 72

>Ecym_6340 Chr6 complement(652943..655801) [2859 bp, 952 aa] {ON}
           similar to Ashbya gossypii AFR096W
          Length = 952

 Score = 89.7 bits (221), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 41/49 (83%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R+SQACDRCRLKKIKCD  RP C+SC  +G++C+ SDKLTR  FPRGYT
Sbjct: 25  RSSQACDRCRLKKIKCDGVRPSCTSCKKIGYQCRTSDKLTRRGFPRGYT 73

>Kpol_1016.20 s1016 (51828..55088) [3261 bp, 1086 aa] {ON}
           (51828..55088) [3261 nt, 1087 aa]
          Length = 1086

 Score = 87.4 bits (215), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 38/51 (74%)

Query: 169 AGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           + R SQACDRCRLKKIKCD  +P CS C  V F CK SDKLTR  FPRGYT
Sbjct: 91  SNRLSQACDRCRLKKIKCDGLKPNCSQCLKVNFICKTSDKLTRRGFPRGYT 141

>KLLA0F14322g Chr6 (1328925..1331078) [2154 bp, 717 aa] {ON}
           uniprot|Q7Z8R2 Kluyveromyces lactis Sip4 protein
          Length = 717

 Score = 85.9 bits (211), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 41/59 (69%)

Query: 161 LLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           L+ +      R SQACDRCRLKKIKCD  +P CS+C  +G+ C  SDKLTR  FPRGYT
Sbjct: 48  LMPTASTKVKRFSQACDRCRLKKIKCDGIKPSCSNCKKIGYHCSTSDKLTRRGFPRGYT 106

>ZYRO0G15136g Chr7 complement(1218989..1222072) [3084 bp, 1027 aa]
           {ON} weakly similar to uniprot|P46954 Saccharomyces
           cerevisiae YJL089W SIP4 Possibly involved in Snf1p
           regulated transcriptional activation shows homology to
           DNA binding domain of Gal4p has a leucine zipper motif
           and acidic region lexA-Sip4p activates transcription
          Length = 1027

 Score = 85.1 bits (209), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (75%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R SQACDRCRLKKIKCD  +P CS C  V F C+ SD+LTR  FPRGYT
Sbjct: 33  RQSQACDRCRLKKIKCDGMKPTCSQCTKVNFTCRTSDRLTRRGFPRGYT 81

>KLTH0D03564g Chr4 (343546..346134) [2589 bp, 862 aa] {ON} weakly
           similar to uniprot|P46954 Saccharomyces cerevisiae
           YJL089W SIP4 Possibly involved in Snf1p regulated
           transcriptional activation shows homology to DNA binding
           domain of Gal4p has a leucine zipper motif and acidic
           region lexA-Sip4p activates transcription
          Length = 862

 Score = 83.6 bits (205), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
            R SQACDRCRLKKIKCD  +P C+ C  +GF C+ SDKL+R  FPRGYT
Sbjct: 23  ARMSQACDRCRLKKIKCDGIKPTCTPCTKIGFHCQTSDKLSRRGFPRGYT 72

>Suva_6.161 Chr6
           complement(283370..284500,284547..284764,284948..285781,
           285812..286127) [2499 bp, 832 aa] {ON} YJL089W (REAL)
          Length = 832

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 45/73 (61%), Gaps = 9/73 (12%)

Query: 147 PSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLS 206
           P+  +TAN           PD + R + ACDRCRLKKIKCD  +P CS+C  + F CK S
Sbjct: 26  PTGPSTANA---------VPDFSVRKAHACDRCRLKKIKCDGLKPNCSNCGKIDFPCKTS 76

Query: 207 DKLTRNSFPRGYT 219
           DKL+R   P+GYT
Sbjct: 77  DKLSRRGLPKGYT 89

>TPHA0I02820 Chr9 complement(620925..624059) [3135 bp, 1044 aa] {ON}
           Anc_1.277 YJL089W
          Length = 1044

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (73%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           D   R SQACDRCRLKKIKCD  +P C+ C+ + F CK SD+LTR  FP+GYT
Sbjct: 75  DINIRLSQACDRCRLKKIKCDGLKPSCTHCSKIKFACKTSDRLTRRGFPKGYT 127

>Kwal_26.7397 s26 complement(342483..343085) [603 bp, 201 aa] {OFF}
           YJL089W (SIP4) - shows homology to DNA binding domain of
           Gal4p, has a leucine zipper motif and acidic region;
           lexA-Sip4p activates transcription [contig 304] PARTIAL
          Length = 201

 Score = 77.4 bits (189), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 37/49 (75%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R SQACDRCRLKKIKCD  +P C  C+ + F C+ SDKL+R  FPRGYT
Sbjct: 24  RMSQACDRCRLKKIKCDGVKPTCGPCSKIKFHCQTSDKLSRRGFPRGYT 72

>YJL089W Chr10 (265926..268415) [2490 bp, 829 aa] {ON}  SIP4C6 zinc
           cluster transcriptional activator that binds to the
           carbon source-responsive element (CSRE) of gluconeogenic
           genes; involved in the positive regulation of
           gluconeogenesis; regulated by Snf1p protein kinase;
           localized to the nucleus
          Length = 829

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (73%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           D + R + ACDRCRLKKIKCD  +P CS+CA + F CK SDKL+R   P+GYT
Sbjct: 37  DFSVRKAHACDRCRLKKIKCDGLKPNCSNCAKIDFPCKTSDKLSRRGLPKGYT 89

 Score = 33.5 bits (75), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/103 (23%), Positives = 45/103 (43%), Gaps = 19/103 (18%)

Query: 556 IKTVQILSLILFY-----------------HLNTGDIIQIYDLRGMIISMAQQLRLHRCP 598
           +K +Q+++L +FY                 H N   +I   DL  +  +    + L+  P
Sbjct: 284 LKVLQLVNLSIFYFMGASVDSCKSKSSLTEHSNVNSVIWTNDLLNLNFTNILNMGLYINP 343

Query: 599 SAVLTGSGSKMDRL--EQGNRRTLFWCIYYLDVFCSLQLGVPR 639
             ++  SG+  +    E+ +R   FWC  +L  + SL  G+P+
Sbjct: 344 KNLIPISGNNNNNKSNEEDDRIVTFWCFQFLSSWWSLIQGLPK 386

>KAFR0A01480 Chr1 (294040..296217) [2178 bp, 725 aa] {ON} Anc_1.277
           YJL089W
          Length = 725

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 38/49 (77%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R SQACDRCRLKKIKCD ++P+CS+C  + F C +S KL+R   P+GYT
Sbjct: 11  RVSQACDRCRLKKIKCDGQKPRCSNCKKINFNCAISTKLSRRGLPKGYT 59

>Skud_10.125 Chr10 (233921..236422) [2502 bp, 833 aa] {ON} YJL089W
           (REAL)
          Length = 833

 Score = 80.1 bits (196), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (73%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           D + R + ACDRCRLKKIKCD  +P CS+C+ + F CK SDKL+R   P+GYT
Sbjct: 37  DFSVRKAHACDRCRLKKIKCDGLKPNCSNCSKIDFPCKTSDKLSRRGLPKGYT 89

>Smik_10.153 Chr10 (257677..260166) [2490 bp, 829 aa] {ON} YJL089W
           (REAL)
          Length = 829

 Score = 79.0 bits (193), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 38/53 (71%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           D + R + ACDRCRLKKI+CD  +P CS+C  + F CK SDKL+R   P+GYT
Sbjct: 37  DFSVRKAHACDRCRLKKIRCDGLKPNCSNCTKINFPCKTSDKLSRRGLPKGYT 89

 Score = 33.9 bits (76), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 45/106 (42%), Gaps = 19/106 (17%)

Query: 553 TTSIKTVQILSLILFYHL-----------------NTGDIIQIYDLRGMIISMAQQLRLH 595
           T S+K +Q+++L  FY +                 N   +I   DL  +  +    + L+
Sbjct: 283 TLSLKVLQLINLSTFYFMGGSVDSCKSKSSLTGSSNVDSVIWTNDLLNLNFANILNMGLY 342

Query: 596 RCPSAV--LTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPR 639
                +  L+GS       E+ +R   FWC  +L+ + SL  G+P+
Sbjct: 343 INSKNLIPLSGSNENCKPNEEDDRLVTFWCFQFLNSWWSLIQGLPK 388

>TDEL0D01450 Chr4 (284869..287706) [2838 bp, 945 aa] {ON} Anc_1.277
           YJL089W
          Length = 945

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 35/49 (71%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R S ACDRCRLKK++CD  +P CS C+   F C  SDKLTR  FP+GYT
Sbjct: 54  RHSHACDRCRLKKVRCDGLKPSCSQCSRANFRCTTSDKLTRRGFPKGYT 102

>KNAG0B01840 Chr2 (345204..348422) [3219 bp, 1072 aa] {ON} Anc_1.277
           YJL089W
          Length = 1072

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 41/101 (40%), Positives = 55/101 (54%), Gaps = 9/101 (8%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYTXXXXXXXXXXX 230
           R +QACDRCRLKKIKCD  +P C++CA + F CK S KL+R   P+GYT           
Sbjct: 23  RKNQACDRCRLKKIKCDGLKPTCTNCAKINFLCKTSHKLSRRGLPKGYTEALEQEVVRL- 81

Query: 231 XXXXXXXAMNDLKEQQLFKIPEDIQSVVDVDAELNSSNQTK 271
                    N L++Q +     D++S V  + EL SS Q +
Sbjct: 82  --------QNVLRDQNIEFNKMDVRSTVGDEKELISSTQEQ 114

>NDAI0G05530 Chr7 (1360413..1363973) [3561 bp, 1186 aa] {ON} 
          Length = 1186

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 34/49 (69%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R  QACDRCRLKKIKCD  +P CS C    F+CK +DKL R  F RGYT
Sbjct: 117 RKIQACDRCRLKKIKCDDLKPSCSQCLKADFQCKTTDKLARRGFSRGYT 165

>TBLA0D05420 Chr4 complement(1334955..1337228) [2274 bp, 757 aa]
           {ON} Anc_1.277 YJL089W
          Length = 757

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 28/49 (57%), Positives = 35/49 (71%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R SQACDRCRLKKIKCD   P C++C  + F C+ + KL+R   P+GYT
Sbjct: 96  RHSQACDRCRLKKIKCDGLIPHCTNCRKINFNCQTTHKLSRRGLPKGYT 144

>CAGL0L03377g Chr12 complement(384929..388558) [3630 bp, 1209 aa]
           {ON} some similarities with uniprot|P46954 Saccharomyces
           cerevisiae YJL089w SIP4 interacts with SNF1 protein
           kinase
          Length = 1209

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 37/49 (75%), Gaps = 1/49 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R SQACDRCR KKIKCD  +P CS+CA +G+ C  SDKL+R   P+GYT
Sbjct: 24  RHSQACDRCRSKKIKCDGLQP-CSNCAKIGYNCVTSDKLSRRGLPKGYT 71

>NCAS0A09410 Chr1 complement(1865924..1868722) [2799 bp, 932 aa]
           {ON} Anc_1.277
          Length = 932

 Score = 68.9 bits (167), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           +  QACDRCRLKKIKCD + P C+ C   G  C+ +++L R  F +GYT
Sbjct: 40  KRKQACDRCRLKKIKCDDRTPDCTPCMKAGIPCRTTERLKRRGFAKGYT 88

>KNAG0E01760 Chr5 (350254..352962) [2709 bp, 902 aa] {ON} Anc_2.231
           YIL130W
          Length = 902

 Score = 58.5 bits (140), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 93/217 (42%), Gaps = 23/217 (10%)

Query: 553 TTSIKTVQILSLILFYHLN-TGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDR 611
           + SI+TV    L+LF  L  +  +   Y   G+ +  A +   HR       G  S +  
Sbjct: 375 SNSIQTV----LMLFIFLQCSARLSTCYAYIGVAMRSALREGFHR-----KVGPESDLSP 425

Query: 612 LEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGV--QLEG 669
           LE   R+ LF+ IY LDV+ +  LG+PR I   + +  LPL     N  +      + +G
Sbjct: 426 LEIEIRKRLFYTIYKLDVYVNAMLGLPRSISPEDFDQVLPLELSDENITEQAYYPEREDG 485

Query: 670 TMSEFSLSVVRCAKVLGNILDSIFK-----RNMSESITEQVYTIHENALDSWRTKLPKKY 724
           ++S  S  +  C   L  ILD+I +     +  +  I+ +  T  E  L  W   LP   
Sbjct: 486 SLS--STGIANCHTRLIMILDTIMRKLYPIKRPNNVISHETVTNLEKLLRDWTNTLPA-- 541

Query: 725 QFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
             +L  NG          N +L L F  V+ ++Y P 
Sbjct: 542 --ELKPNGKSMPPRYERANKLLHLSFLHVQIILYRPF 576

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD ++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

>KNAG0D00690 Chr4 (105640..108267) [2628 bp, 875 aa] {ON} Anc_6.279
           YPL248C
          Length = 875

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/55 (41%), Positives = 29/55 (52%)

Query: 164 SRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           SR  A     QACD CR+KK+KC   +P C  CA  G+ C  S K  R+   R +
Sbjct: 9   SRHHANSSTDQACDLCRIKKLKCSKDKPACRKCAKNGWNCTYSPKAKRSPLTRAH 63

>SAKL0G11902g Chr7 (1016915..1019635) [2721 bp, 906 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 906

 Score = 56.6 bits (135), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 29/71 (40%), Positives = 36/71 (50%), Gaps = 4/71 (5%)

Query: 152 TANGDGAEPLLSSRPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSD 207
           ++N D +      RP ++     R+  AC RCRLKK+KCD K P CS CAS    C   D
Sbjct: 15  SSNIDTSYSKQKKRPSSSILGISRSIAACKRCRLKKVKCDQKFPSCSKCASANEPCVSLD 74

Query: 208 KLTRNSFPRGY 218
             T    PR Y
Sbjct: 75  PATGRDVPRSY 85

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 126/306 (41%), Gaps = 48/306 (15%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           LI  Y +   ++  ++ + G  + +A  L LH              D   +  RR LFWC
Sbjct: 415 LIAIYSIMRPNVPGVWYIMGSALRLAVDLGLH------AEKLNKNYDPFTRELRRRLFWC 468

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNT--DKMDGV-QLEGTMSEF---S 675
            Y LD    +  G P  I D  I    P  L   +  T  D +D   Q++ +M+ +   S
Sbjct: 469 TYALDRQICVHFGRPFGIPDENITAKFPSTLDDALITTAADSIDDYSQVKSSMASYKVIS 528

Query: 676 LSVVRCAKVLGNILDSIFKRN--MSESIT--EQVYTIHENALDSWRTKLPKKYQFKLNAN 731
           L++ +  K+  +I   ++  N  +    T  E+   + +  LD+W  K+  K   K+N  
Sbjct: 529 LAIFKIRKIQTSIAQVLYAPNGRLPSHFTDLEKWRAVMDYELDNWYNKVTPKTHRKMNCE 588

Query: 732 GMVDLEHLN--HENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYMNHKVSHTSL 789
             V+L  LN  H  ++L  L          P S ++T               ++V H S 
Sbjct: 589 FKVELFQLNYCHSKIMLYGL---------SPKSLSLTSYG------------YEVVHDSS 627

Query: 790 QQSINALLSVFK--NINNQYLPLPLNSSRTMTRFALV--SAKGSLEYKKGGLLFEDNKVL 845
             +INA   + K  NIN  ++ +       M+    +  S+KGS+E       F+++   
Sbjct: 628 TNAINAYYKLCKEGNINYTWVAVHNLFMAGMSYLYTIYNSSKGSMETSDK---FKEHSSK 684

Query: 846 LLSVIQ 851
           LL V++
Sbjct: 685 LLHVLK 690

>NDAI0F01220 Chr6 complement(295418..298300) [2883 bp, 960 aa] {ON}
           Anc_6.279
          Length = 960

 Score = 55.5 bits (132), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 31/48 (64%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           ++ QACD CR+KK+KC  ++P+C+ C   G+EC  S K  R+   R +
Sbjct: 7   KSEQACDICRIKKLKCSREKPKCAKCMKNGWECCYSPKAKRSPLTRAH 54

>Smik_12.77 Chr12 complement(159125..161836) [2712 bp, 903 aa] {ON}
           YLR014C (REAL)
          Length = 903

 Score = 53.9 bits (128), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 27/51 (52%)

Query: 168 AAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           A  ++  AC RCRLKKIKCD + P C  CA +   C   D  T    PR Y
Sbjct: 25  AISKSRTACKRCRLKKIKCDQEFPSCKRCAKLQVPCVSLDPATGKDVPRSY 75

>NDAI0I02350 Chr9 (536448..539117) [2670 bp, 889 aa] {ON} Anc_5.235
          Length = 889

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 25/48 (52%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           +   AC RCRLKKIKCD   P CS CA +   C   D  T    PR Y
Sbjct: 17  KPKTACKRCRLKKIKCDNNVPSCSRCAKLRVPCVAVDSATGEDVPRSY 64

>Smik_6.452 Chr6 (741922..744558) [2637 bp, 878 aa] {ON} YPL248C
           (REAL)
          Length = 878

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           QACD CRLKK+KC  ++P+C+ C    +EC+ S K  R+   R +
Sbjct: 9   QACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>YPL248C Chr16 complement(79711..82356) [2646 bp, 881 aa] {ON}
           GAL4DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose;
           repressed by Gal80p and activated by Gal3p
          Length = 881

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 29/45 (64%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           QACD CRLKK+KC  ++P+C+ C    +EC+ S K  R+   R +
Sbjct: 9   QACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAH 53

>TPHA0F01380 Chr6 complement(318207..320879) [2673 bp, 890 aa] {ON}
           Anc_2.231 YIL130W
          Length = 890

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 57/229 (24%), Positives = 103/229 (44%), Gaps = 30/229 (13%)

Query: 558 TVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNR 617
           ++Q + ++LF+   +  +   Y   G  +  A +   HR     +  + + ++ +E   R
Sbjct: 418 SIQTIIILLFFCQCSARLTTCYSYIGAALRAALKEGYHR----RVDPNNTTLNPIEIEMR 473

Query: 618 RTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSE---- 673
           + +F+ IY LDV+ +  +G+PR + + + +  LP+  EI +    + +   G +SE    
Sbjct: 474 KRIFYTIYKLDVYVNSMMGLPRSLSEDDFDQELPI--EISD----ECITENGYLSEQEGQ 527

Query: 674 --FSLSVVRCAKVLGNILDSIFKRNMS-----ESITEQVYTIHENALDSWRTKLPKKYQF 726
              S+S+      L  IL  I +R  S      SITE      EN L  W   LP + + 
Sbjct: 528 QLSSISIANYHTKLYLILADIVQRLYSIKKKNRSITENTVISLENKLRKWADSLPHELK- 586

Query: 727 KLNANGMVDL-EHLNHENLILVLLFFLVKSMIYMPLSSAITELANNPKV 774
                G VD+ +     N +L L +  V+ ++Y P    I  L+ N +V
Sbjct: 587 ----PGAVDVPQKYERANKLLHLSYLQVQLILYRPF---IHYLSRNLRV 628

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           R ++ACD CR KK+KCD + P C  C    ++C     + +N+
Sbjct: 67  RVTRACDECRKKKVKCDGQNP-CIHCTVYSYKCSYDQPVKKNN 108

>KLLA0C10923g Chr3 complement(939148..941475) [2328 bp, 775 aa] {ON}
           weakly similar to uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 775

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 26/49 (53%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R+  AC RCR++KIKCD K P C+ C      C   D  TR   PR Y 
Sbjct: 15  RSVAACKRCRIRKIKCDNKFPSCTKCIQAQEPCITIDPSTRREIPRSYV 63

 Score = 40.4 bits (93), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 45/218 (20%), Positives = 82/218 (37%), Gaps = 32/218 (14%)

Query: 545 KNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTG 604
           ++S +   T  ++ +Q L LI  Y L    +  ++   G  I +   L LH         
Sbjct: 353 QDSLYTSKTNRLEALQGLLLIAVYSLMRPTVPGLWYTLGSAIRLCVDLGLH--------- 403

Query: 605 SGSKMDR----LEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLS------- 653
              K+++      +  RR LFWC Y +D       G P  I D  +    P S       
Sbjct: 404 -AEKLNKNYEPFIRDVRRRLFWCCYSMDRQVCAYFGRPVSIPDVNVTTMFPSSLDDALIT 462

Query: 654 ---SEIHNTDKMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHE 710
                + +      V  + T     LS+ +  K+   I+  ++  N   +I ++   + +
Sbjct: 463 TAEDNVRDYSSPSLVNSDPTYKSVCLSMFQIRKIQSEIVQRMYAPNA--TIPDEFLDLED 520

Query: 711 ------NALDSWRTKLPKKYQFKLNANGMVDLEHLNHE 742
                 N LD W  ++  K   ++N +  +D   LN+ 
Sbjct: 521 WRIAILNQLDVWFQRVIPKTSIQMNCSFPIDFFALNYH 558

>YLR014C Chr12 complement(172268..174982) [2715 bp, 904 aa] {ON}
           PPR1Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain, positively
           regulates transcription of URA1, URA3, URA4, and URA10,
           which are involved in de novo pyrimidine biosynthesis,
           in response to pyrimidine starvation; activity may be
           modulated by interaction with Tup1p
          Length = 904

 Score = 52.8 bits (125), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 31/61 (50%), Gaps = 4/61 (6%)

Query: 162 LSSRPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRG 217
           LS R D+      ++  AC RCRLKKIKCD + P C  CA +   C   D  T    PR 
Sbjct: 16  LSKRGDSPNIGISKSRTACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKDVPRS 75

Query: 218 Y 218
           Y
Sbjct: 76  Y 76

>Kwal_23.2905 s23 (69235..71880) [2646 bp, 881 aa] {ON} YLR014C
           (PPR1) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 246]
           FULL
          Length = 881

 Score = 52.8 bits (125), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 30/59 (50%), Gaps = 4/59 (6%)

Query: 165 RPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           RP +A     R+  AC RCR++K+KCD K P CS C S    C   D  T    PR Y 
Sbjct: 34  RPTSAIMGISRSIAACKRCRIRKVKCDQKFPSCSRCVSANEPCVSIDPATGRDVPRSYV 92

