Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002408.846ON28628615110.0
YMR281W (GPI12)8.846ON3042976466e-83
Smik_13.4948.846ON3042986135e-78
Skud_13.4538.846ON3003016031e-76
Suva_13.4708.846ON3032975952e-75
NCAS0C003808.846ON2762855741e-72
KAFR0B039608.846ON2782815741e-72
NDAI0K003308.846ON3133145642e-70
ZYRO0G14300g8.846ON2802835516e-69
CAGL0M03047g8.846ON3042965329e-66
SAKL0D01320g8.846ON2602755228e-65
TDEL0B005208.846ON2682875106e-63
KLTH0C03740g8.846ON2542755034e-62
TPHA0I002808.846ON3013014953e-60
Kpol_1068.48.846ON2912824701e-56
Kwal_27.102278.846ON2542734582e-55
ABL120W8.846ON2492764564e-55
Ecym_46178.846ON2492754486e-54
TBLA0B033008.846ON3193204432e-52
KLLA0D01430g8.846ON2632344383e-52
NCAS0F031605.402ON373299800.17
TBLA0A035405.402ON381399770.44
Kwal_47.171024.306ON285180750.52
TDEL0E022205.402ON373499760.55
YMR221C8.739ON504101750.59
KAFR0I00130singletonON34489750.59
KLTH0E02530g5.402ON372199750.65
CAGL0A01914g5.402ON374399740.85
Kwal_55.200115.402ON372599740.88
NDAI0C046305.402ON375587740.88
ZYRO0A06534g5.402ON374999731.2
KNAG0C051305.402ON374299731.3
Suva_7.2774.118ON26570711.4
Kpol_530.85.402ON374099731.4
TPHA0E019005.402ON374087721.9
KAFR0E040705.402ON373396721.9
YGL005C (COG7)4.118ON27970693.0
ADL197C3.12ON39069693.3
SAKL0G07458g5.402ON372598694.0
Skud_8.1605.402ON374399676.2
Smik_8.1775.402ON374499676.2
Suva_15.2945.402ON374499676.5
YHR099W (TRA1)5.402ON374499677.8
SAKL0B07832g3.361ON48051667.8
KLLA0F22066g5.402ON376499668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00240
         (286 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}...   586   0.0  
YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER me...   253   6e-83
Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W...   240   5e-78
Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W...   236   1e-76
Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W...   233   2e-75
NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON} ...   225   1e-72
KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.84...   225   1e-72
NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846...   221   2e-70
ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} simil...   216   6e-69
CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly...   209   9e-66
SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON...   205   8e-65
TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON} ...   201   6e-63
KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {O...   198   4e-62
TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846 ...   195   3e-60
Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON} c...   185   1e-56
Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {O...   181   2e-55
ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic hom...   180   4e-55
Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar ...   177   6e-54
TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.84...   175   2e-52
KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {O...   173   3e-52
NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5...    35   0.17 
TBLA0A03540 Chr1 (877387..888828) [11442 bp, 3813 aa] {ON} Anc_5...    34   0.44 
Kwal_47.17102 s47 complement(250539..251396) [858 bp, 285 aa] {O...    33   0.52 
TDEL0E02220 Chr5 complement(415477..426681) [11205 bp, 3734 aa] ...    34   0.55 
YMR221C Chr13 complement(713931..715445) [1515 bp, 504 aa] {ON} ...    33   0.59 
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...    33   0.59 
KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa]...    33   0.65 
CAGL0A01914g Chr1 (195146..206377) [11232 bp, 3743 aa] {ON} high...    33   0.85 
Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa]...    33   0.88 
NDAI0C04630 Chr3 (1055407..1066674) [11268 bp, 3755 aa] {ON} Anc...    33   0.88 
ZYRO0A06534g Chr1 complement(520491..531740) [11250 bp, 3749 aa]...    33   1.2  
KNAG0C05130 Chr3 complement(986756..997984) [11229 bp, 3742 aa] ...    33   1.3  
Suva_7.277 Chr7 complement(481312..482109) [798 bp, 265 aa] {ON}...    32   1.4  
Kpol_530.8 s530 complement(14877..17516,17519..26101) [11223 bp,...    33   1.4  
TPHA0E01900 Chr5 complement(381017..392239) [11223 bp, 3740 aa] ...    32   1.9  
KAFR0E04070 Chr5 complement(804691..815892) [11202 bp, 3733 aa] ...    32   1.9  
YGL005C Chr7 complement(489708..490547) [840 bp, 279 aa] {ON}  C...    31   3.0  
ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON} S...    31   3.3  
SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa]...    31   4.0  
Skud_8.160 Chr8 (276598..287829) [11232 bp, 3743 aa] {ON} YHR099...    30   6.2  
Smik_8.177 Chr8 (279199..290433) [11235 bp, 3744 aa] {ON} YHR099...    30   6.2  
Suva_15.294 Chr15 (505128..516362) [11235 bp, 3744 aa] {ON} YHR0...    30   6.5  
YHR099W Chr8 (302761..313995) [11235 bp, 3744 aa] {ON}  TRA1Subu...    30   7.8  
SAKL0B07832g Chr2 (668304..669746) [1443 bp, 480 aa] {ON} simila...    30   7.8  
KLLA0F22066g Chr6 complement(2051033..2062327) [11295 bp, 3764 a...    30   8.8  

>KNAG0J00240 Chr10 complement(32153..33013) [861 bp, 286 aa] {ON}
           Anc_8.846 YMR281W
          Length = 286

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/286 (100%), Positives = 286/286 (100%)

Query: 1   MFRFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDINSVNLVIAHPDD 60
           MFRFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDINSVNLVIAHPDD
Sbjct: 1   MFRFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDINSVNLVIAHPDD 60

Query: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIV 120
           EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIV
Sbjct: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIV 120

Query: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180
           VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE
Sbjct: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180

Query: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240
           FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI
Sbjct: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240

Query: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVISS 286
           FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVISS
Sbjct: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVISS 286

>YMR281W Chr13 (832339..833253) [915 bp, 304 aa] {ON}  GPI12ER
           membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly, the
           de-N-acetylation of the
           N-acetylglucosaminylphosphatidylinositol intermediate;
           functional homolog of human PIG-Lp
          Length = 304

 Score =  253 bits (646), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 140/297 (47%), Positives = 192/297 (64%), Gaps = 19/297 (6%)

Query: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDIN--SVNLVIAHPDD 60
           + NFS+ +YK+TKL+++L ILYIY  T KI S N  +L+ +  H      +NLVIAHPDD
Sbjct: 8   KVNFSKLLYKITKLAIVLTILYIYF-TPKIVSRNNASLQHIFPHKYGDYEINLVIAHPDD 66

Query: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118
           EVMFF+P +  LN     P TV FNIIC S G A+GLG  R +EL++S A+LL   R  S
Sbjct: 67  EVMFFSPIISQLNSYF--PRTVPFNIICLSKGNAEGLGETRVRELNESAALLLHNERAVS 124

Query: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHN---VLLTFDGKGVSGHLNHIACYRAA- 174
           + V+DF+DGM E WD+  + + L   +    HN   +++TFD  GVS H+NH +CY A  
Sbjct: 125 VQVMDFQDGMDEIWDIDSITSSLSQKIDIKNHNLNQIIVTFDSYGVSNHINHKSCYAAVK 184

Query: 175 --LGYYNEFKSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVP-SRLGNV 226
             +  Y + K+K+      +T L L+SY  NIV KY+S+IWE++K+LY    P  R+   
Sbjct: 185 KLVDDYAQPKTKRNEQPPHVTALYLRSYKNNIVLKYNSFIWEILKILYDLISPFRRIIQA 244

Query: 227 LPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283
           LP   +    K+++ +T+ QYVL+ A MLNAH++QVVWFRYGWW FSR VFVN+ DV
Sbjct: 245 LPPNTAAEKDKLSLMNTHAQYVLAFATMLNAHESQVVWFRYGWWIFSRFVFVNEFDV 301

>Smik_13.494 Chr13 (815351..816265) [915 bp, 304 aa] {ON} YMR281W
           (REAL)
          Length = 304

 Score =  240 bits (613), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 135/298 (45%), Positives = 190/298 (63%), Gaps = 21/298 (7%)

Query: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL--GEHDINSVNLVIAHPDD 60
           R NFS+ +YK+TKLS++L ILYIY  T KI S N  +L+ +   ++    +NL+IAHPDD
Sbjct: 8   RVNFSKLLYKITKLSIVLTILYIYF-TPKIISRNNESLQHVFPNKYSDYQINLIIAHPDD 66

Query: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118
           EVMFF+P +  L+     P+TV FNIIC S G A+GLG  R +EL+DS A+LL   R  S
Sbjct: 67  EVMFFSPMISQLHSYF--PNTVPFNIICLSKGNAEGLGQTRVRELNDSAALLLHNERAVS 124

Query: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHN----VLLTFDGKGVSGHLNHIACY--- 171
           + V+DF+DGM E WD+  + + L   +  + +N    +++TFD  GVSGH+NH +C+   
Sbjct: 125 VQVMDFQDGMNEVWDIDSITSTLSQTI-GINNNELNQIIVTFDSYGVSGHINHKSCHTAV 183

Query: 172 RAALGYYNEFKSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSR-LGN 225
           R  +  Y     +++     +T L L+SY  NIV KY+S+IWE++++LY    P R    
Sbjct: 184 RKLIADYTRSNVRKEVKTPLITALYLRSYKNNIVLKYNSFIWEILRMLYGLISPFRKTTQ 243

Query: 226 VLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283
            LP         + + +T+ QY+L+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ DV
Sbjct: 244 ALPSDVVAEKNSLLLMNTHAQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDV 301

>Skud_13.453 Chr13 (805536..806438) [903 bp, 300 aa] {ON} YMR281W
           (REAL)
          Length = 300

 Score =  236 bits (603), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 137/301 (45%), Positives = 189/301 (62%), Gaps = 29/301 (9%)

Query: 3   RFNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHD--INSVNLVIAHPDD 60
           + NFS+ +YK+TKL+++L ILYI+  T KI S N   L+ +  H    + +NLVIAHPDD
Sbjct: 6   KVNFSKLVYKITKLAIVLTILYIFF-TPKIISRNDELLQHVFPHKNRDSQINLVIAHPDD 64

Query: 61  EVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTS 118
           EVMFF+P +  L+     P TV FNIIC S G ADGLG  R +EL+ S A+LL   R  S
Sbjct: 65  EVMFFSPVISQLHSYF--PITVPFNIICLSKGNADGLGESRVKELNGSAALLLQNERPVS 122

Query: 119 IVVLDFKDGMKEKWDVKEMIAKLRNIVP---KLGHNVLLTFDGKGVSGHLNHIACYRAA- 174
           + V+DF+DGM E WD+  +++ +   +    +  + +++TFD  GVS H+NH +C+ A  
Sbjct: 123 VQVMDFEDGMDEVWDINSIVSTISQTIDLSNEQLNQIIVTFDSYGVSDHINHKSCHTAVK 182

Query: 175 --LGYYNEFKSKQ-----KLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVL 227
             +  Y E K++       +T L L+SY  NIV KY+S+IWE++K+LYS  VP       
Sbjct: 183 RLIDRYAESKAETNEETPHITALYLKSYKNNIVLKYNSFIWEILKILYSVIVP------F 236

Query: 228 PKRGSNVA-----RKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLD 282
           PK            K+ + +T+ QYVL+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ D
Sbjct: 237 PKTIQPPTTTTQRSKLLLMNTHAQYVLAYAAMLNAHKSQVVWFRYGWWILSRFVFVNEFD 296

Query: 283 V 283
           V
Sbjct: 297 V 297

>Suva_13.470 Chr13 (815029..815940) [912 bp, 303 aa] {ON} YMR281W
           (REAL)
          Length = 303

 Score =  233 bits (595), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 131/297 (44%), Positives = 191/297 (64%), Gaps = 20/297 (6%)

Query: 6   FSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEH-DINS-VNLVIAHPDDEVM 63
           FS+ ++K+TKL+++L +LYIY  T KI S N  +L+ +  H D NS +NLVIAHPDDEVM
Sbjct: 9   FSKLLFKITKLAIVLTVLYIYF-TPKILSRNTDSLQHVFPHRDRNSQINLVIAHPDDEVM 67

Query: 64  FFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPT-RNTSIVV 121
           FF+P +  L+     P TV FNI+C S G A+GLG  R +EL+DS  +LL   R  S+ V
Sbjct: 68  FFSPVISQLHAYF--PDTVPFNILCLSKGDAEGLGETRAKELNDSAVLLLRNERPVSVQV 125

Query: 122 LDFKDGMKEKWDVKEMIAKLRNIVP---KLGHNVLLTFDGKGVSGHLNHIACYRAALGYY 178
           +DF+DGM E WD+  + + L   +    +    +++TFD  GVS H+NH +C+ A   + 
Sbjct: 126 MDFEDGMDEVWDIDSITSTLSQTIDVNNEKVSQIIVTFDSYGVSNHINHKSCHIAVEKFI 185

Query: 179 NEF---KSKQK-----LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVP-SRLGNVLPK 229
           +++   K+K+K     +T L L+SY  NI  KY+S+IWE++K+LY +  P  R    L  
Sbjct: 186 DDYVGSKTKEKAENAHITALYLRSYKNNIFLKYNSFIWEILKMLYRTVSPFGRSIQPLAA 245

Query: 230 RGSNVARK-ITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285
             +   +  + + +T+ QY+L+ AAMLNAHK+QVVWFRYGWW  SR VFVN+ D+ +
Sbjct: 246 PSTTTEKNGLLLMNTHSQYILAFAAMLNAHKSQVVWFRYGWWILSRFVFVNEFDIFT 302

>NCAS0C00380 Chr3 complement(55971..56801) [831 bp, 276 aa] {ON}
           Anc_8.846 YMR281W
          Length = 276

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 128/285 (44%), Positives = 181/285 (63%), Gaps = 17/285 (5%)

Query: 4   FNFSRFIYKVTKLSLLLGILYIYAST--SKIGSFNYTNLETLGEHDINSVNLVIAHPDDE 61
           F+FS+ I+KVTKL L+L +LY+ +S    +  + NY+ L T   H+  ++NLVIAHPDDE
Sbjct: 6   FSFSKLIFKVTKLFLVLWLLYLLSSNRIEQFNTLNYSQLNTKIFHEGTTLNLVIAHPDDE 65