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 73/180 (40%), Gaps = 22/180 (12%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           LI  Y +   ++  ++   G  + +A  L LH              D   +  RR LFWC
Sbjct: 407 LIAKYSIMRPNVPGVWYTMGSALRLAVDLGLH------AEKLNKNYDPFTRDFRRRLFWC 460

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALPLS-SEIHNTDKMDGVQ----LEGTMSEF---S 675
            + LD       G P  I D  I    P S  +   T   D ++    ++ +M+ +   S
Sbjct: 461 TFSLDRQICAFFGRPFGIPDENISTEFPSSLDDALITTSADNIEDYSLVKSSMASYKCIS 520

Query: 676 LSVVRCAKVLGNILDSIFKRNMS-----ESITEQVYTIHENALDSW-RTKLPKKYQFKLN 729
           L+  +  K+   I+  ++    S     E + E    ++E  LD W   K+PK ++ K+N
Sbjct: 521 LAFFKIRKIQAQIVQELYAHRASLPNGYEDVDEWREIMNEE-LDEWYERKVPKTHR-KMN 578

>TDEL0E03910 Chr5 (732533..735121) [2589 bp, 862 aa] {ON} Anc_5.235
           YLR014C
          Length = 862

 Score = 52.4 bits (124), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 165 RPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           RP +A     ++  AC RCRLKKIKCD + P C  CA V   C   D  T    PR Y
Sbjct: 15  RPSSAVAGITKSISACKRCRLKKIKCDQEFPSCLKCARVKVPCVSLDPATGRDVPRSY 72

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 72/166 (43%), Gaps = 22/166 (13%)

Query: 617 RRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEI---HNTDKMDGVQLEGTM 671
           RR LFWC+Y LD       G P  I +  I    P  L   +    N D  D  +++ +M
Sbjct: 454 RRRLFWCVYSLDRQICAYFGRPFGIPEESISARYPSLLDDALITTFNDDIEDYSKVQTSM 513

Query: 672 SE---FSLSVVRCAKVLGNILDSIFKRNMS--------ESITEQVYTIHENALDSWRTK- 719
           +     +L+  +  ++  N+L  ++  +          E+    V+++    L+ W  K 
Sbjct: 514 ATSKVIALAFFKVRRIQANVLQVLYAEHGDIPRRCPDLETWRSSVHSL----LEKWLEKD 569

Query: 720 LPKKYQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAI 765
           +PK Y+ K+N    ++  HLN+     +L     K++   P + AI
Sbjct: 570 VPKTYR-KMNCKFNMEFFHLNYYQTKCMLYGLSPKNLSLSPKAFAI 614

>Skud_12.82 Chr12 complement(164119..166818) [2700 bp, 899 aa] {ON}
           YLR014C (REAL)
          Length = 899

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 160 PLLSSRPDAA-GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           P +   P+    ++  AC RCRLKKIKCD + P C  CA++   C   D  T    PR Y
Sbjct: 17  PRIDGSPNIGFSKSRTACKRCRLKKIKCDQEFPSCKRCANLEVPCVSLDPATGKDVPRSY 76

>Kpol_1018.30 s1018 complement(81534..83840,83842..84180) [2646 bp,
           881 aa] {ON} complement(81534..83840,83842..84180) [2646
           nt, 882 aa]
          Length = 881

 Score = 52.4 bits (124), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 28/47 (59%)

Query: 172 ASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
            +Q CD CRLKK+KC  ++P+C  C    +EC  S K+ R+   R +
Sbjct: 6   TNQVCDSCRLKKLKCSKEKPKCFKCLKHNWECNYSPKIKRSPLTRAH 52

>NCAS0D04190 Chr4 (793242..795914) [2673 bp, 890 aa] {ON} Anc_6.279
          Length = 890

 Score = 52.4 bits (124), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 27/43 (62%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           QACD CRLKK+KC  + P+CS C   G +C  S K+ R+   R
Sbjct: 18  QACDNCRLKKLKCSKETPKCSKCLKNGMKCLYSPKVKRSPLTR 60

>KAFR0J00690 Chr10 (124449..127043) [2595 bp, 864 aa] {ON} Anc_5.235
           YLR014C
          Length = 864

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 25/49 (51%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           ++  AC RCR KKIKCD + P C  CA V   C   D  T    PR Y 
Sbjct: 29  KSRSACKRCRAKKIKCDQEFPSCGKCAKVNEPCVSIDPATGEDIPRSYV 77

>NCAS0D02540 Chr4 complement(484060..486732) [2673 bp, 890 aa] {ON}
           Anc_5.235
          Length = 890

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 25/48 (52%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           ++  AC RCR KKIKCD K P C  CA +   C   D  T    PR Y
Sbjct: 36  KSKSACKRCRSKKIKCDQKFPSCDRCAHLKVPCVSVDPATGQDVPRSY 83

>KLTH0G07898g Chr7 (636890..639490) [2601 bp, 866 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 866

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 30/58 (51%), Gaps = 4/58 (6%)

Query: 165 RPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           RP +A     R+  AC RCR++K+KCD K P CS C +    C   D  T    PR Y
Sbjct: 23  RPTSAIMGISRSIAACKRCRVRKVKCDQKFPSCSRCVTANEPCVSVDPATGRDVPRSY 80

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 81/201 (40%), Gaps = 22/201 (10%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           LI  Y +   ++  ++   G  + +A  L LH              D   +  RR LFWC
Sbjct: 396 LIAKYSIMRPNVPGVWYTMGSALRLAVDLGLH------AEKLNKNYDPFTRDLRRRLFWC 449

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALPLSSE---IHNT-DKMDGVQL-EGTMSEF---S 675
            Y LD       G P  I D  I    P S +   I NT D ++   L + +M+ +   S
Sbjct: 450 TYSLDRQICAFFGRPFGIPDDNISTEFPSSLDDALITNTADNIEDYSLVKSSMASYKCIS 509

Query: 676 LSVVRCAKVLGNILDSIFKRNMS-----ESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
           L+  R  K+   I+  ++    S     ES+ E    ++E  LD W  K   K   K+N 
Sbjct: 510 LAFFRIRKIQAQIVQELYAHRTSLPDGFESLDEWRELMNEE-LDEWYEKRVPKTHRKMNC 568

Query: 731 NGMVDLEHLN--HENLILVLL 749
           +   +L  L   H  ++L  L
Sbjct: 569 HFPTELFQLELCHSKVMLYGL 589

>Kpol_495.21 s495 (71447..74704) [3258 bp, 1085 aa] {ON}
           (71447..74704) [3258 nt, 1086 aa]
          Length = 1085

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 14/86 (16%)

Query: 122 VTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRL 181
           V  ++PN     +K +KD    +          G   +  +S+      R ++ACDRCR 
Sbjct: 79  VNTMIPNNNDLMMKNIKDNQHVV----------GSAIKSNVSTTKVQKRRVARACDRCRK 128

Query: 182 KKIKCD----LKRPQCSSCASVGFEC 203
           +KIKCD    LK  +CS+C   G EC
Sbjct: 129 RKIKCDEIKNLKVNKCSNCVKYGAEC 154

>NCAS0G01100 Chr7 complement(193052..195859) [2808 bp, 935 aa] {ON}
           Anc_6.279
          Length = 935

 Score = 51.6 bits (122), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 172 ASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           + QACD CR+KK+KC  ++P+C+ C    +EC  S K  R+   R +
Sbjct: 9   SDQACDLCRVKKLKCSKEKPKCAKCLKNNWECCYSPKTRRSPLTRAH 55

>Suva_16.59 Chr16 complement(88631..91318) [2688 bp, 895 aa] {ON}
           YPL248C (REAL)
          Length = 895

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 27/43 (62%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           QACD CRLKK+KC  ++P+CS C    +EC  S K  R+   R
Sbjct: 9   QACDICRLKKLKCSKEKPKCSKCLKNNWECCYSPKTKRSPLTR 51

>Smik_11.210 Chr11 (352056..355565) [3510 bp, 1169 aa] {ON} YKL038W
           (REAL)
          Length = 1169

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 141 LSPISRPSSSTTANGDGAEPLLSSRPDAAG--------RASQACDRCRLKKIKCDLK--R 190
           L+ +S  SS +T NG  +       P AA         +AS+ACD+CR KKIKCD K  R
Sbjct: 4   LNSVSTNSSDSTKNGGTSNSPDDMNPAAASGHAMKKRTKASRACDQCRKKKIKCDYKDER 63

Query: 191 PQCSSCASVGFECKLSDKLTRNSFPRGYT 219
             C++C   G  C       +    +GYT
Sbjct: 64  GVCTNCQRNGDRCSFERVPLKRGPSKGYT 92

>Skud_11.190 Chr11 (345221..348736) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 141 LSPISRPSSSTTANGDGAEPLLSSRPDAAG--------RASQACDRCRLKKIKCDLK--R 190
           L+ +S  SS +T NG  +       P AA         +AS+ACD+CR KKIKCD K  R
Sbjct: 4   LNTVSTNSSDSTKNGGTSNSPEDMDPAAATSHAMKKRTKASRACDQCRKKKIKCDYKDER 63

Query: 191 PQCSSCASVGFECKLSDKLTRNSFPRGYT 219
             CS+C   G  C       +    +GYT
Sbjct: 64  GVCSNCQRNGDRCSFERVPLKRGPSKGYT 92

>TBLA0G01800 Chr7 complement(469668..473132) [3465 bp, 1154 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1154

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           D +    QACD CRLKK+KC  ++P+C+ C    +EC  S +  R+   R +
Sbjct: 9   DTSLLNDQACDSCRLKKLKCSKEKPKCAKCLKNIWECCYSPRAKRSPLTRNH 60

>SAKL0E08998g Chr5 complement(747085..749556) [2472 bp, 823 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 823

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 96/221 (43%), Gaps = 17/221 (7%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +  LHR     LT        +E  
Sbjct: 277 LNSIQTIVMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRN----LTMGAPGFTPIEIE 332

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFS 675
            R+ LF+ IY +D++ +  LG+PR I   + + + PL  +     + DG+  E    E S
Sbjct: 333 MRKRLFFTIYKMDIYLNTMLGLPRAISQRDFDQSFPLEIDDEYITE-DGIYPERQGDELS 391

Query: 676 LSVV-----RCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLN 729
            + +     +   +L NI+  ++  +  +  I+ +V T  E  L  W  +LP +      
Sbjct: 392 SAGIANQHTKLIMILDNIVSELYPIKKTNNLISHEVVTNLELKLRQWLNQLPPEL----- 446

Query: 730 ANGMVDL-EHLNHENLILVLLFFLVKSMIYMPLSSAITELA 769
             G+ D+       N +L L F  V+ ++Y P    ++  A
Sbjct: 447 IPGLEDVPPKFYKANRLLHLSFLQVQIVLYRPFIHYLSRTA 487

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           R ++ACD CR KK+KCD ++P C  C    +EC  +    R
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 49

>TDEL0C04480 Chr3 (799022..801580) [2559 bp, 852 aa] {ON} Anc_2.231
           YIL130W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 852

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 100/225 (44%), Gaps = 18/225 (8%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +  LHR  S       S    +E  
Sbjct: 329 LNSIQTILMLFIFLQCSARLSTCYAYIGVAMRSALREGLHRSVSP-----DSGFSPIEIE 383

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNTDKMDGVQLEGTMS- 672
            R+ LF+ IY LDV+ +  LG+PR I  ++ +  LP  LS E    +       +G +S 
Sbjct: 384 MRKRLFYTIYKLDVYVNAMLGLPRSISSNDFDQTLPIELSDENITEEGYFPENQKGKLSS 443

Query: 673 -EFSLSVVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
            E +    +   +L  I+  ++  R  +  I  +V T  E  L  W   LP++       
Sbjct: 444 AEIANQHTKLIMILNVIVGELYPIRKTNNLIRHEVVTELELKLRQWLDGLPREL-----I 498

Query: 731 NGMVDL-EHLNHENLILVLLFFLVKSMIYMPLSSAITE--LANNP 772
            G+ D+ +     N +L L FF V+ ++Y P    ++   +AN+P
Sbjct: 499 PGIKDVPKEYETANKLLHLSFFHVQLILYRPFIHYLSRNIVANSP 543

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 4/59 (6%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           GD  + +L ++     R ++ACD CR KK+KCD ++P C  C    +EC  +    R++
Sbjct: 2   GDQQQQILQNK---RRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKRSN 56

>TPHA0H01980 Chr8 (467688..470669) [2982 bp, 993 aa] {ON} Anc_6.279
           YPL248C
          Length = 993

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%)

Query: 166 PDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           P   G   QACD CR+KK++C  + P+C+ C    +EC  S +  R+   R +
Sbjct: 2   PRIPGVVDQACDSCRIKKLRCSKENPKCAKCLKNKWECCYSPRKRRSPLTRAH 54

>Suva_10.94 Chr10 complement(178366..181086) [2721 bp, 906 aa] {ON}
           YLR014C (REAL)
          Length = 906

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 21/48 (43%), Positives = 25/48 (52%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           ++  AC RCR KKIKCD + P C  CA +   C   D  T    PR Y
Sbjct: 29  KSRTACKRCRQKKIKCDQEFPSCKRCAKLKVPCVSLDPATGKDVPRSY 76

 Score = 35.8 bits (81), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 34/88 (38%), Gaps = 6/88 (6%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           LI+ Y +   +I  ++   G ++ +   L LH              D   +  RR LFWC
Sbjct: 446 LIVIYSIMRPNIPGVWYTMGSVLRLTVDLGLHS------EKINKNYDAFTREIRRRLFWC 499

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALP 651
           +Y LD       G P  I +  I    P
Sbjct: 500 VYSLDRQICSYFGRPFGIPEESITTRYP 527

>ZYRO0A10956g Chr1 (881429..883996) [2568 bp, 855 aa] {ON} similar
           to uniprot|P07272 Saccharomyces cerevisiae YLR014C PPR1
           Zinc finger transcription factor containing a
           Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 855

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 32/72 (44%), Gaps = 4/72 (5%)

Query: 151 TTANGDGAEPLLSSRPDAA----GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLS 206
           T    +G E +   RP +      ++  AC RCR KKIKCD + P C  CA     C   
Sbjct: 4   TIKQVEGEEEVSRKRPSSVVVGITKSISACKRCRTKKIKCDHEFPSCKKCARANKPCVSL 63

Query: 207 DKLTRNSFPRGY 218
           D  T    PR Y
Sbjct: 64  DPATGRDVPRSY 75

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/213 (23%), Positives = 93/213 (43%), Gaps = 39/213 (18%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDR----LEQGNRRT 619
           L+  Y L   ++  ++   G  + +A  L LH            K++R      +  RR 
Sbjct: 404 LVAVYSLMRPNVPGVWYTMGSALRLAVDLGLH----------AEKLNRNYDPFTRELRRR 453

Query: 620 LFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEI---HNTDKMDGVQLEGTMSE- 673
           LFWC+Y LD       G P  I +  I    P  L   +    N D +D  +++ +M+  
Sbjct: 454 LFWCVYSLDRQICSYFGRPFGIPEENITARYPSMLDDALITTTNDDIVDYSKMKSSMASP 513

Query: 674 --FSLSVVRCAKVLGNILDSIFKRNMS-----ESITEQVYTIHENALDSW-RTKLPKKYQ 725
              +L++ +  ++  NI+  ++  N        ++    + +H  +LD+W R ++PK Y+
Sbjct: 514 KVVALAMFKVRRLQANIVQVLYAPNGEVPRSFSNLESWKFEMHR-SLDNWFRKEVPKTYK 572

Query: 726 FKLNANGMVDLEHLNHENLILVLLFFLVKSMIY 758
            K+N+    +  +LN         ++  KSM+Y
Sbjct: 573 -KMNSKFNTEFFNLN---------YWFTKSMLY 595

>NDAI0C03450 Chr3 (789514..791844) [2331 bp, 776 aa] {ON} Anc_5.59
          Length = 776

 Score = 50.1 bits (118), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 123/286 (43%), Gaps = 29/286 (10%)

Query: 447 SEIDELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLE-NILNIKIF-- 503
           S +D  +A YFK+     P+ ++  F ++     +D   L KN  +  E NIL  KI+  
Sbjct: 325 SLLDRFIAAYFKHNHRLFPMIDKIAFLNDVSKI-SDFESLEKNIDTGSEYNILIFKIYMI 383

Query: 504 ---GCLLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQ 560
              GC  T + + G+L    N +      E+ LS   HL Y+  K   + +   +I+TV+
Sbjct: 384 MAIGC--TTLRRAGML----NVE------EEDLS--EHLSYLAMKKFSYVIQLQNIETVR 429

Query: 561 ILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTL 620
            L L+  Y          + + G+I+ +   L L++   A+       +  +E   R  +
Sbjct: 430 CLLLLGIYSFFEPRGSSSWTISGLIMRLTIALGLNK---ALTPKKMKLLSAIEMEARNRV 486

Query: 621 FWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVVR 680
           FW  Y  +   S  LG    I D EI   LP    +++ +K D +++  TM E      R
Sbjct: 487 FWSAYCFERLVSTSLGRFSAIDDDEITIGLP--RPLYDGEK-DEIEVTRTMIELRKIAGR 543

Query: 681 CAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQF 726
             K + ++  S+ ++N+S     ++       LD    K  KK Q 
Sbjct: 544 IYKQVHSV--SVSRQNLSIEQKNKIIEGLSTELDGIYEKESKKMQL 587

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           +C RCR  K KC  + P CS+C     EC
Sbjct: 14  SCSRCRRLKKKCLKEVPTCSNCMKANKEC 42

>TBLA0G02610 Chr7 complement(689843..692845) [3003 bp, 1000 aa] {ON}
           Anc_2.231 YIL130W
          Length = 1000

 Score = 49.7 bits (117), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/176 (25%), Positives = 80/176 (45%), Gaps = 12/176 (6%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRC--PSAVLTGSGSKMDRLE 613
           + ++Q + ++  +   +  +   Y   G+ +  A +  LHR    + + TG+ S+ + +E
Sbjct: 375 LNSIQTILMLFIFLQCSARLSTCYSYIGVALRSALREGLHRVIPTNKIGTGTDSRFNCIE 434

Query: 614 QGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNTDKMDGVQLEGTM 671
              R+ LF+ IY LD++ +  LG+PR I  ++ + +LP  LS E    D++   +    +
Sbjct: 435 IEMRKRLFYTIYKLDIYVNAMLGLPRSISPNDFDQSLPFDLSDENITKDEIFFDRQNNVL 494

Query: 672 SEFSLSVVRCAKVLGNILDSI------FKRNMSESITEQVYTIHENALDSWRTKLP 721
           S  S  +      L  I DSI       K+     I+    T  E  L+ W   LP
Sbjct: 495 S--SAGIANQHTKLMMIFDSIITELYPIKKTSKFFISHDSITNFELKLNHWLNNLP 548

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           R ++ACD CR KK+KCD ++P C  C    +EC  +   TR
Sbjct: 61  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPSTR 100

>KAFR0F01490 Chr6 complement(290988..292964) [1977 bp, 658 aa] {ON}
           Anc_1.128 YJL206C
          Length = 658

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 58/264 (21%), Positives = 118/264 (44%), Gaps = 25/264 (9%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           I ++Q + ++  +   +GD+   Y   G+ + +A +  LHR PS  LTG  +    +E  
Sbjct: 240 IHSIQAIFMMTIFLQCSGDLKACYYYIGIALRIAIRENLHRKPS--LTGPTA----IEDE 293

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEI-----------HNTDKMDG 664
            ++ LFW IY +D++ +  LG+P  + +  I+  LP   +             N++ +  
Sbjct: 294 TKKRLFWSIYKVDIYMNCTLGLPASLNESFIDQELPYDVDDEKIVSDGVIFNENSNIISS 353

Query: 665 VQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKY 724
             +    ++  L +++  + L +I   I K      I   V    E+ L +W   LP + 
Sbjct: 354 CGMNNEHTKLILIMLKIYRTLYSIDVEILK------IDANVVLHLEDILFTWYNNLPLQL 407

Query: 725 QFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAITELANNPKVKNDYYMNHKV 784
           + +  A    + E+    + +L L + L K +++ P    I    N+   KN  + + ++
Sbjct: 408 KHREYATNK-EREYYLKPSKLLYLDYLLTKLILFKPFFHFIIIDLNSIHEKNLKF-HKEM 465

Query: 785 SHTSLQQSINALLSVFKNINNQYL 808
           +H  ++ SI  +   ++ IN   L
Sbjct: 466 AHNCIKISIEIINLSYEMINENLL 489

 Score = 37.4 bits (85), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 5/49 (10%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           R  +AC  CR KK +CD K P CS CA     C    + T  + PR ++
Sbjct: 27  RVFKACIACRKKKRRCDGKSP-CSHCARTSIIC----EYTNTARPRSHS 70

>KLTH0H02684g Chr8 complement(235527..237776) [2250 bp, 749 aa] {ON}
           weakly similar to uniprot|P04386 Saccharomyces
           cerevisiae YPL248C GAL4 DNA-binding transcription factor
           required for the activation of the GAL genes in response
           to galactose repressed by Gal80p and activated by Gal3p
          Length = 749

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 27/47 (57%)

Query: 172 ASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           A QACD CR KK+KC  + P CS+C    ++C  S K  R+   R +
Sbjct: 7   AEQACDWCRRKKLKCSREHPICSNCFKHNWDCHYSPKKVRSPLTRAH 53

>Suva_6.285 Chr6 (499581..501941) [2361 bp, 786 aa] {ON} YJL206C
           (REAL)
          Length = 786

 Score = 49.7 bits (117), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 104/231 (45%), Gaps = 27/231 (11%)

Query: 554 TSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLE 613
           T I ++Q + ++  +   + ++   Y   G+ +  A +  LHR  S  +TG  +  D   
Sbjct: 305 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSS--ITGPTAIQDE-- 360

Query: 614 QGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLE----- 668
              ++ LFW +Y LD++ +  LG P  I + +I+   PL  +  N   M G++ +     
Sbjct: 361 --TKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTM-GIKFQDWRMI 417

Query: 669 ---GTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP---- 721
              G  +E +  ++  +++   ++ S+ ++ + E    Q+ ++++  L++W  +LP    
Sbjct: 418 SSCGMNNEHTKLILIMSRIY-KLMYSLRRKPLEEDSRLQIVSLNDQ-LENWYAQLPDILK 475

Query: 722 ------KKYQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAIT 766
                 ++ Q  L+     +         +L L F L K ++Y P    I+
Sbjct: 476 VDKIIYREPQLPLHICASDNSSPYTKPKKLLYLDFLLSKIVLYKPFYHYIS 526

>NDAI0A08790 Chr1 complement(2026171..2029350) [3180 bp, 1059 aa]
           {ON} Anc_7.17
          Length = 1059

 Score = 49.7 bits (117), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 24/50 (48%)

Query: 154 NGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           N D  E  L+ R     R S  C  CR  K KCD ++P CS C  +G  C
Sbjct: 31  NRDSKEEELAQRKKKRYRLSFVCQECRKSKTKCDKEKPSCSRCLKIGITC 80

>KNAG0B05120 Chr2 (982236..984902) [2667 bp, 888 aa] {ON} 
          Length = 888

 Score = 48.9 bits (115), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           + R ++  ++  AC RCR KK KCD K P C  C  +   C   D  T    PR Y
Sbjct: 33  AKRSNSIPKSRSACKRCRSKKTKCDQKLPSCGKCTKLNTPCISVDPATGEDVPRSY 88

 Score = 38.1 bits (87), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 70/177 (39%), Gaps = 23/177 (12%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           L+  Y L   ++  ++ + G ++ +   L LH              D   +  RR LFWC
Sbjct: 435 LLAIYSLMRPNVPGVWYIMGSVLRLTVDLGLH------TEKLNRNYDPFTRELRRRLFWC 488

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALP--------LSSEIHNTDKMDGVQLEGTMSEFS 675
           +Y LD       G P  I +  I    P        LS++    D  D  ++ G+    +
Sbjct: 489 VYSLDRQICSYFGRPFGIPEESITTRFPSMLDDSSILSNDPAVDDYSDNSEISGSSKVVA 548

Query: 676 LSVVRCAKVLGNILDSIFKRNMSESITEQVY------TIHENALDSW-RTKLPKKYQ 725
            ++ +  K+   ++  ++  +    +  Q +      T+    LD W + ++PK ++
Sbjct: 549 TAMFKIRKIQACVVKVLYAPHA--ELPRQYFNLEDWRTVVSADLDHWYKVEVPKSFE 603

>SAKL0A09856g Chr1 complement(867959..871021) [3063 bp, 1020 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1020

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDLKR--PQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           + S+ACD+CR KKIKCD+    P CS C  VG  C       +    +GYT
Sbjct: 31  KVSRACDQCRKKKIKCDVSEDNPVCSGCFKVGDRCTFERVPLKRGPSKGYT 81

>KLTH0H16170g Chr8 complement(1391996..1393855) [1860 bp, 619 aa]
           {ON} some similarities with uniprot|P52960 Saccharomyces
           cerevisiae YOR363C PIP2 peroxisome induction pathway 2
           (PIP2) transcriptional activator of peroxisome
           proliferation may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 619

 Score = 48.9 bits (115), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 21/34 (61%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            R    CD CR++K+KCD  +P CS CA  G EC
Sbjct: 9   NRRLHVCDACRIRKLKCDKAKPNCSRCAKHGLEC 42

>Skud_9.37 Chr9 (79947..82811) [2865 bp, 954 aa] {ON} YIL130W (REAL)
          Length = 954

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 91/211 (43%), Gaps = 14/211 (6%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +   HR       G+ S    +E  
Sbjct: 344 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHR-----KLGTNSGFSPIEIE 398

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGV--QLEGTMSE 673
            R+ LF+ IY LDV+ +  LG+PR I   + +  LPL     N  +   +       +S 
Sbjct: 399 MRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITETAYLPENQNAVLSS 458

Query: 674 FSLS--VVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
             +S    +   +L  I+  ++  +  S  I+ +  T  E  L +W   LPK  +   NA
Sbjct: 459 TGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPK--ELIPNA 516

Query: 731 NGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
              +D E+    N +L L F  V+ ++Y P 
Sbjct: 517 KN-IDPEY-ERANRLLHLSFLHVQIILYRPF 545

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 24/45 (53%), Gaps = 1/45 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           R ++ACD CR KK+KCD ++P C  C    +EC       R   P
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNP 59

>Skud_10.10 Chr10 complement(21672..24173) [2502 bp, 833 aa] {ON}
           YJL206C (REAL)
          Length = 833

 Score = 48.9 bits (115), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 84/175 (48%), Gaps = 15/175 (8%)

Query: 554 TSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLE 613
           T I ++Q + ++  +   + ++   Y   G+ +  A +  LHR  S V  G     D   
Sbjct: 272 TEIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKEGLHRKSSIV--GPTPIQDE-- 327

Query: 614 QGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEG--TM 671
              ++ LFW +Y LD++ +  LG P  I + +I+   PL  +  N   M G++ +   T+
Sbjct: 328 --TKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTM-GIKFQDWRTI 384

Query: 672 SEFSLS-----VVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP 721
           S   ++     ++     +  ++ S+ ++ + E    Q+ ++++  L++W T+LP
Sbjct: 385 SSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRSQIVSLNDQ-LENWYTQLP 438

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 37/69 (53%), Gaps = 11/69 (15%)

Query: 153 ANGDGAEPLLSSRPDAA--------GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECK 204
            NG  ++ L+ SR DA         GRA +AC  CR +K++C  + P C  C +  FECK
Sbjct: 4   GNGKRSKVLVLSR-DAGTNELKPTRGRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECK 61

Query: 205 LSDKLTRNS 213
             D+  RNS
Sbjct: 62  Y-DRPPRNS 69

>KLLA0E13993g Chr5 complement(1239566..1241602) [2037 bp, 678 aa]
           {ON} some similarities with uniprot|P07272 Saccharomyces
           cerevisiae YLR014C PPR1 Zinc finger transcription factor
           containing a Zn(2)-Cys(6) binuclear cluster domain
           positively regulates transcription of genes involved in
           uracil biosynthesis activity may be modulated by
           interaction with Tup1p
          Length = 678

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           AC  C+ ++ +CD   PQC +C + G +C   DK+T    PR Y
Sbjct: 66  ACCFCKRRRKRCDGGFPQCGACVNAGIQCTFVDKITGRELPRDY 109

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 53/117 (45%), Gaps = 1/117 (0%)

Query: 572 TGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFC 631
           + D  Q++ L G+ +  A  L LHR P +  + +      + Q  R  +FWC Y ++   
Sbjct: 277 SDDYNQLWLLAGVAVRTAVSLDLHRKPGSPRSMTHGLEQHVLQNLRSRVFWCAYSIERLI 336

Query: 632 SLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVVRCAKVLGNI 688
            + +G P  I D +I+  LP  SE+     +     E  M   ++ + +  ++  +I
Sbjct: 337 GMTVGRPFCISDVDIDAPLP-ESELEVGSTLGSADCETHMYANAIEIFKLRRIQSSI 392

>KLTH0G09108g Chr7 (744062..746410) [2349 bp, 782 aa] {ON} weakly
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 782

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 47/212 (22%), Positives = 91/212 (42%), Gaps = 15/212 (7%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +  +HR     L       + +E  
Sbjct: 291 LNSIQAIVMLFIFLQCSARLSTCYTYIGVAMRNALREGMHRN----LNADTHSYNPIEIE 346

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNTDKMDGVQLEGTMSE 673
            R+ LF+ IY +DV+ +  LG+PR +   + + ALP  L+ E    D +   +    +S 
Sbjct: 347 MRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEFITKDGLHFEKQGNVLSS 406

Query: 674 FSLS--VVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
             ++    +   +L NI+  ++  +  +  I+  V T  E  L  W   LP +      A
Sbjct: 407 AGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLELKLRQWLDNLPPEL-----A 461

Query: 731 NGMVDL-EHLNHENLILVLLFFLVKSMIYMPL 761
            G  D+       N +L L F  V+ ++Y P 
Sbjct: 462 PGSNDVPPKYERANQLLHLSFLQVQVILYRPF 493

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD ++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

>KLLA0F04609g Chr6 complement(451579..454329) [2751 bp, 916 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130W ASG1 Proposed transcriptional activator member
           of the Gal4p family of zinc cluster proteins
          Length = 916

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 95/216 (43%), Gaps = 21/216 (9%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + L+  +   +  +   Y   G+ +  A +  LHR        S +K + +E  
Sbjct: 402 LNSIQTIVLLFLFLQCSARLSTSYSYIGVAMRSALREGLHR--KIKPDPSKTKTNFIEIE 459

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPL--------SSEIHNTDKMDGVQL 667
            R+ LF+ IY +D++ +  LG+PR I   + +  LPL           I+  ++ D +  
Sbjct: 460 MRKRLFYTIYKMDIYINTMLGLPRTISPRDFDQELPLELNDDYITEDAIYPEEQGDVLSS 519

Query: 668 EGTMSEFSLSVVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQF 726
            G  ++ +    +   +L  I+  ++  +  +  I+ Q+ T  E  L  W  +LP +   
Sbjct: 520 AGIANQHT----KILMILDQIMADLYPIKKTNNLISHQMVTNLELKLRQWLDQLPPEL-- 573

Query: 727 KLNANGMVDL-EHLNHENLILVLLFFLVKSMIYMPL 761
                G+ D+ E     N +L L F  V+ ++Y P 
Sbjct: 574 ---IPGLKDVPERYLRANCLLHLSFLQVQIILYRPF 606

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD K+P C  C    +EC
Sbjct: 9   RVTRACDECRKKKVKCDGKQP-CIHCTVYNYEC 40

>SAKL0C02024g Chr3 complement(174858..177554) [2697 bp, 898 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014C PPR1 Zinc finger transcription factor containing
           a Zn(2)-Cys(6) binuclear cluster domain positively
           regulates transcription of genes involved in uracil
           biosynthesis activity may be modulated by interaction
           with Tup1p
          Length = 898

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 26/48 (54%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           R+  AC+RCR KK KCD   P C+ CAS+G  C   D  T     R Y
Sbjct: 48  RSIVACERCRTKKTKCDQNFPSCARCASLGEPCISVDPATGRVVSRSY 95

 Score = 38.1 bits (87), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 46/210 (21%), Positives = 83/210 (39%), Gaps = 20/210 (9%)

Query: 564 LILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWC 623
           L++ Y +   +   ++ L G  + +A  L LH              D   +  RR LFWC
Sbjct: 442 LLVIYSIMRPNAPGVWYLMGPALRLAVDLGLH------AEKRNRHCDPFTKELRRRLFWC 495

Query: 624 IYYLDVFCSLQLGVPRLIKDHEIECALP------LSSEIHNTDKMDGVQLEGTMSE---F 674
            Y LD    +  G P  I D  I   LP      L +   N    D   ++ T+      
Sbjct: 496 TYALDRQICVYFGRPFGIPDENITARLPSALDDALIAATRNK-VTDYSSMKSTIVSHKVV 554

Query: 675 SLSVVRCAKVLGNILDSIFKRNMSE----SITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
           SL++ +  ++  +I+  ++  +       S  E+     E+ LD+W   +  K   ++N 
Sbjct: 555 SLALFQMRRIEASIVQVLYAPSCDPPPPFSNLEEWRVAMESELDNWYNNVVPKTSREMNC 614

Query: 731 NGMVDLEHLNHENLILVLLFFLVKSMIYMP 760
               +L  LN+ +  +++     KS+   P
Sbjct: 615 GFDTELFELNYYHSKIMIYGLSPKSLSLTP 644

>KAFR0C03900 Chr3 (787524..789980) [2457 bp, 818 aa] {ON} Anc_2.654
           YKL015W
          Length = 818

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 70/173 (40%), Gaps = 8/173 (4%)

Query: 559 VQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRR 618
           ++ L L  FY       +  Y   G  +     L LH      +      +DR +  + R
Sbjct: 361 IETLLLYAFYLQVADSTVSSYFYFGQALRTCLILGLH------VDSQSDSIDRFKLEHHR 414

Query: 619 TLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSV 678
            L+W +Y  +   S + G+P    D+ I   LP   ++ N    +        +E+  S 
Sbjct: 415 RLWWTVYMFERMLSSKAGLPLSFTDNTISTELPNDFDMSNPPN-ECEHYIFPKAEYISSC 473

Query: 679 VRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNAN 731
           V+  +V  NIL  +++R    +I   +  I +N L SWR +L    Q   N N
Sbjct: 474 VKIVRVNANILSQLYQRQPKHNILPVLQKIMKN-LSSWRNELSDNLQVDFNLN 525

>KLTH0B00352g Chr2 complement(31952..34756) [2805 bp, 934 aa] {ON}
           weakly similar to uniprot|P25611 Saccharomyces
           cerevisiae YCR106W RDS1 Regulator of drug sensitivity
           transcriptional regulator
          Length = 934

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S  C  CR +KIKCD KRP+CS C   G  C
Sbjct: 14  RPSFVCQECRRRKIKCDKKRPRCSRCVDTGLPC 46

>TPHA0C04980 Chr3 (1072547..1075105) [2559 bp, 852 aa] {ON}
           Anc_8.879 YML099C
          Length = 852

 Score = 48.5 bits (114), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/43 (48%), Positives = 25/43 (58%), Gaps = 2/43 (4%)

Query: 163 SSRPDAAGRAS--QACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           SSR     RA   + C  CRL+KIKCDLK+P+C  C S    C
Sbjct: 8   SSRDADNKRAKTFEGCWTCRLRKIKCDLKKPKCDKCRSSAISC 50

>ZYRO0E08272g Chr5 (651705..654089) [2385 bp, 794 aa] {ON} similar
           to uniprot|P04386 Saccharomyces cerevisiae YPL248C GAL4
           DNA-binding transcription factor required for the
           activation of the GAL genes in response to galactose
           repressed by Gal80p and activated by Gal3p
          Length = 794

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 25/45 (55%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
            ACD CR KK++C  + P+C+ C   G+EC  S K  R    R +
Sbjct: 9   HACDSCRQKKLRCSKEEPKCAKCIQNGWECCYSPKANRTPLTRAH 53

>YJL206C Chr10 complement(47659..49935) [2277 bp, 758 aa] {ON}
           Putative protein of unknown function; similar to
           transcriptional regulators from the Zn[2]-Cys[6]
           binuclear cluster protein family; mRNA is weakly cell
           cycle regulated, peaking in S phase; induced rapidly
           upon MMS treatment
          Length = 758

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/278 (19%), Positives = 117/278 (42%), Gaps = 25/278 (8%)

Query: 506 LLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLI 565
           L+  +  +G L   ++    S    +  +   +  ++  KNS      T I ++Q + ++
Sbjct: 236 LIYSVLAVGALFSKEDLSKDSKATREFYTDEGYRYFLEAKNSLDFSNITDIYSIQAIFMM 295

Query: 566 LFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIY 625
             +   + ++   Y   G+ +  A +  LHR  S V  G     D      ++ LFW +Y
Sbjct: 296 TIFLQCSANLKACYSFIGIALRAALKEGLHRRSSIV--GPTPIQDE----TKKRLFWSVY 349

Query: 626 YLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEG--TMSEFSLS-----V 678
            LD++ +  LG P  I + +I+   PL  +  N   + G++ +   T+S   ++     +
Sbjct: 350 KLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTI-GIKFQDWRTISSCGMNNKHTKL 408

Query: 679 VRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP----------KKYQFKL 728
           +     +  ++ S+ ++ + E    Q+ ++++  LD+W  +LP          ++ Q  L
Sbjct: 409 ILIMSRIYKLMYSLRRKPLEEDSRTQIVSLNDQ-LDNWYAQLPDILKVDTIRYRQTQPPL 467

Query: 729 NANGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAIT 766
             +             +L L F L K ++Y P    I+
Sbjct: 468 TVSANDTSSPYTKPKKLLYLDFLLSKIVLYKPFYHYIS 505

 Score = 39.3 bits (90), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           GRA +AC  CR +K++C    P C  C +  +ECK  D+  RNS
Sbjct: 41  GRAHRACIACRKRKVRCSGNIP-CRLCQTNSYECKY-DRPPRNS 82

>KLTH0D07260g Chr4 complement(635598..638537) [2940 bp, 979 aa] {ON}
           some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 979

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 33/64 (51%), Gaps = 10/64 (15%)

Query: 166 PDAAGRAS--------QACDRCRLKKIKCDL--KRPQCSSCASVGFECKLSDKLTRNSFP 215
           P+A G AS        +ACD+CR KK +CD   +RP CS+C  +G  C       +    
Sbjct: 17  PEAGGAASDRRRSKTSRACDQCREKKTRCDFSDERPICSACQRMGKTCTFERVPMKRGPT 76

Query: 216 RGYT 219
           +GYT
Sbjct: 77  KGYT 80

>Suva_9.59 Chr9 (97521..100298) [2778 bp, 926 aa] {ON} YIL130W
           (REAL)
          Length = 926

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 50/211 (23%), Positives = 92/211 (43%), Gaps = 14/211 (6%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +   HR  SA      S    +E  
Sbjct: 343 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLSA-----NSGFTPIEIE 397

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGV--QLEGTMSE 673
            R+ LF+ IY LDV+ +  LG+PR I   + +  LPL     N  ++  +       +S 
Sbjct: 398 MRKRLFYTIYKLDVYINAMLGLPRSISPEDFDQTLPLDLSDENITEVAYLPENQNAVLSS 457

Query: 674 FSLS--VVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
             +S    +   +L  I+  ++  +  +  I+ +  T  E  L +W   LPK  +   NA
Sbjct: 458 TGISNEHTKLFLILNEIISELYPIKKTNNIISHETVTSLELKLRNWLDSLPK--ELMPNA 515

Query: 731 NGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
              +D E+    N +L L F  V+ ++Y P 
Sbjct: 516 KN-IDPEY-ERANRLLHLSFLHVQIILYRPF 544

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC--KLSDKLTRNS 213
           R ++ACD CR KK+KCD ++P C  C    +EC  K   K T+NS
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNS 59

>NDAI0I00740 Chr9 complement(160212..163313) [3102 bp, 1033 aa] {ON}
           Anc_6.279 YPL248C
          Length = 1033

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 164 SRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           S P+A     QACD CRLKK+KC    P+C  C    + C  S K+ R+   R
Sbjct: 2   SSPEAI---EQACDNCRLKKLKCSKHFPKCGQCLKNNWPCIYSPKVKRSPLTR 51

>Smik_9.39 Chr9 (80510..83548) [3039 bp, 1012 aa] {ON} YIL130W
           (REAL)
          Length = 1012

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 93/212 (43%), Gaps = 16/212 (7%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +   HR  S     S S    +E  
Sbjct: 346 LNSIQAILMLFIFLQCSARLSTCYTYIGVAMRSALRAGFHRKLS-----SSSGFSPIEIE 400

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFS 675
            R+ LF+ IY LDV+ +  LG+PR I   + +  LPL     N  ++  +  E   S  S
Sbjct: 401 MRKRLFYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLP-ENQHSVLS 459

Query: 676 LSVV-----RCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLN 729
            + +     +   +L  I+  ++  +  S  I+ +  T  E  L +W   LPK  +   N
Sbjct: 460 STGISNEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPK--ELIPN 517

Query: 730 ANGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
           A   +D E+    N +L L F  V+ ++Y P 
Sbjct: 518 AKN-IDPEY-ERANRLLHLSFLHVQIILYRPF 547

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC--KLSDKLTRNS 213
           R ++ACD CR KK+KCD ++P C  C    +EC  K   K T+NS
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNS 59

>Kpol_1039.11 s1039 (29727..32705) [2979 bp, 992 aa] {ON}
           (29727..32705) [2979 nt, 993 aa]
          Length = 992

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 97/216 (44%), Gaps = 22/216 (10%)

Query: 554 TSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLE 613
           TSI+T+ +L L L +   +  +   Y   G+ +  A +  LHR     +    S ++ L+
Sbjct: 468 TSIQTIIMLFLFLQF---SARLSNCYSYIGIALRNALREGLHR----FVNPKSSNLNPLD 520

Query: 614 QGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP-------LSSEIHNTDKMDGVQ 666
              R+ +F+ IY  D++ +  LG+P+ +   + +  LP       ++ E +  DK +G  
Sbjct: 521 IEMRKRVFYTIYKCDLYLNSMLGLPKSLSSADFDQVLPVELSDENITEEGYFPDKQNGEV 580

Query: 667 LEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESI-TEQVYTIHENALDSWRTKLPKKYQ 725
               ++ +     +   +L +I   ++    S +I + +  T  E  L++W   LP+  Q
Sbjct: 581 SSAAIANYH---TKLMLILADITKELYPNKKSNNIVSHETVTQLEMRLENWIQSLPQ--Q 635

Query: 726 FKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
            K   + + D   +     +L L F  V+ ++Y P 
Sbjct: 636 LKPGPSSVSD--KMMSGRSLLHLTFLQVQIILYRPF 669

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           SS+     R ++ACD CR KK+KCD ++P C  C    + C
Sbjct: 23  SSQQPKRRRVTRACDECRKKKVKCDGQQP-CIHCTVYSYNC 62

>SAKL0D00264g Chr4 complement(24754..27300) [2547 bp, 848 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 848

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 22/41 (53%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
            C  CR +K+KCDL RP C  C   GFEC   D   R S P
Sbjct: 19  GCWTCRSRKVKCDLGRPSCKRCERSGFECGGYDIKLRWSKP 59

>Smik_10.25 Chr10 complement(45977..48295) [2319 bp, 772 aa] {ON}
           YJL206C (REAL)
          Length = 772

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/175 (21%), Positives = 82/175 (46%), Gaps = 15/175 (8%)

Query: 554 TSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLE 613
           T I ++Q + ++  +   + ++   Y   G+ +  A +  LHR  S V          +E
Sbjct: 296 TDIYSIQAIFMMTIFLQCSANLKACYSFIGIALRAALKDGLHRKSSIVGPTP------IE 349

Query: 614 QGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEG--TM 671
              ++ LFW +Y LD++ +  LG P  I + +I+   PL  +  N     G++ +   T+
Sbjct: 350 DETKKRLFWSVYKLDLYMNCILGFPSGIDESDIDQEFPLDVDDENISTT-GIKFQDWRTI 408

Query: 672 SEFSLS-----VVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP 721
           S   ++     ++     +  ++ S+ ++ + E    Q+ ++++  LD W T+LP
Sbjct: 409 SSCGMNNKHTKLILIMSRIYKLMYSLRRKPLEEDSRLQIVSLNDQ-LDDWYTQLP 462

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 2/44 (4%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           GRA +AC  CR +K++C  + P C  C +  FECK  D+  RNS
Sbjct: 52  GRAHRACVACRKRKVRCSGQTP-CRLCQNNSFECKY-DRPPRNS 93