Query: 62  VMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSI-AMLLPTRNTSIV 120
           VMFFAP+L+ L + +   S   N+ICFSNG A GLG  R+ EL  SI A++   R T++ 
Sbjct: 66  VMFFAPTLLQL-DNLMPLSIPINVICFSNGDAQGLGEKRQHELQSSIHALIQNQRQTNVT 124

Query: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180
           VL F+DG  + WD+ +M   L    P+  H   LTFD  GVSGH NHIAC+ A    +N 
Sbjct: 125 VLHFQDGNDQIWDIDQMTQYL----PQNDHQAFLTFDSHGVSGHKNHIACHNAV---WNL 177

Query: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240
             +   +T+L+L S   +++ KY+ +I +L+KL ++ W   +     P+  S+   KIT 
Sbjct: 178 KNTNNNVTILTLDSIHHSLLAKYTFFIIDLVKLYWNLWKDQQQ----PQWESH--DKITF 231

Query: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285
           F+ Y QY+L+ + MLNAHK+QVVWFRYGWW FSR VF N L + +
Sbjct: 232 FNAYSQYILAYSTMLNAHKSQVVWFRYGWWAFSRFVFSNHLKITT 276

>KAFR0B03960 Chr2 (829312..830148) [837 bp, 278 aa] {ON} Anc_8.846
           YMR281W
          Length = 278

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 123/281 (43%), Positives = 172/281 (61%), Gaps = 18/281 (6%)

Query: 7   SRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL------GEHDINSVNLVIAHPDD 60
           S+ I+K+TKL+L+   LYI  S  KI   N   L T          +  S+ LV+AHPDD
Sbjct: 5   SKLIFKITKLTLIFWCLYIVLS-PKIQLSNDQILNTFIPSLIKDRSNDPSLTLVVAHPDD 63

Query: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIV 120
           EVMFF+P+L+ L+  +  P+  FNII +S+G A+GLG++R  EL+ SI ML+P RN  I 
Sbjct: 64  EVMFFSPTLLQLDSHLP-PNCKFNIISYSDGDAEGLGSLRSNELAHSIDMLIPRRNKEIF 122

Query: 121 VLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNE 180
           + +  DGM E WD K M+ +L +I+     N+LLTFD  GVS H+NH AC++    Y   
Sbjct: 123 IFNHTDGMNEVWDNKLMLHQLESILSDSQTNILLTFDQFGVSNHINHKACHQVVTSYIQS 182

Query: 181 FKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITI 240
             +K    +L L SYS N++KKY+ + W+L+ L  + W+    G  LP         + +
Sbjct: 183 -HAKNNFALL-LDSYSSNLLKKYTGFAWQLVFLAKNYWIH---GKTLPNLD-----HLAL 232

Query: 241 FSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           F+ Y  Y+ + A ML AHK+Q+VWFRYGWWFFSR V+VNDL
Sbjct: 233 FNPYSDYITAYATMLKAHKSQMVWFRYGWWFFSRFVYVNDL 273

>NDAI0K00330 Chr11 (63765..64706) [942 bp, 313 aa] {ON} Anc_8.846
           YMR281W
          Length = 313

 Score =  221 bits (564), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/314 (42%), Positives = 197/314 (62%), Gaps = 42/314 (13%)

Query: 6   FSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLET-------LGEHD-------INSV 51
           FS+F YK  KL LLL + Y+  ST KI S+N  + +          +H        I  +
Sbjct: 5   FSKFTYKSFKLFLLLWMFYM-ISTQKISSYNKKSFDNSVLNQILRQDHSHADISEPITQL 63

Query: 52  NLVIAHPDDEVMFFAPSLINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAM 110
           +LVIAHPDDE+MFFAP+L+ LN  +  P+++ FNIICFS+G A+GLG +R +EL DSI +
Sbjct: 64  SLVIAHPDDELMFFAPTLLQLNRFL--PTSIPFNIICFSDGDAEGLGYLRRKELHDSINL 121

Query: 111 LLPTRNT---SIVVLDFKDGMKEKWDVKEMIAKLRN-----IVPKLGHNVLLTFDGKGVS 162
           LL + N    +I +LDF DGM + WD K++++ L+N     + P + +N+LLTFD  G+S
Sbjct: 122 LLSSSNNRKINISILDFIDGMDQVWDGKQLLSSLQNELLVNVPPSIKNNILLTFDANGIS 181

Query: 163 GHLNHIACYRAA--LGYYNEFKSKQKLTVLSLQSYSK--------NIVKKYSSYIWELIK 212
            H NHIAC +A   L  Y+  K K+ + ++ L   SK        N++ KY+ ++ +L+K
Sbjct: 182 NHPNHIACNKAVHDLISYDGGKDKE-MNIIGLMLSSKSDEYNIVMNLLSKYTFFVIDLVK 240

Query: 213 LLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFF 272
           + ++  + +   N +P   S    +++  +TY QY+LS A+MLN HK+Q+VWFRYGWW+F
Sbjct: 241 VYWN--LATGTFNTIPNSAS---LELSFINTYSQYILSYASMLNTHKSQMVWFRYGWWWF 295

Query: 273 SRLVFVNDLDVISS 286
           SR VF NDL V+S+
Sbjct: 296 SRFVFSNDLLVVSN 309

>ZYRO0G14300g Chr7 (1145709..1146551) [843 bp, 280 aa] {ON} similar
           to uniprot|P23797 Saccharomyces cerevisiae YMR281W GPI12
           ER membrane protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 280

 Score =  216 bits (551), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 178/283 (62%), Gaps = 18/283 (6%)

Query: 12  KVTKLSLLLGILYIYAST---SKIGSFNYTNLETLGEHDINSVNLVIAHPDDEVMFFAPS 68
           K  K+  LL +L+I  S    S+ GS    NL+ L E  I+S++LV+AHPDDEVMFFAP+
Sbjct: 6   KFPKVYFLLWVLFIAFSVRIKSRNGSVFNDNLKFLDE--IDSLSLVVAHPDDEVMFFAPT 63

Query: 69  LINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPT--RNTSIVVLDFKD 126
           ++ L+ ++  P+  FN++C S GGAD LG+ R QEL +S+ +LL    R   +   D+ D
Sbjct: 64  ILELDSRLP-PNVEFNVVCLSKGGADELGDTRVQELKESVNLLLANSKRQYQLQQHDYPD 122

Query: 127 GMKEKWDVKEMIAKLRN-IVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSKQ 185
           G +E WD + + + +++ ++     +VLLTFD KGVS H+NHIAC+ A      + +S  
Sbjct: 123 GHEETWDQESVQSTIKDSVLQGRRSSVLLTFDDKGVSKHVNHIACHEAVSNLVQD-ESNV 181

Query: 186 KLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSN---VARKITIFS 242
           K   L L SY  NIV KYS++ WE+ KL    W    L  VLP    N    A +IT+ S
Sbjct: 182 K-AALYLDSYGDNIVLKYSAFFWEIWKLT-RDWF---LHRVLPTSSYNENKPATEITLMS 236