>YIL130W Chr9 (102782..105676) [2895 bp, 964 aa] {ON}  ASG1Zinc
           cluster protein proposed to function as a
           transcriptional regulator involved in the stress
           response; null mutants have a respiratory deficiency,
           calcofluor white sensitivity and slightly increased
           cycloheximide resistance
          Length = 964

 Score = 47.4 bits (111), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 90/207 (43%), Gaps = 17/207 (8%)

Query: 561 ILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTL 620
           IL LI+F    +  +   Y   G+ +  A +   HR  S       S    +E   R+ L
Sbjct: 349 ILMLIIFLQC-SARLSTCYTYIGVAMRSALRAGFHRKLSP-----NSGFSPIEIEMRKRL 402

Query: 621 FWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVV- 679
           F+ IY LDV+ +  LG+PR I   + +  LPL     N  ++  +  E   S  S + + 
Sbjct: 403 FYTIYKLDVYINAMLGLPRSISPDDFDQTLPLDLSDENITEVAYLP-ENQHSVLSSTGIS 461

Query: 680 ----RCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMV 734
               +   +L  I+  ++  +  S  I+ +  T  E  L +W   LPK  +   NA   +
Sbjct: 462 NEHTKLFLILNEIISELYPIKKTSNIISHETVTSLELKLRNWLDSLPK--ELIPNAEN-I 518

Query: 735 DLEHLNHENLILVLLFFLVKSMIYMPL 761
           D E+    N +L L F  V+ ++Y P 
Sbjct: 519 DPEY-ERANRLLHLSFLHVQIILYRPF 544

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/45 (46%), Positives = 28/45 (62%), Gaps = 3/45 (6%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC--KLSDKLTRNS 213
           R ++ACD CR KK+KCD ++P C  C    +EC  K   K T+NS
Sbjct: 16  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYKKPTKRTQNS 59

>NCAS0A04750 Chr1 (944929..948354) [3426 bp, 1141 aa] {ON} Anc_2.547
          Length = 1141

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFECKLSDKLTRNSFPRGYT 219
           +AS+ACD+CR KKIKCD    +  CS+C   G +C       +    +GYT
Sbjct: 70  KASRACDQCRKKKIKCDFSEEKTLCSNCQRNGEKCTFERVPLKRGPSKGYT 120

>YKL038W Chr11 (365605..369117) [3513 bp, 1170 aa] {ON}
           RGT1Glucose-responsive transcription factor that
           regulates expression of several glucose transporter
           (HXT) genes in response to glucose; binds to promoters
           and acts both as a transcriptional activator and
           repressor
          Length = 1170

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFECKLSDKLTRNSFPRGYT 219
           +AS+ACD+CR KKIKCD K  +  CS+C   G  C       +    +GYT
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGVCSNCQRNGDRCSFDRVPLKRGPSKGYT 92

>KNAG0A07100 Chr1 complement(1113008..1116868) [3861 bp, 1286 aa]
           {ON} Anc_2.547 YKL038W
          Length = 1286

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/86 (32%), Positives = 40/86 (46%), Gaps = 9/86 (10%)

Query: 143 PISRPSSSTTANGDG-------AEPLLSSRPDAAGRASQACDRCRLKKIKCDLK--RPQC 193
           PIS    S  + GD        A+P +        +AS+ACD+CR KKIKCD    R  C
Sbjct: 15  PISPGKMSHGSAGDSRSGQRRTADPPMEMHGKKRTKASRACDQCRRKKIKCDYNDMRNIC 74

Query: 194 SSCASVGFECKLSDKLTRNSFPRGYT 219
           ++C  +G  C       +    +GY+
Sbjct: 75  TNCQRIGERCSFERVPLKRGPTKGYS 100

>NDAI0B03850 Chr2 complement(970366..973158) [2793 bp, 930 aa] {ON}
           Anc_2.231 YIL130W
          Length = 930

 Score = 47.4 bits (111), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 49/218 (22%), Positives = 87/218 (39%), Gaps = 26/218 (11%)

Query: 555 SIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQ 614
           S+ ++Q + ++  +   +  +   Y   G+ +  A +  LHR       G  S  + +E 
Sbjct: 374 SLDSIQAILMMFIFLQCSARLSTCYSYIGVAMRSALREGLHR-----QVGPNSGFNPIEI 428

Query: 615 GNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEF 674
             R+ LF+ IY LD++ +  LG+PR I  ++ +  LPL     N      +  +G   E 
Sbjct: 429 EMRKRLFYTIYKLDIYVNAMLGLPRSISANDFDQTLPLELSDEN------ITEQGYFPEN 482

Query: 675 SLSVVRCAKVLGN------ILDSIFK-----RNMSESITEQVYTIHENALDSWRTKLPKK 723
              V+    +         ILD+I       +  +  I+ +     E  L +W   LP  
Sbjct: 483 QNGVLSSTGIANEHTKLLMILDAIVGELYPIKKTNTFISHETIATLEQKLRNWLDDLPN- 541

Query: 724 YQFKLNANGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
              +L  N           N +L L F  V+ ++Y P 
Sbjct: 542 ---ELAPNLENIPPRYERANKLLHLSFLHVQIILYRPF 576

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           R ++ACD CR KK+KCD ++P C  C    +EC  +    R
Sbjct: 34  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYECTYNQPTKR 73

>Ecym_5397 Chr5 (805712..808192) [2481 bp, 826 aa] {ON} similar to
           Ashbya gossypii AER370W
          Length = 826

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/245 (22%), Positives = 103/245 (42%), Gaps = 17/245 (6%)

Query: 524 NKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRG 583
           N + KF++ L    H  ++  KN      T S++ +Q L L+  +   +      Y    
Sbjct: 276 NPNCKFKEYLQDEGHRYFLAAKNLIDIANTQSLEAIQTLCLLFMFAQCSARPSAGYMYLS 335

Query: 584 MIISMAQQLRLHR--CPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLI 641
           + +  A +  LHR   P A ++ S      +E   R+ +F+ IY +DV  +  LG+PR I
Sbjct: 336 LAMKSALREGLHRNLTPEASMSFSP-----IEIEMRKRVFYTIYRMDVMLNTMLGLPRSI 390

Query: 642 KDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSV----VRCAKVLGNILDSIFKRNM 697
              + +  LPL+       +   ++ +G+    S  V     +   ++  I ++++   +
Sbjct: 391 SKEDFDQELPLTISDSCITEEGILRNKGSDILGSTGVTNQHTKLVMIMDEIANTLYSPRL 450

Query: 698 SESITEQVYTIHENALDSWRTKLPKKYQFKLNANGMVDL-EHLNHENLILVLLFFLVKSM 756
              ++  V +  E  L +W  +LP +        G+ D  +     N  L   F  V+ M
Sbjct: 451 DNVVSHSVISDLELKLRAWLDQLPPEL-----VPGLKDAPDRYIAANRQLHFSFLYVQIM 505

Query: 757 IYMPL 761
           +Y P 
Sbjct: 506 LYCPF 510

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (57%), Gaps = 1/40 (2%)

Query: 164 SRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           SR     R ++ACD CR KK+KCD + P C  C    +EC
Sbjct: 10  SRIAKRRRITRACDECRKKKVKCDNRHP-CIHCTVYSYEC 48

>TDEL0E00160 Chr5 (16083..17978) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 26/43 (60%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           +ACD CR KK+KC   RP+C  C   G++C  S ++ R+   R
Sbjct: 6   RACDSCRHKKLKCSKTRPKCKKCLKNGWDCCYSPRIKRSPLTR 48

>KLTH0D02222g Chr4 (220570..223113) [2544 bp, 847 aa] {ON} weakly
           similar to uniprot|P52960 Saccharomyces cerevisiae
           YOR363C PIP2 peroxisome induction pathway 2 (PIP2)
           transcriptional activator of peroxisome proliferation
           may form heterodimer with Oaf1 to activate
           oleate-inducible gene expression activator of peroxisome
           proliferation
          Length = 847

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 2/47 (4%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC--KLSDKLTRNSFP 215
           R S  C  CR +KIKCD  +P+C  CA +G EC   LS++++    P
Sbjct: 27  RLSFVCRNCRKRKIKCDKAQPKCGRCAKLGLECNYDLSEQISLKKTP 73

>Suva_11.187 Chr11 (348570..352085) [3516 bp, 1171 aa] {ON} YKL038W
           (REAL)
          Length = 1171

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFECKLSDKLTRNSFPRGYT 219
           +AS+ACD+CR KKIKCD K  +  CS+C   G  C       +    +GYT
Sbjct: 42  KASRACDQCRKKKIKCDYKDEKGLCSNCQRNGDRCSFERVPLKRGPSKGYT 92

>KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} similar
           to uniprot|P38699 Saccharomyces cerevisiae YHR178W STB5
           binds Sin3p in two-hybrid assay Zinc finger (6-Cys)
          Length = 634

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 83/203 (40%), Gaps = 19/203 (9%)

Query: 450 DELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSS-LENILNIKIFGCLLT 508
           D  +A YFK+   S P+ N+ EF +     + D  ++ +   S+ +  +  +   GC  T
Sbjct: 197 DRFIAAYFKHNHRSYPLLNKIEFLNKVSTIR-DFKEMDEKYDSTFIFELYMVMAIGC--T 253

Query: 509 VICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFY 568
            + + GIL           K E+ LS   H  Y+  K     +   ++ T+  L L+  Y
Sbjct: 254 TLQRAGIL----------SKNEEHLS--EHFAYIAMKKFCTVMHQQNVNTITCLLLLGIY 301

Query: 569 HLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLD 628
                  +  + + G+I+ +   L LHR  +A    S   M  +E   R   FW  Y  +
Sbjct: 302 SFFEPQGVSSWTISGVIMRLTIGLGLHRALTARKMKS---MTVVEVEMRYRAFWSFYSFE 358

Query: 629 VFCSLQLGVPRLIKDHEIECALP 651
              S  LG    I D +I   LP
Sbjct: 359 RLVSTSLGRISAIDDDDISVPLP 381

 Score = 35.8 bits (81), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 20/41 (48%)

Query: 173 SQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           S +C RCR  K +C  + P C SCA  G  C    +  R +
Sbjct: 18  SYSCSRCRKLKKRCSKESPVCVSCAKAGETCTYPGRAPRRT 58

>TBLA0B07920 Chr2 complement(1877300..1879603) [2304 bp, 767 aa]
           {ON} Anc_5.59 YHR178W
          Length = 767

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 70/334 (20%), Positives = 133/334 (39%), Gaps = 53/334 (15%)

Query: 450 DELVALYFKYWSDSIPIFNEKEF---NSNYRVFKADLMKLSKNGPSSLENILNIKIFGCL 506
           D+ +A YF++   + P+ +++ F    S  R F  D+ +        L  I+ I   GC 
Sbjct: 322 DKFIAAYFQHNHRTFPMIDKRAFLGTVSTVRDFN-DMSEFDDTFAFKLNMIMAI---GC- 376

Query: 507 LTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLIL 566
            T + + G+L K  +F+              H  +V        +   +++T++ L L+ 
Sbjct: 377 -TTLHRAGLLKKEHDFR-------------EHFAFVAMSKFSKVLRLQNMETIKCLLLLG 422

Query: 567 FYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYY 626
            Y       +  + + G+ + +   L L+R   A+      K+  +E   R  +FW  Y 
Sbjct: 423 IYSFFEPRGVSSWTISGLTMRLTISLGLNR---ALPLSKMQKVSAIEVELRSRVFWSAYC 479

Query: 627 LDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVVRCAKVLG 686
            +   +  LG    I+D EI  ++PL   ++  +K D         E +L  +   KV G
Sbjct: 480 YERLVATSLGRISAIEDEEI--SVPLPHALYEEEKDD--------IEVTLMTISLRKVSG 529

Query: 687 NILDSIF-----KRNMSESITEQVYTIHENALD-------------SWRTKLPKKYQFKL 728
            I   I      ++N  +   EQ+ T     +D             S + K P   +  L
Sbjct: 530 RIYKLIHSTSAGRQNKPQEEKEQIITSLREEIDEICENEKIKIQQKSRQGKNPTSPEDGL 589

Query: 729 NANGMVDLEHLNHENLILVLLFFLVKSMIYMPLS 762
           ++    DL   ++ ++ L +    ++ M+Y P S
Sbjct: 590 SSETSGDLISFHNSDIWLAMRHAQLQIMLYRPSS 623

 Score = 38.1 bits (87), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           +C RCR  K KC    P CSSCA V   C+   +  R +
Sbjct: 8   SCTRCRRLKKKCSKDAPTCSSCAKVNESCEYPGRAPRRT 46

>SAKL0A02860g Chr1 complement(259388..261625) [2238 bp, 745 aa] {ON}
           similar to uniprot|P04386 Saccharomyces cerevisiae
           YPL248C GAL4 DNA-binding transcription factor required
           for the activation of the GAL genes in response to
           galactose repressed by Gal80p and activated by Gal3p
          Length = 745

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           QACD CR +K++C  + P+CS C    +EC  S K  R+   R
Sbjct: 7   QACDSCRKRKLRCSKELPKCSKCLKHNWECCYSPKAVRSPLTR 49

>Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {ON}
           YHR178W (STB5) - Zinc finger (6-Cys) [contig 1] FULL
          Length = 692

 Score = 46.2 bits (108), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 54/215 (25%), Positives = 83/215 (38%), Gaps = 19/215 (8%)

Query: 450 DELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLENILNIKIFGCLLTV 509
           D  +A YFK+   S P+ N+ EF +     +       K   S +  +  +   GC  T 
Sbjct: 255 DRFIAAYFKHNHRSYPLINKIEFLNKVSTIRQFEEMEDKYETSFIFQLYMVMAIGC--TT 312

Query: 510 ICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYH 569
           + + GIL           K E+ LS   H  Y+  K     +   ++ T+  L L+  Y 
Sbjct: 313 LQRAGIL----------SKNEEGLS--EHFAYLAMKKFCTVMHQQNVDTITCLLLLGIYS 360

Query: 570 LNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSK-MDRLEQGNRRTLFWCIYYLD 628
                 +  + + G+I+ +   L LHR     LT    K M  +E   R   FW  Y  +
Sbjct: 361 FFEPQGVSSWTISGIIMRLTIGLGLHR----ALTARKIKCMSVVEVEMRYRAFWSFYSFE 416

Query: 629 VFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMD 663
              S  LG    I D +I   LP       TD ++
Sbjct: 417 RLVSTSLGRISAIDDDDISVPLPRPLYAEETDDIE 451

 Score = 35.0 bits (79), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 19/39 (48%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           +C RCR  K +C  + P C SCA  G  C    +  R +
Sbjct: 72  SCSRCRKLKKRCSKESPVCVSCAKAGESCTYPGRAPRRT 110

>TBLA0A09760 Chr1 complement(2398683..2403275) [4593 bp, 1530 aa]
           {ON} Anc_6.75 YLR278C
          Length = 1530

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 4/61 (6%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSF 214
           GD  + LL    D  GR S++C  CR +K +CD K P C++C   G +C    + + N+ 
Sbjct: 24  GDNVDLLLQ---DKKGR-SKSCLLCRRRKQRCDHKLPSCTACLKAGVKCVQPARYSNNAA 79

Query: 215 P 215
           P
Sbjct: 80  P 80

>TPHA0A04540 Chr1 (1031790..1035326) [3537 bp, 1178 aa] {ON}
           Anc_3.109 YOL089C
          Length = 1178

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 4/40 (10%)

Query: 168 AAGRASQACDRCRLKKIKCDLKRP----QCSSCASVGFEC 203
           A  R S+ACD CR +KIKCD KR     +CS+C     EC
Sbjct: 245 AKKRVSRACDHCRKRKIKCDEKRDPNTNKCSNCIKYNSEC 284

>Kwal_23.4754 s23 (845550..847988) [2439 bp, 812 aa] {ON} YIL130W
           (GIN1) - 1:1 [contig 5] FULL
          Length = 812

 Score = 46.2 bits (108), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 94/221 (42%), Gaps = 13/221 (5%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +  +HR     L         +E  
Sbjct: 322 LNSIQAIVMLFIFLQCSARLSTCYTYIGVAMRNALREGMHRN----LNTDTHGYSPIEIE 377

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNTDKMDGVQLEGTMSE 673
            R+ LF+ IY +DV+ +  LG+PR +   + + ALP  L+ E    D +   +    +S 
Sbjct: 378 MRKRLFYTIYKMDVYVNTMLGLPRSVSQRDFDQALPAELTDEYITEDGLHPEKQGDVLSS 437

Query: 674 FSLS--VVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
             ++    +   +L NI+  ++  +  +  I+  V T  E  L  W   LP +     N 
Sbjct: 438 AGIANQHTKLIMILDNIVAELYPVKKTNNLISHDVVTQLEFKLRQWLDNLPPELTPGSN- 496

Query: 731 NGMVDLEHLNHENLILVLLFFLVKSMIYMPLSSAITELANN 771
           N     E  N    +L L F  V+ ++Y P    ++ + +N
Sbjct: 497 NVPAKYERANQ---LLHLSFLQVQVILYRPFIHYLSAIISN 534

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD ++P C  C    +EC
Sbjct: 10  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 41

>NDAI0F00110 Chr6 (10745..12271) [1527 bp, 508 aa] {ON} 
          Length = 508

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            R+   C  CR +K+KCD +RP+C  C  +G EC
Sbjct: 14  NRSYSGCWTCRARKVKCDTQRPKCCRCKQLGIEC 47

>Kpol_1002.5 s1002 (11943..14819) [2877 bp, 958 aa] {ON}
           (11943..14819) [2877 nt, 959 aa]
          Length = 958

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 10/68 (14%)

Query: 140 TLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQ--CSSCA 197
           T +P  R  SS+T +  G+            +A++ACD+CR +KIKCD    +  CSSC 
Sbjct: 47  TAAPGKRSRSSSTGSAKGSI--------GGKKATRACDQCRKRKIKCDYDNDKNVCSSCN 98

Query: 198 SVGFECKL 205
             G  C+ 
Sbjct: 99  RNGDRCQF 106

>AAL175W Chr1 (32874..35525) [2652 bp, 883 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YML099C (ARG81)
          Length = 883

 Score = 45.8 bits (107), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (43%)

Query: 134 LKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQC 193
           +K+ KDT S    P++         E   ++      +    C  CRL+K+KCDL +P C
Sbjct: 2   IKDEKDTASARCTPAARNDEALQKKEGSGTAVRRPRAKTFTGCWTCRLRKVKCDLGKPSC 61

Query: 194 SSCASVGFECKLSDKLTRNSFP 215
             C   G +C   D   R S P
Sbjct: 62  QRCEKSGLDCGGYDIKLRWSNP 83

>ZYRO0A00440g Chr1 complement(27895..30447) [2553 bp, 850 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 850

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 23/46 (50%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           G+    C  CR +K+KCDL+RP C  C   G  C   D   R S P
Sbjct: 34  GKTFTGCWTCRSRKVKCDLRRPHCQRCEKSGLVCGGYDIKLRWSKP 79

>KLLA0F19602g Chr6 complement(1814949..1816760) [1812 bp, 603 aa]
           {ON} similar to uniprot|P43634 Saccharomyces cerevisiae
           YLR098C CHA4 Zinc-finger protein with Zn[2]-Cys[6]
           fungal- type binuclear cluster domain DNA-binding
           transcriptional activator or CHA1 and some similarities
           to YOR337W uniprot|P47988 Saccharomyces cerevisiae
           YOR337W TEA1 Mutants are defective in Ty1
           Enhancer-mediated Activation Ty1 enhancer activator
          Length = 603

 Score = 45.4 bits (106), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 23/33 (69%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           +A  AC  CR+K+ KCD++RP CS+C   G EC
Sbjct: 12  KAHLACQNCRIKRRKCDMERP-CSNCLKYGIEC 43

 Score = 38.9 bits (89), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 37/185 (20%), Positives = 76/185 (41%), Gaps = 9/185 (4%)

Query: 559 VQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRR 618
           +Q L  + FY +  G+    +   G+   MA ++ LH  P A       K+ +++   R 
Sbjct: 262 IQTLLCLAFYDIGNGENPLAWYESGLAFRMAHEIGLHLNPEAWDDVYDDKLSQIDIEVRS 321

Query: 619 TLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDK-MDGVQLEGTMSEFSLS 677
            ++W  Y  D   ++  G    ++       +P + E+ N D  ++  Q + T+      
Sbjct: 322 RIYWGCYIADHLIAVLFGRSNSLRVS--NSTIPETDELPNIDTGIEDYQYDPTIVTSIAK 379

Query: 678 VVRCAKVLGNILD----SIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGM 733
            ++   VL  I +     IF    S +   +  T   + + +WR  LP   +F L    +
Sbjct: 380 PLKKIIVLSRITEVFAPKIFIHAGSLTERREYLTKFNSEVSNWRKNLPD--EFALTKATL 437

Query: 734 VDLEH 738
           ++ ++
Sbjct: 438 INFDY 442

>KLLA0A09119g Chr1 complement(797533..800781) [3249 bp, 1082 aa]
           {ON} weakly similar to uniprot|P12383 Saccharomyces
           cerevisiae YGL013C PDR1 Zinc cluster protein that is a
           master regulator involved in recruiting other zinc
           cluster proteins to pleiotropic drug response elements
           (PDREs) to fine tune the regulation of multidrug
           resistance genes
          Length = 1082

 Score = 45.8 bits (107), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 32/63 (50%), Gaps = 5/63 (7%)

Query: 148 SSSTTANGDGAEPLLSSRPDAAGR----ASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           S+S+  NGD       S  +  G+     S+ACD CR KKIKC    P C SC + G EC
Sbjct: 23  SASSGVNGDRTAIPRDSNGNGTGKPRRKVSRACDSCRKKKIKCSGTLP-CKSCETYGCEC 81

Query: 204 KLS 206
             S
Sbjct: 82  VYS 84

>KAFR0G02540 Chr7 complement(524919..527486) [2568 bp, 855 aa] {ON}
           Anc_6.60 YLR266C possible pseudogene; N added to avoid
           frameshift
          Length = 855

 Score = 45.4 bits (106), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 39/71 (54%), Gaps = 4/71 (5%)