Query: 243 TYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285
            Y  Y+LS A+ML++HK+Q+VWFRYGWW FSR VFVNDL V++
Sbjct: 237 DYSSYILSFASMLHSHKSQMVWFRYGWWTFSRFVFVNDLKVVN 279

>CAGL0M03047g Chr13 (346435..347349) [915 bp, 304 aa] {ON} weakly
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281w GPI12 N-acetylglucosaminyl phosphatidylinositol
           deacetylase
          Length = 304

 Score =  209 bits (532), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 125/296 (42%), Positives = 176/296 (59%), Gaps = 22/296 (7%)

Query: 4   FNFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNL-ETLGEHD-INSVNLVIAHPDDE 61
           F FS+ ++K+TKL+++  +LYIY  T K+   N  NL + L  HD    +NLVIAHPDDE
Sbjct: 16  FPFSKLLFKLTKLTIIFQVLYIYF-TPKVEDLNKENLTKLLPTHDNFGVLNLVIAHPDDE 74

Query: 62  VMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRN---TS 118
           +MFF+P+++ L + +++     N++C SNG ADGLG +R +EL D+I  L   RN    S
Sbjct: 75  IMFFSPTILQLIDHVQE----LNVVCLSNGDADGLGELRAKELKDAIGYLTVNRNLRNVS 130

Query: 119 IVVLDFKDGMKEKW-----DVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRA 173
           + +LD+ DG  E W     D+K+ I      V +   +++LTFD +G+SGH NHIAC   
Sbjct: 131 LNILDYTDGQNEVWSGVATDLKKYILTSEPGVKQ--KDIILTFDREGISGHRNHIACNEG 188

Query: 174 ALGYYNEFKSKQKLTVLSLQSYSK-NIVKKYSSYIWELIKLLYSSWVPSRLGNV--LPKR 230
            + Y    KS      L L+S S   I+ KYS  + +L++++Y+    S    V  LP R
Sbjct: 189 VISYLKTIKS-NSFVFLELKSLSTWQIISKYSGVVPKLLEIIYNKIRASNKTFVSYLPNR 247

Query: 231 GS-NVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVIS 285
            S      +   ST+ QY LS AAM  AHK+Q+VWFRY WW FSR VFVNDL  I+
Sbjct: 248 DSIATDSNVCFISTFDQYALSFAAMCYAHKSQMVWFRYLWWSFSRYVFVNDLSRIT 303

>SAKL0D01320g Chr4 complement(99898..100680) [783 bp, 260 aa] {ON}
           similar to uniprot|P23797 Saccharomyces cerevisiae
           YMR281W GPI12 ER membrane protein involved in the second
           step of glycosylphosphatidylinositol (GPI) anchor
           assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 260

 Score =  205 bits (522), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 114/275 (41%), Positives = 161/275 (58%), Gaps = 26/275 (9%)

Query: 10  IYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-GEHDINSVNLVIAHPDDEVMFFAPS 68
           + K+ K   LL +LYI  S  +I + N      +       SVNL++AHPDDE MFF+P+
Sbjct: 7   VAKLLKAYALLSVLYICVS-QRIAAHNRQVFRNVFPSRTPTSVNLIVAHPDDETMFFSPT 65

Query: 69  LINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGM 128
           L+ L+     PS    +IC +NG ADGLG VREQEL  S+ +LLP RNTS++V  F+DGM
Sbjct: 66  LLQLHVNY-PPSVPLRVICLTNGDADGLGAVREQELRLSMQLLLPARNTSVIVEGFEDGM 124

Query: 129 KEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSK-QKL 187
             +WD ++++A +   V      +LLTFD  GVSGH+NH++C  A      + + + Q+ 
Sbjct: 125 GVEWDTRQVVATINRHVSD-ASPLLLTFDEHGVSGHVNHVSCNTAVSALVEQREQREQRF 183

Query: 188 TVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIF-STYPQ 246
           T L L S  +    KY S+  +L +++                     R+  +F ST+PQ
Sbjct: 184 TALYLNS-KRYFPPKYGSFAVDLARII-------------------TGRQPPVFMSTFPQ 223

Query: 247 YVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           Y+LSLAAM NAH +Q+VWFR+GWW  SR VFVN+L
Sbjct: 224 YLLSLAAMCNAHVSQMVWFRWGWWLASRFVFVNEL 258

>TDEL0B00520 Chr2 complement(94560..95366) [807 bp, 268 aa] {ON}
           Anc_8.846 YMR281W
          Length = 268

 Score =  201 bits (510), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/287 (40%), Positives = 169/287 (58%), Gaps = 28/287 (9%)

Query: 5   NFSRFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLE----TLGEHDINSVNLVIAHPDD 60
           N S    KV KL   L ILY+ A T++I   N    +     +G  +  S+ L+IAHPDD
Sbjct: 2   NVSGGAVKVFKLLFFLSILYV-ALTARINGRNEVQWQQHAAAIGTPE--SLTLLIAHPDD 58

Query: 61  EVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPT--RNTS 118
           EVMFF+PSL+ L +++   S  FN +C S G AD LG  RE EL  S+ +L     R T 
Sbjct: 59  EVMFFSPSLLQL-DRLLPQSVRFNFVCLSKGDADHLGETRELELQRSLNLLTSNSQRKTQ 117

Query: 119 IVVLDFKDGMKEKWDVKEMIAKLRN-IVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGY 177
           +   D+ DG  EKW+++ +++ + + +    G N+LLTFD  GVS H NH+AC+ A    
Sbjct: 118 LYQFDYPDGFDEKWEIESVVSIVESKVFIGSGFNLLLTFDAHGVSNHPNHVACHNAVARL 177

Query: 178 YNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARK 237
                 ++    L L S+S+N+  KYS +IWELI++L  S +       L + G      
Sbjct: 178 I-----EKGHKALYLNSHSRNLPLKYSGFIWELIRMLSDSVMK------LERTG------ 220

Query: 238 ITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVI 284
           +T  +++PQY+L+ AAM NAH++Q+VWFRYGWW  SR VFVNDL+++
Sbjct: 221 LTFMNSFPQYILAFAAMANAHESQLVWFRYGWWSLSRFVFVNDLEIV 267

>KLTH0C03740g Chr3 complement(323371..324135) [765 bp, 254 aa] {ON}
           weakly similar to uniprot|P23797 Saccharomyces
           cerevisiae YMR281W GPI12 ER membrane protein involved in
           the second step of glycosylphosphatidylinositol (GPI)
           anchor assembly the de-N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 254

 Score =  198 bits (503), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 161/275 (58%), Gaps = 26/275 (9%)

Query: 8   RFIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-GEHDINSVNLVIAHPDDEVMFFA 66
           R +  V KL  +L ILY +AS+++I + N     TL    +  S+NLVIAHPDDEVMFFA
Sbjct: 2   RILKVVCKLLAVLCILY-FASSARIKASNEQAFTTLFSVLNPTSINLVIAHPDDEVMFFA 60

Query: 67  PSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKD 126
           P+L+ L+    D     ++   ++GGADGLG +RE+EL DS+ +L   R   + VL+F+D
Sbjct: 61  PTLLQLDHYF-DTDIPVSVFSLTDGGADGLGKLREEELRDSVHLLFRRRKAEVTVLNFED 119