Query: 142 SPISRPSSSTTANGDGAEPLLSSRPDAAGRASQ---ACDRCRLKKIKCDLKRPQCSSCAS 198
           S ++ P+ ++  + D A+     R  +  +  +   +C  CR +K+KCD ++P CSSC S
Sbjct: 8   SGVNIPAVTSNTDNDAAKITKKRRKASVNKKRKPIKSCAFCRRRKLKCDQRKPICSSCKS 67

Query: 199 VGFE-CKLSDK 208
             F+ C  +D+
Sbjct: 68  RNFQVCMYTDE 78

>NCAS0C00220 Chr3 (22532..25051) [2520 bp, 839 aa] {ON} Anc_8.879
          Length = 839

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           + RP  A +    C  CR +K+KCDL+RP C  C   G EC
Sbjct: 9   TKRPRRA-KTFTGCWTCRSRKVKCDLRRPGCVRCDKSGLEC 48

>YGR288W Chr7 (1070293..1071714) [1422 bp, 473 aa] {ON}
           MAL13MAL-activator protein, part of complex locus MAL1;
           nonfunctional in genomic reference strain S288C
          Length = 473

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 172 ASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           A QACD CR++++KCD KRP CSSC     +C
Sbjct: 9   AKQACDCCRIRRVKCDGKRP-CSSCLQNSLDC 39

>AER370W Chr5 (1320487..1322892) [2406 bp, 801 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL130W
          Length = 801

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 19/164 (11%)

Query: 608 KMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLS--------SEIHNT 659
           K   LEQ  R+ LF+ +Y ++VF +  LG+P  +   + + +LPL         S IH  
Sbjct: 353 KYSPLEQEMRKRLFYTLYKMEVFVNTMLGLPSSLSKDDYDQSLPLEISDKYISDSGIHAE 412

Query: 660 DKMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRT 718
            + D +   G  ++ +  ++    ++  I   ++  +   + I+ +V +  E  L SW  
Sbjct: 413 QQRDILSSSGVANQHTKLIM----IMEEIAAQLYPVKRTGKFISHKVISALELKLRSWLD 468

Query: 719 KLPKKYQFKLNANGMVDL-EHLNHENLILVLLFFLVKSMIYMPL 761
           +LP +        G+ D+ E     N +L L F  V+ ++Y P 
Sbjct: 469 QLPAEL-----VPGLKDVPERYYMANRMLHLSFLHVQLILYRPF 507

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD + P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDSRHP-CIHCTVYSYEC 44

>TDEL0B00480 Chr2 (83911..86418) [2508 bp, 835 aa] {ON} Anc_8.879
           YML099C
          Length = 835

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
            C  CR +K+KCDL+RP C  C   G +C   D   R S P
Sbjct: 27  GCWTCRSRKVKCDLQRPNCGRCEKSGLDCGGYDIKLRWSNP 67

>KNAG0E00210 Chr5 (24545..27391) [2847 bp, 948 aa] {ON} Anc_7.17
           YOR363C
          Length = 948

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 19/33 (57%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S  C  CR  K KCD ++PQC  C  +G EC
Sbjct: 24  RLSYVCKACRTAKAKCDKEKPQCGRCYKLGVEC 56

>KAFR0F01040 Chr6 complement(195192..197696) [2505 bp, 834 aa] {ON}
           Anc_6.279 YPL248C
          Length = 834

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           QACD CR+KK++C  ++P C  C      C  S +  R+   R +
Sbjct: 3   QACDICRVKKLRCSKEKPSCFKCLKNNLTCTYSPRAKRSPLTRAH 47

>KLLA0D12672g Chr4 complement(1076011..1078608) [2598 bp, 865 aa]
           {ON} uniprot|P08657 Kluyveromyces lactis LAC9 Lactose
           regulatory protein LAC9
          Length = 865

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 23/45 (51%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           QACD CR KK KC    P C++C     +C  S ++ R    R +
Sbjct: 93  QACDACRKKKWKCSKTVPTCTNCLKYNLDCVYSPQVVRTPLTRAH 137

>Ecym_7440 Chr7 complement(902108..904804) [2697 bp, 898 aa] {ON}
           similar to Ashbya gossypii AER183C
          Length = 898

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 1/41 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           R S+ACD CR KKIKC+ + P CS+C     EC  +  + R
Sbjct: 22  RVSKACDTCRAKKIKCNGEEP-CSNCGKHDLECAYTHVIKR 61

>NCAS0B06550 Chr2 complement(1242371..1245091) [2721 bp, 906 aa]
           {ON} Anc_2.231
          Length = 906

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD ++P C  C    +EC
Sbjct: 32  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 63

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 91/217 (41%), Gaps = 26/217 (11%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           + ++Q + ++  +   +  +   Y   G+ +  A +   HR       G  S    +E  
Sbjct: 352 LNSIQAILMLFIFLQCSARLSTCYAYIGVAMRSALREGYHR-----QVGPLSGFTPIEIE 406

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGV--QLEGTMSE 673
            R+ LF+ IY LD++ +  LG+PR I   + +  LP+     N  +   +     G +S 
Sbjct: 407 MRKRLFYTIYKLDIYVNAMLGLPRSISPDDFDQTLPIELSDENITEHGYLPENQNGVLS- 465

Query: 674 FSLSVVRCAKVLGNILDSIFK-----RNMSESITEQVYTIHENALDSWRTKLPKKYQFKL 728
            S  +      L  IL+SI +     +  +  I+ +  T  E  L +W  +LP +     
Sbjct: 466 -STGIANQHTKLLMILNSIVRELYPIKKTNNLISHETVTRLELKLRTWMDELPTEL---- 520

Query: 729 NANGMVDLEHL----NHENLILVLLFFLVKSMIYMPL 761
               + +LE++       N +L L F  V+ ++Y P 
Sbjct: 521 ----VPNLENIPAKYERANKLLHLSFLHVQIILYRPF 553

>KLLA0F02750g Chr6 complement(250368..253814) [3447 bp, 1148 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1148

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 10/60 (16%)

Query: 147 PSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRP---QCSSCASVGFEC 203
           P+ ++ A G   +P       A  R S+ACDRCR +KIKCD   P   +CS+C      C
Sbjct: 12  PAITSHAEGVTTKP-------AKKRVSKACDRCRRRKIKCDDLDPVSGKCSNCIKYKVPC 64

>KAFR0J01710 Chr10 complement(327570..330116) [2547 bp, 848 aa] {ON}
           Anc_2.231 YIL130W
          Length = 848

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R ++ACD CR KK+KCD ++P C  C    +EC
Sbjct: 13  RVTRACDECRKKKVKCDGQQP-CIHCTVYSYEC 44

 Score = 37.7 bits (86), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 40/214 (18%), Positives = 90/214 (42%), Gaps = 13/214 (6%)

Query: 553 TTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRL 612
           T  + ++Q + ++  +   +  +   Y   G+ +    +   HR        +   ++ +
Sbjct: 312 TRDLNSIQTVLMLFIFLQCSARLSSCYTYIGVAMRSVLREGYHRASDP----NDPNINPI 367

Query: 613 EQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP--LSSEIHNTDKMDGVQLEGT 670
           E   ++ LF+ +Y +D++ +  LG+PR ++  + +  LP  LS E    +     + +G 
Sbjct: 368 ELEMKKRLFYNVYKMDIYINAMLGLPRSLRVEDFDQTLPIELSDENITAEGYFYERQKGE 427

Query: 671 MSEFSLS--VVRCAKVLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKKYQFK 727
           +S  ++S    +   V   I+  ++  +  +  I+ +  T  E  L  W   LP + +  
Sbjct: 428 LSSIAISNQHTKLIMVFDTIVSELYPLKKTNNMISHETVTRLEAKLTEWVDNLPVELRPT 487

Query: 728 LNANGMVDLEHLNHENLILVLLFFLVKSMIYMPL 761
            +A            N +L L F  V+ ++Y P 
Sbjct: 488 TDAIP----PKYERANKLLQLSFLHVQIILYRPF 517

>Ecym_2522 Chr2 (1017930..1020710) [2781 bp, 926 aa] {ON} similar to
           Ashbya gossypii AGL233C
          Length = 926

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGF-ECKLSDKLTRN 212
           + S++C  CR +++KCD  RP+CS+C S G  EC    + T +
Sbjct: 14  KVSKSCVFCRKRRVKCDKARPKCSTCVSKGLPECVYLSEFTHD 56

>NDAI0K01800 Chr11 (401055..404687) [3633 bp, 1210 aa] {ON}
           Anc_2.547
          Length = 1210

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFECKLSDKLTRNSFPRGYT 219
           +AS+ACD+CR KKIKCD    +  CS+C     +C       +    +GYT
Sbjct: 86  KASRACDQCRKKKIKCDFTEAKNICSNCQRNAEKCTFERVPLKRGPSKGYT 136

>TBLA0C04050 Chr3 complement(980010..983633) [3624 bp, 1207 aa] {ON}
           Anc_4.113 YGL013C
          Length = 1207

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLS 206
           ++RP    + S+ACD CR +KIKC  +RP C+ C +   EC  S
Sbjct: 6   ATRP--RSKVSKACDNCRRRKIKCSGERP-CAGCKTYNCECIFS 46

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 53/118 (44%), Gaps = 12/118 (10%)

Query: 534 SYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLR 593
           +YY+  +Y L  + +F     +I+ +++L + L   L   +      +  + I+ A Q+ 
Sbjct: 541 NYYNSTLYHL--DDHFN----TIEYLELLIVFLKQQLVASEFYGFERVLDVAINYAIQMG 594

Query: 594 LHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
             R    V       +   +   RR L+W +Y ++    ++ G P +I + +I C LP
Sbjct: 595 FSRWEFYV------GLQEYQAEKRRQLWWKLYMIEKLHCMKRGFPSVINEDKINCLLP 646

>KNAG0J00210 Chr10 (26132..28717) [2586 bp, 861 aa] {ON} Anc_8.879
           YML099C
          Length = 861

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 160 PLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           P + +RP  A +    C  CR +K+KCDL+RP C  C     EC
Sbjct: 8   PRVKARPRRA-KTFTGCWTCRSRKVKCDLRRPGCLRCEKSSLEC 50

>NCAS0A08840 Chr1 (1746841..1751277) [4437 bp, 1478 aa] {ON}
           Anc_1.380
          Length = 1478

 Score = 44.7 bits (104), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 142 SPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVG 200
           +P+S   SS+ AN +G    +  +     R   +C  CR +K+KCD  RP C  C   G
Sbjct: 12  TPLSATDSSSHANANGTSTKVKRK---RNRVPLSCTICRKRKVKCDKIRPHCQQCTKTG 67

>Suva_15.77 Chr15 complement(123654..126743) [3090 bp, 1029 aa] {ON}
           YOL089C (REAL)
          Length = 1029

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 5/56 (8%)

Query: 161 LLSSRPDAAGRASQACDRCRLKKIKCDLKRPQ---CSSCASVGFEC--KLSDKLTR 211
           L++S  +   R S+ACD CR +KI+CD   PQ   CS+C      C  K  D++ R
Sbjct: 118 LIASSKNLKKRVSKACDHCRKRKIRCDEVDPQTNKCSNCVKFQSACTFKHRDEILR 173

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 16/115 (13%)

Query: 533 LSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQL 592
           + YYH L            I +  +T+Q L L+  Y   T D      + G  I +A  +
Sbjct: 454 MYYYHKL----------STICSGTRTLQALLLLNRYCQVTYDTELANSILGTAIRLAVDM 503

Query: 593 RLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIE 647
            L+R        S   +D  E   RR+++W  +  D   SL L  P ++ + +++
Sbjct: 504 ELNR------NSSYKSLDFEEAIKRRSMWWHCFCTDKLYSLMLSRPPIVGEQDMD 552

>KAFR0L02130 Chr12 (403953..406601) [2649 bp, 882 aa] {ON} Anc_8.879
           YML099C
          Length = 882

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 22/41 (53%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
            C  CR +K+KCDL RP C+ C   G +C   D   R S P
Sbjct: 21  GCWTCRARKVKCDLTRPSCTRCERSGLKCGGYDIKLRWSKP 61

>CAGL0L01903g Chr12 (220700..224563) [3864 bp, 1287 aa] {ON} similar
           to uniprot|P32862 Saccharomyces cerevisiae YKL038w RGT1
          Length = 1287

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/36 (52%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 172 ASQACDRCRLKKIKCDL--KRPQCSSCASVGFECKL 205
            S+ACD+CR KKIKCD   +R  C+SC   G  CK 
Sbjct: 12  VSRACDQCRRKKIKCDRNQERNICTSCQRNGERCKF 47

>KLTH0E00440g Chr5 complement(42945..45011) [2067 bp, 688 aa] {ON}
           some similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 28/186 (15%)

Query: 563 SLILFYHLNT----GDIIQIYDLRG---MIISMAQQ----LRLHRCPSA-VLTGSGSKMD 610
           SL L YH  T     ++++ YD      +I+S+       L L++  SA V+TGS  +  
Sbjct: 265 SLGLKYHRTTLLLYSELVKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTM 324

Query: 611 RLEQGNRRT-------LFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMD 663
                ++RT       +FW  +  D   +++ G P +I +  I   +PL +E+   D + 
Sbjct: 325 FTLGLHKRTKTIVENRVFWLCFIYDRLLAVRFGFPLMIDERNIN--IPLLTEVD--DNLT 380

Query: 664 GVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKK 723
            V L+  +  F +S VR AK+   I+  I+ RN   S     + + +  L +W   LP +
Sbjct: 381 AVSLD--IYHF-VSQVRLAKITTQIITKIYTRN-PYSFLHNCHAVLKQ-LKNWFESLPAE 435

Query: 724 YQFKLN 729
            +F  N
Sbjct: 436 LKFDYN 441

>KLTH0B10076g Chr2 (841024..843090) [2067 bp, 688 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 688

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 50/186 (26%), Positives = 86/186 (46%), Gaps = 28/186 (15%)

Query: 563 SLILFYHLNT----GDIIQIYDLRG---MIISMAQQ----LRLHRCPSA-VLTGSGSKMD 610
           SL L YH  T     ++++ YD      +I+S+       L L++  SA V+TGS  +  
Sbjct: 265 SLGLKYHRTTLLLYSELVKTYDCAASTSLILSLLYMAYFSLSLNKATSAFVMTGSAIRTM 324

Query: 611 RLEQGNRRT-------LFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMD 663
                ++RT       +FW  +  D   +++ G P +I +  I   +PL +E+   D + 
Sbjct: 325 FTLGLHKRTKTIVENRVFWLCFIYDRLLAVRFGFPLMIDERNIN--IPLLTEVD--DNLT 380

Query: 664 GVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKK 723
            V L+  +  F +S VR AK+   I+  I+ RN   S     + + +  L +W   LP +
Sbjct: 381 AVSLD--IYHF-VSQVRLAKITTQIITKIYTRN-PYSFLHNCHAVLKQ-LKNWFESLPAE 435

Query: 724 YQFKLN 729
            +F  N
Sbjct: 436 LKFDYN 441

>NDAI0G04140 Chr7 (994071..997076) [3006 bp, 1001 aa] {ON} Anc_3.109
           YBR150C
          Length = 1001

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 27/44 (61%), Gaps = 3/44 (6%)

Query: 171 RASQACDRCRLKKIKCDL---KRPQCSSCASVGFECKLSDKLTR 211
           RAS+ACD CR +KIKCD    +  +CS+C     EC  S++  R
Sbjct: 98  RASKACDLCRRRKIKCDAFDDRLKKCSNCIKYHSECTFSNQNKR 141

>KLTH0E03256g Chr5 complement(294997..297021) [2025 bp, 674 aa] {ON}
           weakly similar to uniprot|P39529 Saccharomyces
           cerevisiae YJL206C Hypothetical ORF
          Length = 674

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%), Gaps = 8/115 (6%)

Query: 539 LMYVLPKNSYFG--VITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHR 596
           + Y +    YF   +   ++ +V+ L LI FY      +  +Y   G+ +S A    +HR
Sbjct: 260 MCYYISALKYFHEPIEEPNLDSVRTLILIAFYSQGLNRMNSVYAYTGLALSTAVAQGIHR 319

Query: 597 CPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
                   +  +  R EQ  R+ ++W  + +D   + +LG+P      +I+  LP
Sbjct: 320 ------QANNHQFPRAEQEARKKIWWTAFLMDTLWASRLGLPPHFNSCDIDIELP 368

 Score = 33.9 bits (76), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 11/26 (42%), Positives = 18/26 (69%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSC 196
           R+ +AC RC  +K+KC  ++P C +C
Sbjct: 12  RSKKACQRCSAQKVKCLGEKPPCRAC 37

>CAGL0M12298g Chr13 complement(1227303..1230287) [2985 bp, 994 aa]
           {ON} similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051w OAF1 peroxisome proliferating transcription
           factor or uniprot|P52960 Saccharomyces cerevisiae
           YOR363c PIP2
          Length = 994

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 59/148 (39%), Gaps = 14/148 (9%)

Query: 155 GDGAEPLL-SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           G G+ P   ++R     R S  C  CR  K +CD ++P C+ C  +  EC     + + S
Sbjct: 5   GSGSSPEGNAARTRKRNRISFVCQACRRSKTRCDKEKPICTRCKKLKLECVYD--MAKQS 62

Query: 214 FPRGYTXXXXXXXXXXXXXXXXXXAMNDLKEQQLFKIPEDIQSVVDVDAELNSSNQTKNM 273
            PR  +                  AM  ++EQ+   + +D            SS   +NM
Sbjct: 63  APRIPSKDATIARLGRDVDYWKNKAMKLMQEQESMPVNKDSNV---------SSGSLENM 113

Query: 274 YATHVCDGICCQDTKLHSRPVATNFNLN 301
            + +  DG   +    + RP   ++N+N
Sbjct: 114 NSDYESDGESRESD--YKRPRLDSYNIN 139

>NDAI0D00900 Chr4 (205039..207636) [2598 bp, 865 aa] {ON} 
          Length = 865

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 21/33 (63%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S  C  C+ +K++CD +RP CS C  +G +C
Sbjct: 26  RRSHVCITCKNQKLRCDRERPSCSRCRRIGRDC 58

>Kwal_47.17681 s47 complement(513119..515683) [2565 bp, 854 aa] {ON}
           [contig 206] FULL
          Length = 854

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 58/290 (20%), Positives = 115/290 (39%), Gaps = 45/290 (15%)

Query: 450 DELVALYFKYWSDSIPIFNEKEFNSNYRVFKADLMKLSKNGPSSLENILNIKIFGCLLTV 509
           DELV L+F+Y    +PI N+ EF + Y                   N  +I +   L  +
Sbjct: 200 DELVDLFFRYIHPLMPIINQTEFRAAYAA-----------------NTCSIFL---LQAI 239

Query: 510 ICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYH 569
           +C    L +     +K    +   + ++     L    Y       ++ + +LS   F  
Sbjct: 240 LCVSVKLSRNPLLMDKDSSTDLASNIFYQRAKSLYDGRYEENEICLLQGMMLLSKQAFNE 299

Query: 570 LNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDV 629
            NT  +  +Y ++  + ++AQ   LHR      T + +     E+  R+ ++W +Y +D 
Sbjct: 300 KNTIHM-PMYFIKNAV-TVAQTYGLHRSADFHPTLTAN-----EKRTRKLIWWILYVIDT 352

Query: 630 FCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSV---------VR 680
             S+ +G P+ I   +  C +P+ +        D    EG   + +++V         V+
Sbjct: 353 LVSISIGRPQAINLDD--CDVPVLTH-------DDFIFEGGAPDHAVAVDYMDCIISTVQ 403

Query: 681 CAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNA 730
             +++  I   + +   S+   + +    +  L  WR  LP+   +  NA
Sbjct: 404 IVEIMSRISRELNRPAASQCDAKVLIQHFDMLLQRWRKNLPESLTYHSNA 453

 Score = 39.7 bits (91), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 171 RASQACDRCRLKKIKCDLK-RPQCSSCASVGFECKLSD 207
           R ++AC+ C  +K++CD   R  C+SC + G  C+L D
Sbjct: 14  RTNRACEVCHDRKVRCDANIRVPCTSCQTFGLVCRLRD 51

>KLTH0E14454g Chr5 complement(1282704..1285412) [2709 bp, 902 aa]
           {ON} some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger; overexpression increases salt
           tolerance through increased expression of the
           ENA1(Na+/Li+ extrusion pump) gene while gene disruption
           decreases both salt tolerance and ENA1 expression
          Length = 902

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S+ACD CR KKIKCD   P CS+C  V  EC
Sbjct: 9   RVSKACDACRAKKIKCDGCDP-CSNCKKVSQEC 40

>KLLA0D10153g Chr4 (858016..859983) [1968 bp, 655 aa] {ON} some
           similarities with uniprot|P35995 Saccharomyces
           cerevisiae YKL222C Hypothetical ORF
          Length = 655

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 24/38 (63%)

Query: 166 PDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           P +  + +++C  C+ +K KCD K P CS+C   G+EC
Sbjct: 2   PKSRNKPTRSCLMCQRRKKKCDRKAPSCSACLKKGYEC 39

>Kwal_14.778 s14 complement(40408..42405) [1998 bp, 665 aa] {ON}
           YKL015W (PUT3) - zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type [contig 245]
           FULL
          Length = 665

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 52/221 (23%), Positives = 91/221 (41%), Gaps = 37/221 (16%)

Query: 533 LSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQL 592
           LS Y  LM V           TS+  VQ L  + ++ L+       + + G  I     L
Sbjct: 252 LSLYAELMKVYE-------WATSVSLVQSLLYMAYFALSLNRTTFAFVITGDAIRTMFTL 304

Query: 593 RLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPL 652
            LH+  S+V            +GNR  +FW  +  D   +++ G P +I +  I   +P+
Sbjct: 305 GLHKSTSSV------------RGNR--VFWLCFIYDRLLAVRFGFPLMIDERSIN--VPI 348

Query: 653 SSEIHNTDKMDGVQLEGTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENA 712
            SE+  +     + +   +S+     +R AK+   ++  I+ RN   S  +   T+    
Sbjct: 349 FSEVDESLTATSLDIYHFVSQ-----IRLAKITTQVITKIYTRN-PFSFLQNCRTVL-GQ 401

Query: 713 LDSWRTKLPKKYQFKLN------ANGMVDLEHLNHENLILV 747
           L  W   LP + +F  N          V+L H+N+   I++
Sbjct: 402 LKRWFDSLPIELKFDYNDIKTGITRATVNL-HINYNYSIII 441

>NCAS0D04860 Chr4 (933920..936025) [2106 bp, 701 aa] {ON} 
          Length = 701

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGF-ECKLSDK 208
            R  ++C  CRL+K KCD  +P CSSC   G  EC+  D+
Sbjct: 20  NRVPKSCTVCRLRKSKCDRIKPYCSSCVLHGIKECRYDDR 59

>TBLA0G01130 Chr7 (287952..291350) [3399 bp, 1132 aa] {ON} Anc_8.879
           YML099C
          Length = 1132

 Score = 43.5 bits (101), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 20/37 (54%)

Query: 168 AAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECK 204
           A  R    C  CR +KIKCD ++PQC  C     +C+
Sbjct: 8   ARNRTYSGCWTCRSRKIKCDQQKPQCKRCLKANLKCE 44

>TPHA0F02630 Chr6 complement(583511..587299) [3789 bp, 1262 aa] {ON}
           Anc_6.75 YLR278C
          Length = 1262

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           GD  E LL    D  GR S++C  CR +K KCD   P C+SC   G +C
Sbjct: 24  GDKVEVLLV---DKKGR-SKSCLLCRRRKQKCDHNLPSCTSCLKAGVKC 68

 Score = 34.3 bits (77), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 2/36 (5%)

Query: 620 LFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSE 655
           LFWC+Y L+    + +G P  I + EI+  LPL  E
Sbjct: 501 LFWCVYLLERMICVAVGCPFTISEREID--LPLFDE 534

>SAKL0A08074g Chr1 (711985..715425) [3441 bp, 1146 aa] {ON} similar
           to uniprot|Q05854 Saccharomyces cerevisiae YLR278C
           Protein of unknown function localizes to the nucleus
           potential Cdc28p substrate
          Length = 1146

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 22/124 (17%)

Query: 543 LPKNSYF----------GVITTSIKTVQILSLILFYHLNTG-DIIQIYDLRGMIISMAQQ 591
           LP N YF          G   T ++ V++L+L++ Y + T  D I +Y++   ++S+   
Sbjct: 331 LPPNRYFSTAIRHITKCGPNLTFVQQVEVLTLLVLYIIRTDRDSIGLYEIIKDVMSI--- 387

Query: 592 LRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
                C + +   + +  D       R LFWC+Y L+    + +G P  I + EI   LP
Sbjct: 388 -----CKNKLFLNNWNPQDIFANKKLR-LFWCVYLLERMICVAVGKPYTIAESEI--YLP 439

Query: 652 LSSE 655
           L +E
Sbjct: 440 LFNE 443

 Score = 36.2 bits (82), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           D  GR S++C  C+ +K +CD K P C++C     +C
Sbjct: 33  DKKGR-SRSCLLCQRRKQRCDHKLPSCTACLKAAVKC 68

>CAGL0G08844g Chr7 complement(846590..849133) [2544 bp, 847 aa] {ON}
           similar to uniprot|P40467 Saccharomyces cerevisiae
           YIL130w
          Length = 847

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 24/41 (58%), Gaps = 1/41 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
           + ++ACD CR KK+KCD  +P C  C    +EC  +  L R
Sbjct: 15  KVTRACDDCRKKKVKCDGNQP-CIHCTVYSYECTYNHPLKR 54

 Score = 41.2 bits (95), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 77/166 (46%), Gaps = 19/166 (11%)

Query: 612 LEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTM 671
           LE   R+ LF+ IY LDV+ +  LG+P  +   + +  LPL       + +    +    
Sbjct: 399 LEIEMRKRLFYTIYKLDVYVNAMLGLPGSLDREDFDQELPLDLP---DEALTEQGINYDQ 455

Query: 672 SEFSLSVVRCAK-------VLGNILDSIFK-RNMSESITEQVYTIHENALDSWRTKLPKK 723
           + +SLS    A        +LG+IL  ++  + ++  I+ +  T  E  L  W  +LP+ 
Sbjct: 456 NPYSLSSTGIANEHTKLFMILGDILKHLYPIKKINIFISHKTVTDLELKLKMWLEELPR- 514

Query: 724 YQFKLNANGMVDLEHLNHE--NLILVLLFFLVKSMIYMPLSSAITE 767
            +   NA+ +    H  +E  N +L L F  V+ ++Y P    I++
Sbjct: 515 -ELVPNAHDI----HPQYERANKLLHLAFLHVQLILYRPFIHYISK 555

>YGL013C Chr7 complement(469092..472298) [3207 bp, 1068 aa] {ON}
           PDR1Zinc cluster protein that is a master regulator
           involved in recruiting other zinc cluster proteins to
           pleiotropic drug response elements (PDREs) to fine tune
           the regulation of multidrug resistance genes
          Length = 1068

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 40/85 (47%), Gaps = 10/85 (11%)

Query: 124 GLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKK 183
           GL P  G   ++   DT S     + ST  +G   +P          + S+ACD CR +K
Sbjct: 3   GLTPKNGVH-IETGPDTESSADSSNFSTGFSGKIRKP--------RSKVSKACDNCRKRK 53

Query: 184 IKCDLKRPQCSSCASVGFECKLSDK 208
           IKC+ K P C+SC     EC  S +
Sbjct: 54  IKCNGKFP-CASCEIYSCECTFSTR 77

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/35 (40%), Positives = 20/35 (57%)

Query: 617 RRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
           RR L+W  +Y +   + +LG P  I D +I C LP
Sbjct: 523 RRNLWWKAFYFEKTLASKLGYPSNIDDSKINCLLP 557

>ZYRO0E05676g Chr5 complement(439616..442816) [3201 bp, 1066 aa]
           {ON} some similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1066

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 49/98 (50%), Gaps = 17/98 (17%)

Query: 122 VTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGA----EPLLSSRPDAAG------- 170
           +T +  N G ++ +++   +   SR +SS  A GDG+    E    S   A+G       
Sbjct: 1   MTPMSENNGSENTRDVSAAMMK-SRSNSSEYAGGDGSFHASEVESQSSQGASGGNTSASK 59

Query: 171 ---RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFEC 203
              +AS+ACD+CR +KI+CD    +  C+SC   G  C
Sbjct: 60  RRTKASRACDQCRKRKIRCDYDDDKGVCTSCRKNGESC 97

>Suva_4.499 Chr4 complement(871565..872917) [1353 bp, 450 aa] {ON}
           YBR240C (REAL)
          Length = 450

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 162 LSSRPD-AAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKL 209
           LSS+P    GR    C  CR KK +CD  RP CS CA  G  C    +L
Sbjct: 14  LSSKPSPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDRCSYDIRL 62

>KLTH0E16500g Chr5 (1460844..1463345) [2502 bp, 833 aa] {ON} similar
           to uniprot|P05085 Saccharomyces cerevisiae YML099C ARG81
           Zinc-finger transcription factor of the Zn(2)-Cys(6)
           binuclear cluster domain type involved in the regulation
           of arginine-responsive genes acts with Arg80p and Arg82p
          Length = 833

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 8/56 (14%)

Query: 168 AAGRASQ--------ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           A G+A +         C  CR +K+KCDL +P C  C   G EC   D   R S P
Sbjct: 7   AGGKAKEVRRVKTFTGCWTCRSRKVKCDLGKPTCQRCDKSGLECGGYDIKLRWSQP 62

>CAGL0D02904g Chr4 complement(302952..305615) [2664 bp, 887 aa] {ON}
           similar to uniprot|P07272 Saccharomyces cerevisiae
           YLR014c PPR1 transcription factor regulating pyrimidine
           pathway
          Length = 887

 Score = 43.5 bits (101), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 25/60 (41%), Gaps = 4/60 (6%)

Query: 164 SRPDAAG----RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           S+P   G    +   AC  CR KK+KCD   P C  C      C   D +T    PR Y 
Sbjct: 9   SKPVPGGVKFTKFPNACKLCRRKKVKCDQGYPSCKGCLRNNVPCVSVDPVTGQDIPRSYV 68

>Skud_2.372 Chr2 complement(669194..670552) [1359 bp, 452 aa] {ON}
           YBR240C (REAL)
          Length = 452

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 23/49 (46%)

Query: 161 LLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKL 209
           L S  P   GR    C  CR KK +CD  RP CS CA  G  C    +L
Sbjct: 15  LSSKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>TBLA0G00510 Chr7 (104797..107604) [2808 bp, 935 aa] {ON} Anc_6.60
           YLR266C
          Length = 935

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 41/85 (48%), Gaps = 18/85 (21%)

Query: 137 LKDTLSPISRPSSSTTANGDGAEPLLSSRPDAAGRASQ-------------ACDRCRLKK 183
           L+ T + ISRPS+ TT N +       S+     RASQ              C  CR KK
Sbjct: 34  LETTSNTISRPST-TTGNCNLRN---GSQKHYRQRASQISGTRKKRKTIIKTCLFCREKK 89

Query: 184 IKCDLKRPQCSSCASVGF-ECKLSD 207
           +KCD +RP CSSC +  F EC   D
Sbjct: 90  LKCDKRRPLCSSCIARNFTECVYVD 114

>ZYRO0C18150g Chr3 (1418645..1420360) [1716 bp, 571 aa] {ON} some
           similarities with uniprot|P39529 Saccharomyces
           cerevisiae YJL206C
          Length = 571

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 24/38 (63%), Gaps = 1/38 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDK 208
           R S ACD CRLKK KCD ++P C  C +   EC  SD+
Sbjct: 23  RVSHACDNCRLKKKKCDGQQP-CKLCKNSENECIYSDR 59

 Score = 40.8 bits (94), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 541 YVLPKNSYFGVIT-TSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPS 599
           Y L   S   V   T + ++Q + ++  +   +G++ + Y   G+ +  A    LHR   
Sbjct: 170 YFLAAKSMLDVTNITDVYSIQTMFMLTMFLQCSGNLKRCYSYMGIALRAAIAEGLHR--K 227

Query: 600 AVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
           + L G       +E  +++ LFW +Y +D++ +  +G+P+ I    +   LP
Sbjct: 228 SSLMGPTP----IEDESKKRLFWTVYKVDIYMNCIMGLPQSISQKTVNMELP 275

>Kwal_34.15751 s34 (40148..42034) [1887 bp, 628 aa] {ON} [contig
           274] FULL
          Length = 628

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            R S  CD CR++K+KC+ ++P CS C     +C
Sbjct: 9   NRISHVCDACRIRKLKCNKQKPSCSRCVKHDLQC 42

>KLTH0E05786g Chr5 (517896..520349) [2454 bp, 817 aa] {ON} weakly
           similar to uniprot|P39961 Saccharomyces cerevisiae
           YER184C Hypothetical ORF
          Length = 817

 Score = 43.1 bits (100), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 158 AEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           A P ++ R     +  QAC  CR +K+KC+  RP CSSC + G EC
Sbjct: 33  ATPRVTKRAYTIRKTPQACISCRRRKVKCNGCRP-CSSCKTNGLEC 77

>Kwal_56.23308 s56 complement(485779..487092) [1314 bp, 438 aa]
           {OFF} YLR278C - Hypothetical ORF [contig 181] PARTIAL
          Length = 438

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 20/116 (17%)

Query: 543 LPKNSYF----------GVITTSIKTVQILSLILFYHLNTG-DIIQIYDLRGMIISMAQQ 591
           LP N YF          G   T I+ V++LSL+L Y + T  D   +Y++   ++S+   
Sbjct: 316 LPPNRYFSTAIRHITKCGGNLTYIQQVEVLSLLLLYIIRTDRDSSGLYEIIKDVMSI--- 372

Query: 592 LRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIE 647
                C + +     ++ D       R LFWCIY L+    + +G P  I + EI+
Sbjct: 373 -----CKNKLFLNKWNEQDMFANKKLR-LFWCIYSLERMICVAIGKPYTILESEID 422

 Score = 38.5 bits (88), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 34/65 (52%), Gaps = 8/65 (12%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC----KLSDKLT 210
           G  AE LL    D  GR S++C  C+ +K +CD K P C++C     +C    K   KL+
Sbjct: 24  GQDAELLLK---DKKGR-SRSCLLCQRRKRRCDHKMPSCTACLKAAVKCIQPAKYVGKLS 79

Query: 211 RNSFP 215
           R + P
Sbjct: 80  RANTP 84

>TBLA0F01200 Chr6 (295744..299004) [3261 bp, 1086 aa] {ON} Anc_3.109
           YOL089C
          Length = 1086

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 32/68 (47%), Gaps = 3/68 (4%)

Query: 144 ISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRP---QCSSCASVG 200
           I+ P    TA     E +      +  RA++AC+ CR +KIKCD   P   +CS+C    
Sbjct: 109 INSPQMKRTATSPQQEKIQQDTYYSKKRATRACESCRKRKIKCDPVDPITNKCSNCTKFH 168

Query: 201 FECKLSDK 208
             C   ++
Sbjct: 169 MICVFDNR 176

>Ecym_8159 Chr8 (330207..332933) [2727 bp, 908 aa] {ON} similar to
           Ashbya gossypii AAL175W
          Length = 908

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           + RP A  +    C  CR++K+KCDL +P C  C   G  C   D   R S P
Sbjct: 35  ARRPRA--KTFTGCWTCRIRKVKCDLGKPNCQRCEKSGLSCGGYDIKLRWSNP 85

>KAFR0B01450 Chr2 (273614..276880) [3267 bp, 1088 aa] {ON} Anc_2.547
           YKL038W
          Length = 1088

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCD--LKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           +AS+ACD+CR KK+KCD    R  C++C   G +C       +    +GY+
Sbjct: 58  KASRACDQCRKKKVKCDNGDDRSVCTNCQRNGEKCTFERVPLKRGPSKGYS 108

>NDAI0B02520 Chr2 complement(631209..633341) [2133 bp, 710 aa] {ON}
           Anc_8.283
          Length = 710

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/150 (26%), Positives = 62/150 (41%), Gaps = 14/150 (9%)

Query: 499 NIKIFGC---LLTVICQMGILIKYKNFKNKSPKFEKLLSYYHH-------LMYVLPKNSY 548
           N K + C   L+  I  +G   K  N K  S  F    SYY H        ++ L +N+ 
Sbjct: 233 NTKDYYCSEELIYAIAALGS--KISNSKTDSKLFSNSFSYYQHSKKIVLEKIFHLQRNNN 290

Query: 549 FGVITTSIK--TVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSG 606
               T+S K   +Q L  + FY +  G+    + L G+   +A ++ LH  P A      
Sbjct: 291 LDSSTSSSKLAIIQTLLCLSFYDIGNGENPMAWYLSGLAFRIAHEIGLHLNPKAWTHVYE 350

Query: 607 SKMDRLEQGNRRTLFWCIYYLDVFCSLQLG 636
            ++  L+   R  ++W  Y  D   S+  G
Sbjct: 351 DELTMLDIKVRSRIYWGCYIADHLISILFG 380

>Skud_15.64 Chr15 complement(109746..112844) [3099 bp, 1032 aa] {ON}
           YOL089C (REAL)
          Length = 1032

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%)

Query: 150 STTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQ---CSSCASVGFEC 203
           ST      +  L +S  ++  R S+ACD CR +KI+CD   PQ   CS+C      C
Sbjct: 110 STMVESTNSNDLGASGKNSKKRVSKACDHCRKRKIRCDEVDPQTDKCSNCVKFQSVC 166

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 28/115 (24%), Positives = 48/115 (41%), Gaps = 16/115 (13%)

Query: 533 LSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQL 592
           + YYH L            I +  +T+Q L L+  Y   T D      + G  I +A  +
Sbjct: 459 MYYYHKL----------STICSGTRTLQALLLLNRYFQVTYDTELANCILGTAIRLAVDM 508

Query: 593 RLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIE 647
            L+R        S   +D  E   RR+++W  +  D   SL L  P ++ + +++
Sbjct: 509 ELNR------KSSYKSLDFEEAIRRRSMWWHCFCTDKLYSLMLSRPPIVGEQDMD 557

>SAKL0C09944g Chr3 complement(899127..902312) [3186 bp, 1061 aa]
           {ON} weakly similar to uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 1061

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 171 RASQACDRCRLKKIKCDLKRP---QCSSCASVGFEC 203
           R S+ACD CR +KIKCD  +P   +CS+C     EC
Sbjct: 134 RVSKACDHCRKRKIKCDDVKPRTGKCSNCTKFNAEC 169

>TPHA0C02180 Chr3 complement(493972..496632) [2661 bp, 886 aa] {ON}
           Anc_8.423 YLR228C
          Length = 886

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 28/55 (50%), Gaps = 1/55 (1%)

Query: 149 SSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           SS T       PLL  R     ++   CD C+ +++KCD  +P C++C  +  +C
Sbjct: 28  SSNTDTNSTHTPLLGKR-KFHKKSKSGCDHCKRRRVKCDEAKPFCANCQHMKLDC 81

>TPHA0A06090 Chr1 complement(1372559..1375102) [2544 bp, 847 aa]
           {ON} 
          Length = 847

 Score = 43.1 bits (100), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 18/33 (54%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R +  C  CR KK+KCD K+P C  C   G  C
Sbjct: 9   RLNNGCWTCRTKKVKCDSKKPFCDKCKDSGLHC 41

>Kpol_1061.11 s1061 complement(31679..33880) [2202 bp, 733 aa] {ON}
           complement(31679..33880) [2202 nt, 734 aa]
          Length = 733

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 41/90 (45%), Gaps = 13/90 (14%)

Query: 127 PNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPLL-------SSRPDAAGR------AS 173
           PN G   L+ +   +  +S PS++ ++  D   P L       S+  D+ G       + 
Sbjct: 57  PNYGNLDLESVSSNIRYVSGPSTNASSPNDYIAPSLKPKTSVTSTIKDSKGNVVKRKYSR 116

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
             C  C+ +++KCD  +P C  C+ +  EC
Sbjct: 117 NGCAECKRRRMKCDETKPTCWQCSRLNREC 146

>NDAI0K00150 Chr11 complement(20792..23653) [2862 bp, 953 aa] {ON}
           Anc_8.879 YML099C
          Length = 953

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            C  CR +K+KCDL+RP CS C     +C
Sbjct: 11  GCWTCRSRKVKCDLRRPNCSRCERSELQC 39

>CAGL0F07909g Chr6 (776659..779808) [3150 bp, 1049 aa] {ON} some
           similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089c HAL9 or uniprot|P38114 Saccharomyces
           cerevisiae YBR150c TBS1
          Length = 1049

 Score = 43.1 bits (100), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 3/36 (8%)

Query: 171 RASQACDRCRLKKIKCDLKRP---QCSSCASVGFEC 203
           R+++ACD CR +KI+CD   P   +CS+C     EC
Sbjct: 36  RSTKACDHCRKRKIRCDEVNPVTNKCSNCVKFKVEC 71

>TBLA0C06230 Chr3 (1509702..1512089) [2388 bp, 795 aa] {ON} Anc_6.60
           YLR266C
          Length = 795

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 20/30 (66%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           +AC  CR +K+KCDL +P+C  C+S    C
Sbjct: 12  KACVFCRKRKLKCDLTKPKCKQCSSRNLNC 41

>AGL099C Chr7 complement(516587..518830) [2244 bp, 747 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR207C
           (UME6)
          Length = 747

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 168 AAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           A  R+   C  CRL+K KC  +RPQCS+C  +  EC
Sbjct: 672 AGTRSRTGCWICRLRKKKCSEERPQCSNCLRLNLEC 707

>YOR162C Chr15 complement(639560..641992) [2433 bp, 810 aa] {ON}
           YRR1Zn2-Cys6 zinc-finger transcription factor that
           activates genes involved in multidrug resistance;
           paralog of Yrm1p, acting on an overlapping set of target
           genes
          Length = 810

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 41/75 (54%), Gaps = 3/75 (4%)

Query: 141 LSPISRPSSSTT--ANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCAS 198
           ++P S  S+ST   ANG  +    S+      +  ++C  CR +K++CD ++P CS+C S
Sbjct: 17  VTPPSDNSNSTAGGANGSNSGTPTSTSGKKRNKLIKSCGFCRRRKLRCDQQKPMCSTCIS 76

Query: 199 VGF-ECKLSDKLTRN 212
                C+ +++  +N
Sbjct: 77  RNLTTCQYAEEFNKN 91

>TDEL0G03970 Chr7 (720080..723187) [3108 bp, 1035 aa] {ON} Anc_6.75
           YLR278C
          Length = 1035

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 30/49 (61%), Gaps = 4/49 (8%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           G+ AE LLS   D  GR S++C  CR +K +CD K+P C++C     +C
Sbjct: 24  GNNAEILLS---DKKGR-SRSCLLCRRRKQRCDRKQPSCTNCLKANVKC 68

 Score = 34.7 bits (78), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 64/161 (39%), Gaps = 34/161 (21%)

Query: 620 LFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSVV 679
           +FWC+Y L+    + +G P  I + EI   LP  SE    D  +  Q  G +SE      
Sbjct: 404 IFWCVYLLERMICVAVGRPFTISESEIN--LPFFSE----DSFNSGQ--GYISE------ 449

Query: 680 RCAKVLGN--ILDSIFKRNMSESITE--QVYTIHENALDSWRTKLPKKYQFKLNANGMVD 735
           +C K  G   I  S+  R +     E  Q+  +  N  ++ R +LP   +F        D
Sbjct: 450 QCHKRRGVHFINQSLKLRRIESQFVEHLQILPLRHNRKETLREQLPTVRKF------FHD 503

Query: 736 LEHL----------NHENLILVLLFFLVKSMIYMPLSSAIT 766
           LE            N EN  L L ++    ++  P    IT
Sbjct: 504 LEVWRSSCSRDDVRNFENETLKLYYYRSVRLLIQPYLEFIT 544

>KAFR0G02450 Chr7 (508147..511353) [3207 bp, 1068 aa] {ON} Anc_6.75
           YLR278C
          Length = 1068

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 28/49 (57%), Gaps = 4/49 (8%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           GD  + LL    D  GR S++C  CR +K +CD K P C++C   G +C
Sbjct: 24  GDRTDVLLQ---DKKGR-SKSCLLCRRRKQRCDHKLPSCTACLKAGVKC 68

>TBLA0E03480 Chr5 (865043..868183) [3141 bp, 1046 aa] {ON} Anc_3.109
           YOL089C
          Length = 1046

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 9/91 (9%)