Query: 127 GMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSKQK 186
           GMK +WD+++    LR  V      + LTFD  GVS H+NHI+CY             + 
Sbjct: 120 GMKVEWDLQKTSEALRKQVVG-DQPLFLTFDDHGVSSHINHISCYETVRNLRAAHPESRS 178

Query: 187 LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQ 246
            ++ S     ++I +KY++++  LI +L               RGS   R+    ST+ Q
Sbjct: 179 FSLTS----KRSIFQKYTAFVPSLITVL---------------RGS---RQAVFMSTFKQ 216

Query: 247 YVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           Y+L+L+ M+NAH +Q+VWFRYGWWFFS  VF N++
Sbjct: 217 YLLALSVMMNAHTSQMVWFRYGWWFFSCYVFANEV 251

>TPHA0I00280 Chr9 (54103..55008) [906 bp, 301 aa] {ON} Anc_8.846
           YMR281W
          Length = 301

 Score =  195 bits (495), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 178/301 (59%), Gaps = 29/301 (9%)

Query: 10  IYKVTKLSLLLGILYIYASTSKIGSFN----YTNLE-TLGEHDINSVNLVIAHPDDEVMF 64
           ++K+ K   +L ILYI+  T  I   N    Y+N++  + +  + SVNL+IAHPDDEVMF
Sbjct: 4   LFKLFKCYCILSILYIWL-TPHIEDLNLKSFYSNVQLNISQQSLKSVNLIIAHPDDEVMF 62

Query: 65  FAPSLINLNEQIRDPSTV-FNIICFSNG-GADG--LGNVREQELSDSIAMLLP------T 114
           F P+L+ L++ +  P+ V FN+IC S G   DG  +G++R  E+ DS+ MLL        
Sbjct: 63  FTPTLLQLDDIL--PTHVPFNVICLSKGVDVDGRAVGDLRSNEIMDSLTMLLGHRRAGLN 120

Query: 115 RNTSIVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNV------LLTFDGKGVSGHLNHI 168
           R   +   +++DGM ++WD+ +++  ++N +  +  NV      LLTFD +GVS H NHI
Sbjct: 121 REVKLHQFEYEDGMDKQWDISKVVTDIQNTI-SMESNVDGLKHWLLTFDAQGVSEHPNHI 179

Query: 169 ACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYS----SWVPSRLG 224
           ACY A +    +  +     +++L SY  NI+ KYSS++  + KLL +     +    L 
Sbjct: 180 ACYDAMMTLKQKSSNPGDYLLMTLNSYGSNIILKYSSFLPVVFKLLINIINDKFRIFELK 239

Query: 225 NVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDVI 284
            V          +I   +T+P Y+++L++MLN+H +Q+VWFRYGWW FSR VFVNDL +I
Sbjct: 240 QVPFLSMHKEHDQIQFINTFPHYIMALSSMLNSHTSQMVWFRYGWWSFSRFVFVNDLHII 299

Query: 285 S 285
            
Sbjct: 300 D 300

>Kpol_1068.4 s1068 complement(6124..6999) [876 bp, 291 aa] {ON}
           complement(6124..6999) [876 nt, 292 aa]
          Length = 291

 Score =  185 bits (470), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 166/282 (58%), Gaps = 14/282 (4%)

Query: 9   FIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHD-INSVNLVIAHPDDEVMFFAP 67
           F++K  KL  LL   Y++ + +  G  N   +   G     +SVNLVIAHPDDEVMFF+P
Sbjct: 6   FVFKAIKLYFLLWCGYVWFAGAIRGE-NARQVRGPGYFSGSSSVNLVIAHPDDEVMFFSP 64

Query: 68  SLINLNEQIRDPSTVFNIICFSNG-GADG--LGNVREQELSDSIAMLLP-TRNTSIVVLD 123
           +L+ L+  + +   + N+ICFS G   DG   G  R +EL  S++ML+   R  ++  LD
Sbjct: 65  TLMQLDNWLPNDVAI-NVICFSKGVNVDGSIAGESRARELKKSVSMLIEHDRPVTVHQLD 123

Query: 124 FKDGMKEKWDVKEMIAKLRNIV-PKLGH---NVLLTFDGKGVSGHLNHIACYRAALGYYN 179
           +KDG  + WD+  M+  L+ ++ P   +   ++L+TFD  GVS H NHIAC+ A    + 
Sbjct: 124 YKDGKDQIWDLDSMVWDLKTLINPSKDYKRKDLLITFDEHGVSDHPNHIACHNAV---HR 180

Query: 180 EFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKIT 239
             + +       L+S+S N++ KYS +  E++K  Y+       G     +  +V  +  
Sbjct: 181 LIEEEPLFMAYQLESHSTNVILKYSFFAREIVKYFYNYCHQRIKGQTSLNKNMDVPYEYV 240

Query: 240 IFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           +F+T+ +Y+++ A MLNAH++QVVWFRYGWWFFSRL + N+L
Sbjct: 241 LFNTHSEYIMAYATMLNAHESQVVWFRYGWWFFSRLTYANEL 282

>Kwal_27.10227 s27 complement(249716..250480) [765 bp, 254 aa] {ON}
           YMR281W (GPI12) -
           N-acetylglucosaminylphosphatidylinositol de-N-acetylase
           [contig 39] FULL
          Length = 254

 Score =  181 bits (458), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 159/273 (58%), Gaps = 28/273 (10%)

Query: 13  VTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDI-NSVNLVIAHPDDEVMFFAPSLIN 71
           V K+S +L ++YI  S  +I   N   L +L       S+NLVIAHPDDEVMFFAP+L+ 
Sbjct: 7   VFKVSGILWLVYILGSV-QIERSNRRALGSLFRGSAPTSINLVIAHPDDEVMFFAPTLLQ 65

Query: 72  LNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGMKE 130
           ++E +  P ++  N+I  ++GGADGLG++R +EL D + +LL  R  S+ VLDF DGM  
Sbjct: 66  IDEWL--PGSIEVNVISLTDGGADGLGDLRTKELQDCVRLLLRKRKASVEVLDFLDGMDV 123

Query: 131 KWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLTVL 190
           +WD++  +  L+  +      + LTFD  G+SGH+NHI+CY+A       +       ++
Sbjct: 124 EWDLERAVKALQERILD-ESPLFLTFDENGISGHVNHISCYKAVQKVRKHYSKSSCFKLV 182

Query: 191 SLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVLS 250
           S     + + +KYS +I  L     SS  PS                 T+ +++ QY+L+
Sbjct: 183 S----KRYLFEKYSGFIPALFHSFISS-SPS-----------------TLINSFRQYLLA 220

Query: 251 LAAMLNAHKTQVVWFRYGWWFFSRLVFVNDLDV 283
           L++M+NAH +Q+VWFRYGWW FS  V+ N+L  
Sbjct: 221 LSSMMNAHVSQMVWFRYGWWLFSYYVYANELQA 253

>ABL120W Chr2 (175065..175814) [750 bp, 249 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR281W (GPI12)
          Length = 249

 Score =  180 bits (456), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 161/276 (58%), Gaps = 39/276 (14%)