Query: 126 LPNEGKKSLKELKDTLSP---ISRP---SSSTTANGDGAEPLLSSRPDAAGRASQACDRC 179
           +PN+ ++++  L + +SP   I+ P   SS   +N   +     S+     R  +AC  C
Sbjct: 107 VPNQNRQNISLLAEIVSPNNAITIPKLTSSEKNSNKPTSNDNFISQHPYKRRVVKACYNC 166

Query: 180 RLKKIKCDLKRP---QCSSCASVGFECKLSD 207
           R +KIKCD   P   +CS+C  +   C  S+
Sbjct: 167 RRRKIKCDAIDPSKNKCSNCLKLNKICSFSE 197

>Ecym_6141 Chr6 complement(258221..258565) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ACL195C
          Length = 114

 Score = 39.7 bits (91), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 24/35 (68%), Gaps = 3/35 (8%)

Query: 174 QACDRCRLKKIKCD--LKRPQ-CSSCASVGFECKL 205
           ++C RCR  K+KCD  ++RP+ CSSC   G  C+L
Sbjct: 34  RSCVRCRKNKVKCDSAIRRPKPCSSCLKKGVSCEL 68

>ZYRO0G21626g Chr7 complement(1781790..1783031) [1242 bp, 413 aa]
           {ON} weakly similar to uniprot|P38141 Saccharomyces
           cerevisiae YBR240C THI2 Zinc finger protein of the
           Zn(II)2Cys6 type probable transcriptional activator of
           thiamine biosynthetic genes
          Length = 413

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 22/41 (53%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLT 210
           GR    C  CRLKK +CD +RPQC+ CA     C    KL 
Sbjct: 8   GRTFTGCWACRLKKRRCDERRPQCTLCAKHNDSCCYDVKLV 48

>CAGL0F02519g Chr6 (245120..247618) [2499 bp, 832 aa] {ON} weakly
           similar to uniprot|P39529 Saccharomyces cerevisiae
           YJL206c
          Length = 832

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 72/176 (40%), Gaps = 19/176 (10%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQG 615
           I ++Q + ++  +   T  I   Y   G+ +    +   HR  S  L G    +D     
Sbjct: 330 IYSIQTIFMMTLFLQCTAKIKICYSYVGIAMRALVKNGFHRTTS--LIGPTPIIDE---- 383

Query: 616 NRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFS 675
            R+ LFW ++ +D++ +  +G+P  + D ++   LP   E  N  + DG+  +    +F 
Sbjct: 384 TRKRLFWSVFKVDMYLNCIMGIPFGLSDSDVNQDLPADVEDENI-REDGIIYKKC--QFG 440

Query: 676 LS----------VVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP 721
           LS          ++     +   L ++   N S S  E+     EN L  W   LP
Sbjct: 441 LSSAGANNQHTKLILIMSHICKALRNLHHSNYSLSAVEEKVKYFENELFGWYASLP 496

 Score = 34.7 bits (78), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S+ACD C+ +K KC    P C SC     +C
Sbjct: 31  RLSRACDLCKKRKTKCQGGNP-CQSCRKANIQC 62

>CAGL0F07865g Chr6 complement(768270..770804) [2535 bp, 844 aa] {ON}
           similar to uniprot|Q12151 Saccharomyces cerevisiae
           YDR213w UPC2
          Length = 844

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 19/33 (57%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C  +  EC
Sbjct: 49  KSKNGCDHCKRRRVKCDEGKPMCDKCVKMKLEC 81

>Suva_13.49 Chr13 complement(75704..78352) [2649 bp, 882 aa] {ON}
           YML099C (REAL)
          Length = 882

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 2/48 (4%)

Query: 170 GRASQ--ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           GRA     C  CR +K+KCDL+RP C  C      C   D   R S P
Sbjct: 13  GRAKTFTGCWTCRGRKVKCDLRRPHCQRCEKSNLPCGGYDIKLRWSKP 60

>KLLA0C18953g Chr3 (1682246..1684357) [2112 bp, 703 aa] {ON} some
           similarities with uniprot|P25502 Saccharomyces
           cerevisiae YKL015W PUT3 Positive regulator of PUT
           (proline utilization) genes zinc-finger transcription
           factor of the Zn(2)-Cys(6) binuclear cluster domain type
          Length = 703

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 50/209 (23%), Positives = 93/209 (44%), Gaps = 34/209 (16%)

Query: 559 VQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRR 618
           +Q    + ++ L+       Y + G  I +A  L +H+      T +  K +R+      
Sbjct: 310 IQAFLYVAYFGLSVDKSAFAYVMVGNAIRIAFTLGIHK------TSATPKNNRI------ 357

Query: 619 TLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGTMSEFSLSV 678
             FW  +  D   +++ G P LI  +EIE  +P  S   +TD +  + LE    E  +S+
Sbjct: 358 --FWLCFLYDRLLAIRFGFPLLI--NEIEIEIPSCSSF-DTDFL-SISLEKYHFEAQVSL 411

Query: 679 VRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNANGM----- 733
              AK+  NI+  I+ +N S  +      + E  L  W   LP + +F  N   +     
Sbjct: 412 ---AKITTNIIKRIYTKNSSSFVHNCHAVLKE--LKDWFDGLPSELKFDYNNFSLETSRP 466

Query: 734 -VDLEHLNHENLILV----LLFFLVKSMI 757
            V+L H+N+  LI++    ++F++   ++
Sbjct: 467 TVNL-HINYNYLIILTTRSVVFYVFNKLV 494

>KLLA0F25630g Chr6 (2378464..2381487) [3024 bp, 1007 aa] {ON} some
           similarities with uniprot|P32862 Saccharomyces
           cerevisiae YKL038W RGT1 Glucose-responsive transcription
           factor that regulates expression of several glucose
           transporter (HXT) genes in response to glucose binds to
           promoters and acts both as a transcriptional activator
           and repressor
          Length = 1007

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 52/125 (41%), Gaps = 20/125 (16%)

Query: 102 AASITTSDAAGGTENTVREEVTGLLPNEGKKSLKELKDTLSPISRPSSSTTANGDGAEPL 161
           AA+ITTS       + V E  T    N G  ++ E  +T     R S S+  +    E  
Sbjct: 56  AATITTSKQ---DPSAVDEATTPRSINTGASTVPEPDNT----RRDSVSSNVSTATTESR 108

Query: 162 LSSRPDAAGRASQACDRCRLKKIKCDLKRPQ-------CSSCASVGFECKLSDKLTRNSF 214
             S+       S+ACD+CR KKIKCD            C+ C  +G +C       +   
Sbjct: 109 RRSK------VSRACDQCRKKKIKCDFIEGHDINPDQSCTGCRKIGEKCSFERIPLKRGP 162

Query: 215 PRGYT 219
            +GYT
Sbjct: 163 SKGYT 167

>KLTH0B09746g Chr2 complement(801412..803589) [2178 bp, 725 aa] {ON}
           some similarities with uniprot|Q12180 Saccharomyces
           cerevisiae YOL089C HAL9 Putative transcription factor
           containing a zinc finger overexpression increases salt
           tolerance through increased expression of the ENA1 (Na
           /Li extrusion pump) gene while gene disruption decreases
           both salt tolerance and ENA1 expression
          Length = 725

 Score = 42.7 bits (99), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 56/117 (47%), Gaps = 15/117 (12%)

Query: 535 YYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRL 594
           +Y+H + ++P+          I T+Q +  +L Y   TG +   Y +  + I +AQ L L
Sbjct: 292 FYYHQVSIMPEG---------ILTLQAMLALLAYTDFTGALHASYIMVTLAIRLAQDLGL 342

Query: 595 HRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
           H    A +T  G  +D  E   RR ++    Y D+  S+ LG P ++ +++   + P
Sbjct: 343 H----AEITYEG--LDIAEDEKRRKMWGLCRYFDLKLSMILGRPPVVANYDTTTSFP 393

>Kpol_538.52 s538 (126243..128966) [2724 bp, 907 aa] {ON}
           (126243..128966) [2724 nt, 908 aa]
          Length = 907

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 21/34 (61%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECK 204
           ++   C  CR +K+KCDL RP+C  C  +G  C+
Sbjct: 12  KSFNGCWTCRSRKVKCDLNRPKCQRCDRLGIICE 45

>Smik_16.20 Chr16 complement(26236..27657) [1422 bp, 473 aa] {ON}
           YGR288W (REAL)
          Length = 473

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           QACD CR++++KCD KRP CSSC      C
Sbjct: 11  QACDCCRVRRVKCDSKRP-CSSCLQNNLSC 39

>TBLA0A01210 Chr1 (276151..280419) [4269 bp, 1422 aa] {ON} Anc_1.380
           YLR256W
          Length = 1422

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 1/39 (2%)

Query: 163 SSRPDAA-GRASQACDRCRLKKIKCDLKRPQCSSCASVG 200
           SS+P     R   +C  CR +K+KCD KRP C+ C   G
Sbjct: 104 SSKPKRKRNRIPLSCTICRKRKVKCDKKRPHCNQCTKTG 142

>CAGL0A00451g Chr1 (47557..50880) [3324 bp, 1107 aa] {ON} similar to
           uniprot|P12383 Saccharomyces cerevisiae YGL013c PDR1
           transcription factor
          Length = 1107

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 2/43 (4%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSD-KLTRN 212
           +  +ACD CR +KIKC+  +P C SC   G EC  +D K T+N
Sbjct: 26  KVGKACDSCRRRKIKCNGLKP-CPSCTIYGCECTYTDAKSTKN 67

>Kwal_27.9688 s27 complement(21328..23853) [2526 bp, 841 aa] {ON}
           YML099C (ARG81) - zinc-finger transcription factor of
           the Zn(2)-Cys(6) binuclear cluster domain type [contig
           336] FULL
          Length = 841

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            C  CR +K+KCDL +P C  C   G EC
Sbjct: 22  GCWTCRSRKVKCDLGKPNCQRCEKSGLEC 50

>TBLA0A00730 Chr1 (156043..159156) [3114 bp, 1037 aa] {ON} Anc_2.654
           YKL015W
          Length = 1037

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 54/121 (44%), Gaps = 1/121 (0%)

Query: 609 MDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLE 668
           + R E  +RR L+W +Y  +   S + G+P    D+ I   LP +      + +      
Sbjct: 631 LSRCEVEHRRRLWWTVYMFERMLSSKAGLPLSFTDNTISTELPSNINCAQDNDILAKYYY 690

Query: 669 GTMSEFSLSVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKL 728
              + +    V+  ++ G IL  +++R  S +I   +  I +  L+ W++ +P+  Q   
Sbjct: 691 YVEAAYIGESVKIVQINGQILSKLYQRQPSSNILPILKDILKQLLN-WKSNVPESLQVDF 749

Query: 729 N 729
           N
Sbjct: 750 N 750

>TPHA0N00230 Chr14 (39855..43553) [3699 bp, 1232 aa] {ON} Anc_7.17
           YOR363C
          Length = 1232

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 18/34 (52%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            R S  C  CR  K KCD K+P C+ C   G +C
Sbjct: 46  NRISFVCQHCRKSKTKCDKKQPHCARCIKHGIQC 79

>SAKL0B10538g Chr2 (910662..912767) [2106 bp, 701 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337W TEA1
           Mutants are defective in Ty1 Enhancer- mediated
           Activation Ty1 enhancer activator and to YLR098C
           uniprot|P43634 Saccharomyces cerevisiae YLR098C CHA4
           Zinc- finger protein with Zn[2]-Cys[6] fungal-type
           binuclear cluster domain DNA-binding transcriptional
           activator or CHA1
          Length = 701

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 37/83 (44%), Gaps = 13/83 (15%)

Query: 145 SRPSSSTTANGDGAEPLLSSRPDAAG-------RASQACDRCRLKKIKCDLKRPQCSSCA 197
           S  SSS        EP     PD A        R   AC  CR ++ KCDL  P CSSC 
Sbjct: 21  SGESSSKRQRDTSEEPF----PDPADKQIKMGERKRLACSNCRRRRKKCDLNYP-CSSCV 75

Query: 198 SVGFECKLSDK-LTRNSFPRGYT 219
            +  +C ++++ L +  +  GY 
Sbjct: 76  RLRLQCNVNEEDLRKKRYSTGYV 98

>CAGL0E05434g Chr5 (532814..535264) [2451 bp, 816 aa] {ON} similar
           to uniprot|P47988 Saccharomyces cerevisiae YOR337w TEA1
           TY1 enhancer activator
          Length = 816

 Score = 42.4 bits (98), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 11/65 (16%)

Query: 147 PSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLS 206
           PS  ++AN       ++SRP    +   AC  CR ++ KCDL+ P C +C  +G EC ++
Sbjct: 57  PSRESSAN-------VTSRP---TKKRLACSNCRRRRKKCDLQYP-CFTCDKLGLECNIN 105

Query: 207 DKLTR 211
           ++  R
Sbjct: 106 EEDLR 110

 Score = 36.6 bits (83), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 2/83 (2%)

Query: 556 IKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSA--VLTGSGSKMDRLE 613
           I TVQ L  + FY L  G++   +   G+ I +   +     P    V   +  K+ + E
Sbjct: 388 ITTVQALFCLAFYELGKGNMQMAWYFSGLAIRVGYAMGFQLDPKVWHVDDDTDEKLTQSE 447

Query: 614 QGNRRTLFWCIYYLDVFCSLQLG 636
              R  ++W  Y  D F  L LG
Sbjct: 448 LEIRSRIYWGCYIADHFICLMLG 470

>Ecym_3112 Chr3 (203876..207310) [3435 bp, 1144 aa] {ON} similar to
           Ashbya gossypii AGR280C
          Length = 1144

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 58/118 (49%), Gaps = 14/118 (11%)

Query: 550 GVITTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQ-QLRLHRCPSAVLTGSGSK 608
           G   +  + ++IL+L++FY +        YD+   +I++++ +L LH+  S+        
Sbjct: 385 GTALSLFQQLEILTLLVFYVIRRDKDSVGYDIIKDVINISKNKLYLHKRTSS-------- 436

Query: 609 MDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQ 666
            D      +  LFW +Y L+    + +G P  I + EIE  LP+ SE   T K DG +
Sbjct: 437 -DNFASRKKLRLFWSVYLLERMICVSIGKPYTISESEIE--LPIFSET--TVKADGSE 489

 Score = 38.5 bits (88), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           D  GR S++C  C+ +K KCD K P C++C   G  C
Sbjct: 33  DKKGR-SRSCLLCQRRKQKCDHKIPSCTACLKAGVRC 68

>CAGL0I07755g Chr9 complement(745585..748746) [3162 bp, 1053 aa]
           {ON} similar to uniprot|Q12180 Saccharomyces cerevisiae
           YOL089c HAL9
          Length = 1053

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 24/36 (66%), Gaps = 3/36 (8%)

Query: 171 RASQACDRCRLKKIKCDLKRP---QCSSCASVGFEC 203
           RA++AC+ CR +K KCD   P   +CS+C+  G +C
Sbjct: 173 RAAKACEYCRKRKTKCDEVSPYTNKCSNCSKAGVDC 208

>Smik_2.383 Chr2 complement(686676..688022) [1347 bp, 448 aa] {ON}
           YBR240C (REAL)
          Length = 448

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 22/47 (46%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKL 209
           S  P   GR    C  CR KK +CD  RP CS CA  G  C    +L
Sbjct: 17  SKAPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>KLLA0A04169g Chr1 complement(376273..378600) [2328 bp, 775 aa] {ON}
           similar to uniprot|Q05958 Saccharomyces cerevisiae
           YLR228C ECM22 Sterol regulatory element binding protein
           regulates transcription of the sterol biosynthetic genes
           ERG2 and ERG3 member of the fungus-specific Zn[2]-Cys[6]
           binuclear cluster family of transcription factors
           homologous to Upc2p
          Length = 775

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  RP C +C  +  +C
Sbjct: 52  KSKNGCDHCKRRRVKCDETRPHCLNCKKMSLDC 84

>KNAG0A02550 Chr1 complement(262867..265059) [2193 bp, 730 aa] {ON}
           Anc_8.423 YLR228C
          Length = 730

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 21/33 (63%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  CA++  EC
Sbjct: 29  KSKNGCDNCKRRRVKCDEGKPFCQKCANMRLEC 61

>KLLA0D00484g Chr4 (44879..47893) [3015 bp, 1004 aa] {ON} conserved
           hypothetical protein
          Length = 1004

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 151 TTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLT 210
           TT     +E  LS++   +  + + C +C+    KCD ++P+CS C     +C   ++  
Sbjct: 46  TTTGDSSSEEKLSTKKRKSTYSRKGCLQCKKAHTKCDERKPKCSRCEKRSIDCTYRNQFV 105

Query: 211 --RNSFP 215
             +N FP
Sbjct: 106 FQKNEFP 112

>SAKL0H00682g Chr8 complement(81989..84757) [2769 bp, 922 aa] {ON}
           weakly similar to uniprot|P39720 Saccharomyces
           cerevisiae YAL051W OAF1 Oleate-activated transcription
           factor acts alone and as a heterodimer with Pip2p
           activates genes involved in beta-oxidation of fatty
           acids and peroxisome organization and biogenesis
          Length = 922

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (55%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            R S  C  CR +KIKCD +RP C  CA  G  C
Sbjct: 19  NRLSFVCLECRRRKIKCDKQRPCCIQCAEQGLTC 52

>YDR213W Chr4 (889751..892492) [2742 bp, 913 aa] {ON}  UPC2Sterol
           regulatory element binding protein, induces
           transcription of sterol biosynthetic genes and of
           DAN/TIR gene products; Ecm22p homolog; relocates from
           intracellular membranes to perinuclear foci on sterol
           depletion
          Length = 913

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 11/34 (32%), Positives = 21/34 (61%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECK 204
           ++   CD C+ +++KCD  +P C  C ++  EC+
Sbjct: 46  KSKNGCDNCKRRRVKCDEGKPACRKCTNMKLECQ 79

>TPHA0L02050 Chr12 complement(423921..426563) [2643 bp, 880 aa] {ON}
           Anc_2.654 YKL015W
          Length = 880

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 47/227 (20%), Positives = 88/227 (38%), Gaps = 28/227 (12%)

Query: 516 LIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLILFYHLNTGDI 575
           L  YK F+     F+K+ S           N+   ++T+    ++ + L  FY       
Sbjct: 289 LKNYKFFEQSISLFDKIFSL----------NNIDAILTSDSNGIEAMFLYCFYLQVIDST 338

Query: 576 IQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCSLQL 635
           I  Y   G  +     L  H      +    + ++  E  ++R L+W IY  +   S + 
Sbjct: 339 INSYLCLGQTVRACLLLGWH------VESQSNNLNPFEMEHKRRLWWTIYIFERMFSSKA 392

Query: 636 GVPRLIKDHEIECALPLSSEIHNT--------DKMDGVQLEGTMSEFSLSVVRCAKVL-- 685
           G+P  + D+ I   LP +    N+         +++           + S+  C K++  
Sbjct: 393 GLPLNLSDNNISTVLPSNHFFENSTVNSPNNQTELNNKNNNNFKFSSATSLTNCVKIVQI 452

Query: 686 -GNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPKKYQFKLNAN 731
            G IL  ++ +  + +I   +  I  N L  WR+ LP   QF  + +
Sbjct: 453 NGKILSKLYHKQPTSNILPILKGI-LNDLLQWRSSLPLCLQFDFHVH 498

>CAGL0L04400g Chr12 complement(513759..516722) [2964 bp, 987 aa]
           {ON} similar to uniprot|Q12340 Saccharomyces cerevisiae
           YOR172w
          Length = 987

 Score = 42.4 bits (98), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 165 RPDAAGRASQACDRCRLKKIKCDLKRPQCSSCA 197
           RP    +  ++C  CR +K+KCD ++P+CSSCA
Sbjct: 26  RPKKRFKPLKSCAFCRKRKLKCDKQKPRCSSCA 58

>SAKL0A00704g Chr1 complement(78811..80967) [2157 bp, 718 aa] {ON}
           similar to uniprot|P35995 Saccharomyces cerevisiae
           YKL222C Hypothetical ORF and similar to uniprot|Q12340
           Saccharomyces cerevisiae YOR172W
          Length = 718

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGF-ECKLSDKLTRNSFP 215
           ++C  CR +K+KCD K+P+CS+CA+    EC   +K T    P
Sbjct: 17  KSCLFCRKRKLKCDHKKPKCSTCAARNLPECVYVEKFTHEIDP 59

>TBLA0B04800 Chr2 complement(1127000..1129333) [2334 bp, 777 aa]
           {ON} 
          Length = 777

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 19/27 (70%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSC 196
            R S+ C+ CR++K+KCD +RP C  C
Sbjct: 9   SRISRVCNSCRIQKLKCDRERPSCKRC 35

>YML099C Chr13 complement(74398..77040) [2643 bp, 880 aa] {ON}
           ARG81Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type, involved in
           the regulation of arginine-responsive genes; acts with
           Arg80p and Arg82p
          Length = 880

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 23/52 (44%), Gaps = 2/52 (3%)

Query: 166 PDAAGRASQ--ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
           P   GRA     C  CR +K+KCDL+ P C  C      C   D   R S P
Sbjct: 9   PKKMGRAKTFTGCWTCRGRKVKCDLRHPHCQRCEKSNLPCGGYDIKLRWSKP 60

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 42.0 bits (97), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC-KLSDKLTRNS 213
           +A +AC  CR KK KCD  RPQC  C     EC  L +K  +NS
Sbjct: 11  KAIKACLNCRRKKQKCDQARPQCYQCRIRKTECVYLGEKADKNS 54

>Smik_4.460 Chr4 (833609..836365) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C ++  EC
Sbjct: 46  KSKNGCDNCKRRRVKCDEGKPACKKCTNMKLEC 78

>NDAI0D02730 Chr4 (629970..633647) [3678 bp, 1225 aa] {ON} Anc_6.75
           YLR278C
          Length = 1225

 Score = 42.4 bits (98), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 27/49 (55%), Gaps = 4/49 (8%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           GD  + LL    D  GR S++C  CR +K KCD K P C++C     +C
Sbjct: 24  GDNPDALLQ---DKKGR-SRSCLLCRRRKQKCDHKLPSCTACLKAAVKC 68

 Score = 33.5 bits (75), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 574 DIIQIYDLRGMIISMAQ-QLRLHRCPSAVLTGSGSKMDRLEQGNRRTLFWCIYYLDVFCS 632
           D + +Y++ G ++ + Q  L+L+R             D +    +  +FWC+Y L+    
Sbjct: 432 DSMVLYEIIGDVMKICQLDLKLNR--------RNDHDDTVLANKKLRIFWCVYLLERMIC 483