Query: 11  YKVTKLSLLLGILYIYASTSKIGSFNYTNLETL--GEHDINSVNLVIAHPDDEVMFFAPS 68
           + V KL LLL  +Y + S  ++   N    E L  G+    S+ LVIAHPDDEVMFFAP+
Sbjct: 6   FAVVKLYLLLLAVYCW-SRRRLERHNTQVFERLVGGDSQHTSLTLVIAHPDDEVMFFAPT 64

Query: 69  LINLNEQIRDPSTV-FNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDG 127
           L+ L+ ++  P+ + F ++C ++GGA+GLG +R  EL  ++ +L+   + ++ V DF DG
Sbjct: 65  LLQLDARL--PAWMPFRVVCLTDGGAEGLGQLRRAELQKALRLLVLEHDVTLEVADFTDG 122

Query: 128 MKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAA--LGYYNEFKSKQ 185
           MKE WD+ E+  +L  +V      ++LTFD +GVSGH NHI C  AA  LG+   F   +
Sbjct: 123 MKEDWDLAEVRTRLGELVTD-AKPLVLTFDERGVSGHRNHIGCALAAARLGHKTLFLRSE 181

Query: 186 KLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIF-STY 244
                      +N+++KYS ++ ++ ++++ +  P                  T+F ST 
Sbjct: 182 -----------RNLLRKYSFFVLDVFRVVFGTPPP------------------TVFVSTL 212

Query: 245 PQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVND 280
            QY+ +L AM+ AH++Q+VWFR+GWW  SR V+ N+
Sbjct: 213 AQYLHALVAMVVAHRSQMVWFRWGWWMASRYVYANE 248

>Ecym_4617 Chr4 (1209745..1210494) [750 bp, 249 aa] {ON} similar to
           Ashbya gossypii ABL120W
          Length = 249

 Score =  177 bits (448), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 107/275 (38%), Positives = 157/275 (57%), Gaps = 35/275 (12%)

Query: 11  YKVTKLSLLLGILYIYASTSKIGSFNYTNLETL-GEH-DINSVNLVIAHPDDEVMFFAPS 68
           + V KL L+L  +Y   S   + + N    E L G H +  SV L+IAHPDDEVMFFAP+
Sbjct: 6   FAVIKLYLVLLAVYC-GSYKHLETHNSKVYEYLVGSHGNYTSVTLIIAHPDDEVMFFAPT 64

Query: 69  LINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVLDFKDGM 128
           L+ L+ ++   S  F ++C ++G ADGLG VR +EL  ++ +L+  R+  I +  FKDGM
Sbjct: 65  LLQLDARMAQ-SVPFRVVCLTDGDADGLGEVRRRELHKALRLLVLERDVEIQMGGFKDGM 123

Query: 129 KEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNHIACYRAA--LGYYNEFKSKQK 186
            E+W ++ +  +L  +V      ++LTFD +GVSGH NHIAC  AA  LG++        
Sbjct: 124 DEEWKMEVVREELAQVVTD-RRPLVLTFDERGVSGHRNHIACAHAAAKLGHHT------- 175

Query: 187 LTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQ 246
              L L S   N+++KYS +  +L +LL+   +P+                    ST+ Q
Sbjct: 176 ---LHLDS-GHNLIRKYSFFFVDLFRLLFGYPMPT-----------------VFLSTFSQ 214

Query: 247 YVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           Y+ SL  ML AHK+Q+VWFR+GWW  SR V+ N+ 
Sbjct: 215 YLHSLVTMLVAHKSQMVWFRWGWWTASRYVYANEF 249

>TBLA0B03300 Chr2 (771332..772291) [960 bp, 319 aa] {ON} Anc_8.846
           YMR281W
          Length = 319

 Score =  175 bits (443), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 174/320 (54%), Gaps = 41/320 (12%)

Query: 5   NFSRFIYKVTKLSLLLGILYIYASTS----KIGSFNYTN----LETLGEH-DINSVNLVI 55
           NFS    +  KL L+  ++YI+ S S       SFNY N    L +  +H  INS++L+I
Sbjct: 2   NFSTNEIRTVKLILIFWLIYIFNSNSIKLLNDQSFNYFNKHIQLMSNKQHVKINSLSLII 61

Query: 56  AHPDDEVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVRE----QELSDSIAML 111
           AHPDDE+MFF+P+L+ LN  + +   +FN++C S  G D  G+ ++     EL+DS+ +L
Sbjct: 62  AHPDDEIMFFSPTLLQLNNYL-EKDIMFNVVCLS-QGLDSTGSFKDPQRVHELNDSLNLL 119

Query: 112 L-------PTRNTSIVVLDFKDGMKEKWDVKEMIAKL-RNI-VPKLGHNVLLTFDGKGVS 162
                     RN  ++ LD+ DGMKE W++  ++  L +N+     G N+LLTFD  GVS
Sbjct: 120 FNRGSNNEHNRNFKLIQLDYTDGMKEIWNMDLIVDDLLQNLNFTDNGINLLLTFDKSGVS 179

Query: 163 GHLNHIACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWEL-----------I 211
            H NH+AC  A             L  + L S+SKN   KYS ++ +L           I
Sbjct: 180 NHKNHLACNEAVTKLLKYSNPDSNLIGIFLNSHSKNFFLKYSFFVSKLFTIIKLKFFRSI 239

Query: 212 KLLYSSWVPS----RLGNVLPKRGSNVARKI--TIFSTYPQYVLSLAAMLNAHKTQVVWF 265
            L YS   P+    +   ++     N    +  T F+ + +Y+LS + MLNAH++Q+VWF
Sbjct: 240 SLFYSFCFPNSDFLQSYQIISHYDLNTKTNLSFTFFNPFAKYMLSYSTMLNAHESQMVWF 299

Query: 266 RYGWWFFSRLVFVNDLDVIS 285
           RY WW FSR  F+NDL +++
Sbjct: 300 RYLWWIFSRFAFINDLTIVN 319

>KLLA0D01430g Chr4 complement(122369..123160) [792 bp, 263 aa] {ON}
           similar to uniprot|Q75DZ3 Ashbya gossypii ABL120W
           ABL120Wp and weakly similar to YMR281W uniprot|P23797
           Saccharomyces cerevisiae YMR281W GPI12 ER membrane
           protein involved in the second step of
           glycosylphosphatidylinositol (GPI) anchor assembly the
           de- N-acetylation of the N-
           acetylglucosaminylphosphatidylinositol intermediate
           functional homolog of human PIG-Lp
          Length = 263

 Score =  173 bits (438), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 98/234 (41%), Positives = 137/234 (58%), Gaps = 22/234 (9%)

Query: 48  INSVNLVIAHPDDEVMFFAPSLINLNEQIRDPSTVFNIICFSNGGADGLGNVREQELSDS 107
           + SV LV+AHPDDEVMFF+P+L   NE +   S   N++C + G ADGLG++R+QEL DS
Sbjct: 48  LTSVTLVVAHPDDEVMFFSPTLTQFNE-LLPISIPINVVCMTAGDADGLGHIRKQELVDS 106

Query: 108 IAMLLPTRNTSIVVLDFKDGMKEKWDVKEMIAKLRNIVPKLGHNVLLTFDGKGVSGHLNH 167
           + ++   R     VLDF+DGM   WD   +  +LR+ +P   + ++LTFD  GVSGH+NH
Sbjct: 107 LRIMFHGRQFGCDVLDFEDGMDAVWDQVLLEKQLRSSIPD-SNPLVLTFDQFGVSGHINH 165

Query: 168 IACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPSRLGNVL 227
           I+C R       +     KL + S Q     I  KYS++I  + +L  S+        V 
Sbjct: 166 ISCGRLV----EKLPYSHKLHLRSDQP----IYVKYSAFIAGIFQLGIST--------VY 209

Query: 228 PKRGSNVARKITIFSTYPQYVLSLAAMLNAHKTQVVWFRYGWWFFSRLVFVNDL 281
           P  G    +     ST PQY+L+ +AM  AH +Q+VWFR GWW FSR  F+N+L
Sbjct: 210 PDYG----KPRCFISTLPQYLLAASAMSLAHTSQMVWFRVGWWLFSRFCFINEL 259

>NCAS0F03160 Chr6 (633224..644422) [11199 bp, 3732 aa] {ON} Anc_5.402
            YHR099W
          Length = 3732

 Score = 35.4 bits (80), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            LT +   +S   N I+CY  A G Y   K++  L     ++S+   S ++ K + S+  E
Sbjct: 3054 LTEEPNNISYASNAISCYLQAAGLYKNSKTRNLLCRILWLISMDDASGSLSKAFDSFRGE 3113

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3114 VPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3151

>TBLA0A03540 Chr1 (877387..888828) [11442 bp, 3813 aa] {ON} Anc_5.402
            YHR099W
          Length = 3813

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K+++ L     ++S+   +  I   + S+  E
Sbjct: 3132 LSDEPNNISFASNTISCYLQAAGLYKNSKTRRLLCRILWLISMDDGTNAIANAFDSFRGE 3191

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  TYPQ
Sbjct: 3192 VPVWYWITYIPQLLTS-LSHKEANMVRQILIRIAKTYPQ 3229

>Kwal_47.17102 s47 complement(250539..251396) [858 bp, 285 aa] {ON}
           YLR426W - 1:1 [contig 215] FULL
          Length = 285

 Score = 33.5 bits (75), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 42/180 (23%), Positives = 72/180 (40%), Gaps = 33/180 (18%)

Query: 69  LINLNEQIR------DPSTVFNIICFSNGGADGLGNVREQELSDSIAMLLPTRNTSIVVL 122
           +I LN +++      + S + N +C   GG++GLG    QE       LL   N +++ L
Sbjct: 11  MIKLNTRLKLRGEWVELSKIDNAVCVVTGGSNGLGRAIVQEF------LLKLPNVTLISL 64

Query: 123 DFKDGMKEKWDVKEMIAKLRN---------IVPKLGHNVLLTFDGKGVSGHLNHIACYRA 173
           D +   K   +V      L N         IV +   +V +  +  G+          RA
Sbjct: 65  DIEPPKKSFPNVYHYTCDLSNSSDVDQTLKIVKRNHGDVTVLINNAGI----------RA 114

Query: 174 ALGYYNEFKSKQKLTVLSLQSYSK-NIVKKYSSYIWELIKLLYSSWVPSRLGNVLPKRGS 232
               + E   +    V  +  ++   +V++ S    +L +  Y+  V S LG   P RGS
Sbjct: 115 KYQNFRELSKEVADKVFQVNVFTPMRLVQELSPKAGDL-RQFYAVTVASALGVCAPARGS 173

>TDEL0E02220 Chr5 complement(415477..426681) [11205 bp, 3734 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3734

 Score = 33.9 bits (76), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K+++ L     ++S+   S ++   + S+  E
Sbjct: 3053 LSEEPNNISFASNAISCYLQAAGLYKNAKTRKLLCRILWLISMDDSSGSLTNAFESFRGE 3112

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3113 IPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3150

>YMR221C Chr13 complement(713931..715445) [1515 bp, 504 aa] {ON}
           Putative protein of unknown function; the authentic,
           non-tagged protein is detected in highly purified
           mitochondria in high-throughput studies; physical
           interaction with Atg27p suggests a possible role in
           autophagy
          Length = 504

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 48/101 (47%), Gaps = 19/101 (18%)

Query: 160 GVSGHLNHIACYRAALGYYNEFKSKQKLTVLSLQSYSKNIVKKYSSYIWELIKLLYSSWV 219
            V+G    I+C++ A    N F  +   TVL+L + S +     SS ++ L +LLY +W 
Sbjct: 129 AVAGPFVFISCFQLA----NSFPQRSG-TVLALLTGSFD----SSSALFLLYRLLYQNWF 179

Query: 220 PSRLGNVLPKRGSNVARKITIFSTYPQYVLSLAAMLNAHKT 260
           P+           NV+R  T++   P ++L+    +  H +
Sbjct: 180 PTL----------NVSRFFTLYLIVPVFILACQLTIMPHSS 210

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score = 33.5 bits (75), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 43/89 (48%), Gaps = 10/89 (11%)

Query: 33  GSFNYTNLETLGEHDINSVNLVIAHP-DDEVMFFAPSLI------NLNEQIRDPSTVFNI 85
           G+  Y     L E +   V  +  HP DD +++   S+I      +L EQ  DPS V  I
Sbjct: 123 GADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVKAI 182

Query: 86  ICFSNGGA--DGLGNVREQ-ELSDSIAML 111
           +C   GG   +GL    E+ +L+D I ++
Sbjct: 183 VCSVGGGGLYNGLMQGLERYKLADKIPIV 211

>KLTH0E02530g Chr5 complement(221189..232354) [11166 bp, 3721 aa] {ON}
            similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3721

 Score = 33.5 bits (75), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ + + +S   N I+CY  A G YN  K+++ L     ++ ++  +  +   + S+  E
Sbjct: 3040 LSEEPQNISFANNAISCYLQAAGLYNNSKTRKLLCRILWLIGIEDSTGTLAGAFESFRGE 3099

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3100 IPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3137

>CAGL0A01914g Chr1 (195146..206377) [11232 bp, 3743 aa] {ON} highly
            similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099w TRA1
          Length = 3743

 Score = 33.1 bits (74), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 48/99 (48%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            LT +   +S   N I+CY  A G Y   K  + L     ++S+   S +I   + S+  E
Sbjct: 3063 LTEEPNNISFASNAISCYLQAAGLYKNSKIHELLCRILWLISMDDSSGSIANAFESFRGE 3122

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3123 VPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3160

>Kwal_55.20011 s55 complement(211222..222399) [11178 bp, 3725 aa] {ON}
            YHR099W (TRA1) - ATM/Mec1/TOR1+2-related [contig 157]
            FULL
          Length = 3725

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/99 (24%), Positives = 51/99 (51%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ + + +S   N I+CY  A G YN  K+++ L     ++ ++  +  +   + S+  E
Sbjct: 3044 LSEEPQNISFANNAISCYLQAAGLYNNAKTRKLLCRILWLIGIEDSTGTLSSAFESFRGE 3103

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3104 VPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3141

>NDAI0C04630 Chr3 (1055407..1066674) [11268 bp, 3755 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3755

 Score = 33.1 bits (74), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 166  NHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPS 221
            N I+CY  A G Y   K++  L     ++S+   S ++ K + S+  E+    + +++P 
Sbjct: 3088 NAISCYLQAAGLYKSSKTRNLLCRILWLISMDDASGSLSKAFDSFRGEVPVWYWITFIPQ 3147