Query: 633 LQLGVPRLIKDHEIECALPLSSE 655
           + +G   +IK+ +I+  LPL  E
Sbjct: 484 VAVGKSYIIKESDID--LPLFDE 504

>Skud_15.326 Chr15 complement(588275..590731) [2457 bp, 818 aa] {ON}
           YOR162C (REAL)
          Length = 818

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 154 NGDG------AEPLLSSRPDAAGRAS----QACDRCRLKKIKCDLKRPQCSSCASVGF-E 202
           NGDG      A   +++    +GR      ++C  CR +K++CD ++P CS+C S     
Sbjct: 23  NGDGKSGGASASGTVTASASGSGRKRNKLIKSCGFCRRRKLRCDQRKPMCSTCISRNLTT 82

Query: 203 CKLSDKLTRN 212
           C+ +++  +N
Sbjct: 83  CQYAEEFNKN 92

>YBR297W Chr2 (800523..801929) [1407 bp, 468 aa] {ON}
           MAL33MAL-activator protein, part of complex locus MAL3;
           nonfunctional in genomic reference strain S288C
          Length = 468

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 26/44 (59%), Gaps = 2/44 (4%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKL-TRNSFPRG 217
           ACD CR++++KCD K+P CS C    F+C     L  R S P G
Sbjct: 7   ACDYCRVRRVKCDGKKP-CSRCIEHNFDCTYQQPLKKRGSKPIG 49

>KAFR0I00230 Chr9 (48095..51232) [3138 bp, 1045 aa] {ON} Anc_7.17
           YOR363C
          Length = 1045

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 24/51 (47%)

Query: 153 ANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           +N D    L ++      R S  C  CR  K KCD ++P+CS CA     C
Sbjct: 6   SNDDLLLALRANEIKTRNRISLVCQACRKSKTKCDREKPRCSRCAKNNLRC 56

>Kwal_26.8109 s26 complement(650270..653182) [2913 bp, 970 aa] {ON}
           YKL038W (RGT1) - 1:1 [contig 55] FULL
          Length = 970

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)

Query: 171 RASQACDRCRLKKIKCDL--KRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           + S+ACD+CR KK +CD   + P C+SC  +   C       +    +GYT
Sbjct: 34  KTSRACDQCRGKKTRCDFSDENPVCTSCQRMSKTCTFERVPMKRGPTKGYT 84

>KNAG0E00450 Chr5 complement(74721..76853) [2133 bp, 710 aa] {ON}
           Anc_7.56 YOR337W
          Length = 710

 Score = 42.0 bits (97), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 41/179 (22%), Positives = 74/179 (41%), Gaps = 12/179 (6%)

Query: 553 TTSIKTVQILSLILFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLT-----GSGS 607
            TSI TVQ L  + FY L  G+    +   G+ I +  ++     P    T     G G 
Sbjct: 381 VTSITTVQALLCLAFYELGKGNNQLAWYFSGLAIRVGYEMGFQLDPEVWYTDADDNGKG- 439

Query: 608 KMDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQ- 666
           K+ + E   R  ++W  Y  D F  L LG  R          +P S E+   +  +  + 
Sbjct: 440 KLTKSELEIRSRIYWGCYIADHFICLMLG--RTSTLSVSNSTIPASDELPEVEGTEEFRF 497

Query: 667 LEGTMSEFSL---SVVRCAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLPK 722
           + G + + +L   +++  ++++   +  IF  +   +   +      N + SWR  LP+
Sbjct: 498 IGGHVLQVALPLKNLIILSRIVQIFISKIFIESQDNTARLEYLATFNNQVYSWRQSLPE 556

 Score = 40.0 bits (92), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 154 NGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLS-DKLTRN 212
           +G+   P+L       G+   +C  CR ++ KCDL  P C +C  +  EC ++ D L + 
Sbjct: 22  DGERRTPVLG----PTGKKRLSCSNCRKRRKKCDLGFP-CGNCTRLEIECNVNEDDLRKK 76

Query: 213 SFPRGYT 219
            +  GY 
Sbjct: 77  RYTSGYV 83

>YBR240C Chr2 complement(700490..701842) [1353 bp, 450 aa] {ON}
           THI2Transcriptional activator of thiamine biosynthetic
           genes; interacts with regulatory factor Thi3p to control
           expression of thiamine biosynthetic genes with respect
           to thiamine availability; acts together with Pdc2p to
           respond to thiaminediphosphate demand, possibly as
           related to carbon source availability; zinc finger
           protein of the Zn(II)2Cys6 type
          Length = 450

 Score = 41.6 bits (96), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 22/47 (46%)

Query: 163 SSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKL 209
           S  P   GR    C  CR KK +CD  RP CS CA  G  C    +L
Sbjct: 17  SKVPPTKGRTFTGCWACRFKKRRCDENRPICSLCAKHGDNCSYDIRL 63

>KNAG0K00820 Chr11 complement(153470..156622) [3153 bp, 1050 aa]
           {ON} Anc_3.109 YOL089C
          Length = 1050

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 10/70 (14%)

Query: 142 SPISRPSSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKC---DLKRPQCSSCAS 198
           SP+     S+++NG    P       A  R S ACD CR +KIKC   +    +CS C  
Sbjct: 121 SPLGNFQYSSSSNGASVIP-------AKKRVSMACDHCRKRKIKCGPINTVENKCSHCIK 173

Query: 199 VGFECKLSDK 208
              EC    +
Sbjct: 174 YNAECTFQHR 183

>Suva_2.381 Chr2 (669136..671892) [2757 bp, 918 aa] {ON} YDR213W
           (REAL)
          Length = 918

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C ++  EC
Sbjct: 46  KSKNGCDNCKRRRVKCDEGKPACKKCTNMKLEC 78

>Skud_4.475 Chr4 (844018..846759) [2742 bp, 913 aa] {ON} YDR213W
           (REAL)
          Length = 913

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C ++  EC
Sbjct: 46  KSKNGCDNCKRRRVKCDEGKPACKKCTNMKLEC 78

>ZYRO0C00726g Chr3 (53977..57084) [3108 bp, 1035 aa] {ON} similar to
           uniprot|P39720 Saccharomyces cerevisiae YAL051W OAF1
           Oleate-activated transcription factor acts alone and as
           a heterodimer with Pip2p activates genes involved in
           beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1035

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 61/148 (41%), Gaps = 13/148 (8%)

Query: 148 SSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSD 207
           SSS   + +G E   S+      R S  C  CR  K KCD ++P+C  C   G  C    
Sbjct: 35  SSSQDGSQNGDE---SNSIKKRNRISFVCKACRRSKTKCDREKPKCGRCVQHGIACVYD- 90

Query: 208 KLTRNSFPRGYTXXXXXXXXXXXXXXXXXXAMNDLK-EQQLFKIPEDIQSVVDVDAELNS 266
            + + + PR  +                  A+  ++ E+++ K     +S  ++D   ++
Sbjct: 91  -VEKQAAPRNPSKDATIARLERDVEYWRQKAVKLMQDEEEMTK-----RSERNIDGRDDA 144

Query: 267 SNQTKNMYATHVCDGICCQDTKLHSRPV 294
           S +T     +H   G+   ++ LH  P+
Sbjct: 145 SPRTLKRTVSH--SGVSIGNSDLHETPI 170

>AGR280C Chr7 complement(1266912..1270232) [3321 bp, 1106 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR278C
          Length = 1106

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 55/104 (52%), Gaps = 15/104 (14%)

Query: 554 TSIKTVQILSLILFYHLNTG-DIIQIYDLRGMIISMAQ-QLRLHRCPSAVLTGSGSKMDR 611
           T ++ V++L+L++FY +    D   +Y++   ++++ + +L LH+       G+  +  R
Sbjct: 369 TPVQEVELLTLLVFYTIRIDRDSAALYEIIEDVVAICKNKLNLHQ---HTPYGNSDRKFR 425

Query: 612 LEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSE 655
           L        FWC+Y L+    + +G P +IK+ EI   LPL  E
Sbjct: 426 L--------FWCVYLLERMICVAVGKPYVIKESEI--GLPLFQE 459

 Score = 36.6 bits (83), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 167 DAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           D  GR S++C  C+ +K +CD K P C++C   G  C
Sbjct: 33  DKKGR-SRSCLLCQRRKQRCDHKIPSCTACLKAGVRC 68

>NCAS0A03070 Chr1 (603639..605609) [1971 bp, 656 aa] {ON} 
          Length = 656

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R +  C  CR +K++C+ +RP CS C  +G  C
Sbjct: 10  RPTHVCAACRTQKLRCNRERPSCSRCQRIGRTC 42

>TDEL0E00300 Chr5 (64461..66374) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 21/34 (61%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           GR++  C  CR ++ KCD +RP C +CA    EC
Sbjct: 17  GRSNTGCLSCRRRRKKCDERRPSCKACARNFLEC 50

>ZYRO0E06270g Chr5 (475960..478698) [2739 bp, 912 aa] {ON} weakly
           similar to uniprot|P50104 Saccharomyces cerevisiae
           YMR019W STB4 Protein that binds Sin3p in a two- hybrid
           assay
          Length = 912

 Score = 42.0 bits (97), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           R  +AC+ C+ +K+KCD  +P C++C   G ECK      R  + R
Sbjct: 12  RVRKACEICKRRKVKCDGSQP-CANCVKHGQECKYISGTVRRRYRR 56

>Smik_1.13 Chr1 (31514..34654) [3141 bp, 1046 aa] {ON} YAL051W
           (REAL)
          Length = 1046

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S  C  CR  K KCD ++P+CS C   G +C
Sbjct: 61  RISFVCQACRKSKTKCDREKPECSRCIKHGLKC 93

>SAKL0B01870g Chr2 (185897..188926) [3030 bp, 1009 aa] {ON} weakly
           similar to uniprot|P39720 Saccharomyces cerevisiae
           YAL051W OAF1 Oleate-activated transcription factor acts
           alone and as a heterodimer with Pip2p activates genes
           involved in beta-oxidation of fatty acids and peroxisome
           organization and biogenesis
          Length = 1009

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 22/34 (64%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECK 204
           + S AC+ C +KKIKCD   P C++C   G +CK
Sbjct: 71  KVSPACEACNVKKIKCDRGFPVCNTCLKRGTQCK 104

>NCAS0I00270 Chr9 complement(33129..35963) [2835 bp, 944 aa] {ON}
           Anc_7.17 YAL051W
          Length = 944

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 24/47 (51%), Gaps = 2/47 (4%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRG 217
           R S  C  CR  K+KCD ++P CS C+    EC     +T+   PR 
Sbjct: 35  RLSFVCQGCRRSKVKCDQEKPVCSRCSKHDLECVYD--VTKQHAPRN 79

>NDAI0E03460 Chr5 (742144..744993) [2850 bp, 949 aa] {ON} Anc_8.423
          Length = 949

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 14/49 (28%), Positives = 24/49 (48%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGYT 219
           ++   CD C+ +++KCD  +P C  C ++   C  +    R S  R  T
Sbjct: 59  KSKNGCDNCKRRRVKCDESKPHCQKCVNMQLHCVYTPPQPRRSKGRNDT 107

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 856

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 21/41 (51%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFP 215
            C  CR +K+KCDL+RP C  C   G  C   D   R + P
Sbjct: 13  GCWTCRSRKVKCDLRRPGCERCEKGGLICGGYDVKLRWTRP 53

>TDEL0A02690 Chr1 (485785..487953) [2169 bp, 722 aa] {ON} 
          Length = 722

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGF-ECKLSDKLTRNS 213
           +A ++C  CR +K++CD K+P+CS+C +    EC  S  L  N+
Sbjct: 8   KAIKSCAFCRRRKLRCDQKKPRCSTCVARNLAECVYSQGLQHNA 51

>Kpol_1061.19 s1061 (51386..54709) [3324 bp, 1107 aa] {ON}
            (51386..54709) [3324 nt, 1108 aa]
          Length = 1107

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 2/56 (3%)

Query: 148  SSSTTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
            S+S T   D  +P    +P+   R+   C  CRL+K KC  ++P C +C  +  EC
Sbjct: 1013 SASETEGKD--KPKTEKKPNIGTRSRNGCWICRLRKKKCTEEKPNCYNCERLNLEC 1066

>TPHA0L01060 Chr12 (220857..223778) [2922 bp, 973 aa] {ON} Anc_8.423
           YLR228C
          Length = 973

 Score = 42.0 bits (97), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 10/33 (30%), Positives = 21/33 (63%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C+++  +C
Sbjct: 47  KSKNGCDNCKRRRVKCDEAKPACVKCSNMKLDC 79

>AFL160C Chr6 complement(130842..132788) [1947 bp, 648 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL248C
           (GAL4)
          Length = 648

 Score = 41.6 bits (96), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 24/45 (53%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPRGY 218
           QACD CR +K+KC    P+C+ C      C  S K+ R+   R +
Sbjct: 7   QACDSCRRRKMKCSKTFPKCAKCREDNRVCLYSPKIRRSPLTRAH 51

>TDEL0B06360 Chr2 complement(1127150..1130095) [2946 bp, 981 aa]
           {ON} Anc_2.547 YKL038W
          Length = 981

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 171 RASQACDRCRLKKIKCDLKRPQ--CSSCASVGFECKLSDKLTRNSFPRGY 218
           +AS+ACD+CR +KIKCD    +  C+SC+     C       +    +GY
Sbjct: 44  KASRACDQCRKRKIKCDFSEEKGICTSCSKNADRCAFDRVPLKRGPSKGY 93

>TBLA0G00490 Chr7 (99344..102100) [2757 bp, 918 aa] {ON} 
          Length = 918

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 28/48 (58%), Gaps = 3/48 (6%)

Query: 165 RPDAAGRAS--QACDRCRLKKIKCDLKRPQCSSCASVGF-ECKLSDKL 209
           +P    R S  ++C  CR +K+KCD  +P CS+C +  F EC  SD +
Sbjct: 22  KPPRKKRRSTIKSCSFCRRRKLKCDKSKPLCSTCRARNFTECIYSDAI 69

>NCAS0C02730 Chr3 (513280..515607) [2328 bp, 775 aa] {ON} Anc_8.423
          Length = 775

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C ++  EC
Sbjct: 53  KSKNGCDNCKRRRVKCDELKPTCQKCINMNLEC 85

>KAFR0G02520 Chr7 complement(522206..524722) [2517 bp, 838 aa] {ON}
           Anc_6.61 YOR172W
          Length = 838

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 174 QACDRCRLKKIKCDLKRPQCSSCASVGFE-CKLSDKLTRNSFPR 216
           ++C  CR +K+KCD K+P CS+C S  F+ C   D    N   R
Sbjct: 30  KSCSFCRKRKLKCDQKKPICSNCLSRKFDSCLYPDSFLNNDVSR 73

>NDAI0I01940 Chr9 (450330..454112) [3783 bp, 1260 aa] {ON} Anc_6.75
          Length = 1260

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 4/49 (8%)

Query: 155 GDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           GD  + LL    D  GR S AC  CR +K KCD   P C++C   G +C
Sbjct: 24  GDNVDILLK---DKRGR-STACLLCRRRKQKCDHMLPSCTACLKAGVKC 68

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 51/101 (50%), Gaps = 12/101 (11%)

Query: 556 IKTVQILSLILFYHLNTG-DIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSKMDRLEQ 614
           ++ V++L+L++ Y + T  D + +Y++   ++ +        C + +   + +  D    
Sbjct: 497 VQKVEVLTLLILYIVRTDRDSLVLYEIIKDVMDI--------CQNKLSLNTWNPQDPFA- 547

Query: 615 GNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALPLSSE 655
             R  LFWC+Y L+    + +G P  IK+ +I   LPL +E
Sbjct: 548 NKRLRLFWCVYLLERMICVAVGKPYTIKESDIN--LPLFNE 586

>Kwal_26.7095 s26 (211883..214399) [2517 bp, 838 aa] {ON} YOR363C
           (PIP2) - activator of peroxisome proliferation [contig
           46] FULL
          Length = 838

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 19/33 (57%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S  C  C+ +KIKCD  RP C  C+ +  EC
Sbjct: 25  RQSFVCRNCKKRKIKCDKARPSCGRCSKLELEC 57

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 2/46 (4%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNSFPR 216
           R S  C  CR  K+KCD ++P+C+ C   G +C   ++  R   PR
Sbjct: 45  RISFVCQNCRKSKMKCDREKPECTRCLKQGIKCVYDEE--RQPRPR 88

>TPHA0N00440 Chr14 complement(82249..84522) [2274 bp, 757 aa] {ON}
           Anc_7.56 YOR337W
          Length = 757

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTRNS 213
           G+   AC  CR ++ KCD++ P C  C+ +G EC ++++  R +
Sbjct: 45  GKRRLACSNCRKRRKKCDVEYP-CGGCSRLGLECNINEEDLRKT 87

 Score = 38.1 bits (87), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 48/221 (21%), Positives = 84/221 (38%), Gaps = 14/221 (6%)

Query: 506 LLTVICQMGILIKYKNFKNKSPKFEKLLSYYHHLMYVLPKNSYFGVITTSIKTVQILSLI 565
           L+  +C +G  +  K  ++KS        YY      L K  +       I TVQ L  +
Sbjct: 357 LVYAMCAIGSRLS-KKLEHKSE------YYYEQCKTSLLKAVFDEHSVAKITTVQALFCL 409

Query: 566 LFYHLNTGDIIQIYDLRGMIISMAQQLRLHRCPSAVLTGSGSK-MDRLEQGNRRTLFWCI 624
            FY L  G+    +   G+ + +   +     P    +   S+ + R E   R  ++W  
Sbjct: 410 AFYELGKGNNQLAWYFSGLAVRVGYDMGFQLDPEGWYSDDTSQPLTRSELEIRSRIYWGC 469

Query: 625 YYLDVFCSLQLGVPRLIKDHEIECALPLSSEIHNTDKMDGVQLEGT-MSEFSL---SVVR 680
           Y  D F  L LG  R    +     +P S E+      +  + EG  + + SL   +++ 
Sbjct: 470 YIADHFICLMLG--RTSTLNVSNSTIPESDELPEVTGTEEFRFEGKHVLQISLPLKNLIV 527

Query: 681 CAKVLGNILDSIFKRNMSESITEQVYTIHENALDSWRTKLP 721
            ++++      IF          Q   I  + + +WR  LP
Sbjct: 528 LSRIVEVYTSKIFIETEETDQKVQYLAIFNSQVANWRESLP 568

>KLTH0F07854g Chr6 complement(677647..680013) [2367 bp, 788 aa] {ON}
           some similarities with uniprot|Q12151 Saccharomyces
           cerevisiae YDR213W UPC2 involved in sterol uptake zinc
           finger transcription factor of the Zn(2)- Cys(6)
           binuclear cluster domain type
          Length = 788

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ++   CD C+ +++KCD  +P C  C ++  EC
Sbjct: 45  KSKNGCDNCKRRRVKCDEDKPSCQKCINMKLEC 77

>Skud_9.220 Chr9 complement(396576..398957) [2382 bp, 793 aa] {ON}
           YER184C (REAL)
          Length = 793

 Score = 41.6 bits (96), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           R S+AC+RC  KKIKCD K+P C  CA    +C
Sbjct: 13  RVSKACERCHRKKIKCDSKKP-CFGCAGSRSKC 44

>KAFR0C04980 Chr3 (987900..990755) [2856 bp, 951 aa] {ON} Anc_7.17
           YOR363C
          Length = 951

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/42 (40%), Positives = 20/42 (47%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDKLTR 211
            R S  C  CR  K KCD ++P CS C     EC    +L R
Sbjct: 59  NRISFVCQACRKAKTKCDKEKPMCSRCRKQDLECVYDIELQR 100

>Smik_7.277 Chr7 complement(461108..464317) [3210 bp, 1069 aa] {ON}
           YGL013C (REAL)
          Length = 1069

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 170 GRASQACDRCRLKKIKCDLKRPQCSSCASVGFECKLSDK 208
            + S+ACD CR +KIKC+ K P C+SC     EC  + +
Sbjct: 37  SKVSKACDNCRKRKIKCNGKFP-CASCEIYSCECTFTTR 74

 Score = 33.5 bits (75), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 22/43 (51%)

Query: 609 MDRLEQGNRRTLFWCIYYLDVFCSLQLGVPRLIKDHEIECALP 651
           +D      RR L+W  +Y +   + ++G P  I D +I C LP
Sbjct: 512 LDETFAERRRNLWWKAFYFEKTLASKMGYPSNIDDSKINCLLP 554

>ZYRO0A13596g Chr1 complement(1080653..1082599) [1947 bp, 648 aa]
           {ON} similar to gnl|GLV|KLLA0D10153g Kluyveromyces
           lactis KLLA0D10153g and weakly similar to uniprot|P35995
           Saccharomyces cerevisiae YKL222C Hypothetical ORF
          Length = 648

 Score = 41.6 bits (96), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 22/33 (66%)

Query: 171 RASQACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           + S+ C  C+ KK++CD K P C++C+  G+ C
Sbjct: 6   KPSKTCTNCQRKKVRCDRKVPACTACSERGYNC 38

>Smik_2.438 Chr2 (786437..787846) [1410 bp, 469 aa] {ON} YBR297W
           (REAL)
          Length = 469

 Score = 41.2 bits (95), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 175 ACDRCRLKKIKCDLKRPQCSSCASVGFEC 203
           ACD CR++++KCD K+P CS C    FEC
Sbjct: 7   ACDFCRVRRVKCDGKKP-CSRCIQHDFEC 34

>Suva_10.364 Chr10 complement(637047..639170) [2124 bp, 707 aa] {ON}
           YLR266C (REAL)
          Length = 707

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 26/48 (54%)

Query: 150 STTANGDGAEPLLSSRPDAAGRASQACDRCRLKKIKCDLKRPQCSSCA 197
           ST+   +G+ P+ S +     +  ++C  CR +K+KC   RP C  C+
Sbjct: 7   STSFTNEGSSPIDSDKKGKRRKVIKSCTFCRKRKLKCSQVRPMCQQCS 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,199,432
Number of extensions: 5791319
Number of successful extensions: 23655
Number of sequences better than 10.0: 844
Number of HSP's gapped: 24359
Number of HSP's successfully gapped: 1004
Length of query: 1237
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1116
Effective length of database: 39,606,813
Effective search space: 44201203308
Effective search space used: 44201203308
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)