Query: 222  RLGNVLPKRGSNVARK--ITIFSTYPQ 246
             L + L  + +N+ R+  I I  +YPQ
Sbjct: 3148 LLTS-LSHKEANMVRQILIRIAKSYPQ 3173

>ZYRO0A06534g Chr1 complement(520491..531740) [11250 bp, 3749 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3749

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K+++ L     ++S+   S ++   + S+  E
Sbjct: 3071 LSEEPNNISFASNAISCYLQAAGLYKCAKTRKLLCRILWLISMDDASGSLANAFESFRGE 3130

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3131 VPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3168

>KNAG0C05130 Chr3 complement(986756..997984) [11229 bp, 3742 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3742

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L  +   +S   N I+CY  A G Y   K++  L     ++S+   + ++ K + S+  E
Sbjct: 3063 LVEEPNNISYASNAISCYLQAAGLYKNPKTRSLLCRILWLISMDDDAGSLTKAFESFRGE 3122

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3123 VPVWYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3160

>Suva_7.277 Chr7 complement(481312..482109) [798 bp, 265 aa] {ON}
           YGL005C (REAL)
          Length = 265

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 23/70 (32%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 195 YSKNIVKKYSSYIWELIKL---LYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVL-S 250
           Y+KN+ K+  + IW L KL   L  +W PSR      K  S+V    ++ S+  +Y L +
Sbjct: 42  YTKNLTKELENTIWNLDKLSQTLPMAWPPSRSSEESDKDDSSVYSTESLRSSKLEYYLDT 101

Query: 251 LAAMLNAHKT 260
           L + + A +T
Sbjct: 102 LGSAVRALET 111

>Kpol_530.8 s530 complement(14877..17516,17519..26101) [11223 bp, 3740
            aa] {ON} complement(14877..17516,17519..26101) [11223 nt,
            3741 aa]
          Length = 3740

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y + K+++ L     ++SL   S ++   + S+  E
Sbjct: 3059 LSEEPSNISFASNAISCYLQAAGLYKKSKTRKLLCRILWLISLDDPSGSLSNAFESFRGE 3118

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    +  ++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3119 VPVWYWIMFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3156

>TPHA0E01900 Chr5 complement(381017..392239) [11223 bp, 3740 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3740

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 45/87 (51%), Gaps = 7/87 (8%)

Query: 166  NHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWELIKLLYSSWVPS 221
            N I+CY  A G Y + K+++ L     ++SL   S  +   + S+  E+    + +++P 
Sbjct: 3072 NAISCYLQAAGLYKKAKTRRLLCRILWLISLDDTSGALSNAFDSFRGEVPVWYWITFIPQ 3131

Query: 222  RLGNVLPKRGSNVARKITI--FSTYPQ 246
             L + L  + +N+ R+I I    +YPQ
Sbjct: 3132 LLTS-LSHKEANMVRQILIRVAKSYPQ 3157

>KAFR0E04070 Chr5 complement(804691..815892) [11202 bp, 3733 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3733

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 47/96 (48%), Gaps = 7/96 (7%)

Query: 157  DGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWELIK 212
            +   +S   N I+CY  A G Y   K++  L     ++S+   S ++   + S+  E+  
Sbjct: 3055 EPNNISFASNAISCYLQAAGLYKNAKTRNLLCRILWLISMDDASGSLTNAFDSFRGEVPV 3114

Query: 213  LLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
              + +++P  L + L  + +N+ R+  I I  +YPQ
Sbjct: 3115 WYWITFIPQLLTS-LSHKEANMVRQILIRIAKSYPQ 3149

>YGL005C Chr7 complement(489708..490547) [840 bp, 279 aa] {ON}
           COG7Component of the conserved oligomeric Golgi complex
           (Cog1p through Cog8p), a cytosolic tethering complex
           that functions in protein trafficking to mediate fusion
           of transport vesicles to Golgi compartments
          Length = 279

 Score = 31.2 bits (69), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 195 YSKNIVKKYSSYIWELIKL---LYSSWVPSRLGNVLPKRGSNVARKITIFSTYPQYVL-S 250
           Y+KN+ K+  S IW L KL   L  +W  SR      +  S++    ++ S+  +Y L +
Sbjct: 57  YTKNLTKELESTIWNLDKLSQTLPRTWASSRYHKEAEQNDSSLYSTESLKSSKLEYYLDT 116

Query: 251 LAAMLNAHKT 260
           LA+ + A +T
Sbjct: 117 LASAVRALET 126

>ADL197C Chr4 complement(350991..352163) [1173 bp, 390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL326C
          Length = 390

 Score = 31.2 bits (69), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 9   FIYKVTKLSLLLGILYIYASTSKIGSFNYTNLETLGEHDINSVNLVIAHPDDEVMFFAPS 68
           FI     L+L+  ILY Y ST  +G  +  + E L   D+N V   +  P D   F A  
Sbjct: 102 FIQGTVLLTLVPLILYAYFSTIAVGPGSPLDFEELRIRDLNDVETGMEFPPD---FLAAK 158

Query: 69  LINLNEQIR 77
            + L+   R
Sbjct: 159 TVTLDSTGR 167

>SAKL0G07458g Chr7 complement(609418..620595) [11178 bp, 3725 aa] {ON}
            highly similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3725

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 46/98 (46%), Gaps = 5/98 (5%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ D   +S   N I+CY  A G Y   K+++ L     ++ +   S ++   + S+  E
Sbjct: 3044 LSEDPNNISFANNAISCYLQAAGLYKNSKTRKLLCRILWLIGMDDTSGSLASAFDSFRGE 3103

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVAR-KITIFSTYPQ 246
            +    + +++P  L ++  K    V +  I I  +YPQ
Sbjct: 3104 IPVWYWITFIPQLLTSLSHKEAGMVRQILIRIAKSYPQ 3141

>Skud_8.160 Chr8 (276598..287829) [11232 bp, 3743 aa] {ON} YHR099W
            (REAL)
          Length = 3743

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K ++ L     ++S+   S  +   + S+  E
Sbjct: 3067 LSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISMDDASGMLTNAFDSFRGE 3126

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R   I I  +YPQ
Sbjct: 3127 IPVWYWITFIPQLLTS-LSHKEANMVRHILIRIAKSYPQ 3164

>Smik_8.177 Chr8 (279199..290433) [11235 bp, 3744 aa] {ON} YHR099W
            (REAL)
          Length = 3744

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K ++ L     ++S+   S  +   + S+  E
Sbjct: 3068 LSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISMDDASGMLTNAFDSFRGE 3127

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R   I I  +YPQ
Sbjct: 3128 IPVWYWITFIPQLLTS-LSHKEANMVRHILIRIAKSYPQ 3165

>Suva_15.294 Chr15 (505128..516362) [11235 bp, 3744 aa] {ON} YHR099W
            (REAL)
          Length = 3744

 Score = 30.4 bits (67), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K ++ L     ++S+   S  +   + S+  E
Sbjct: 3068 LSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISMDDASGMLTNAFDSFRGE 3127

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R   I I  +YPQ
Sbjct: 3128 IPVWYWITFIPQLLTS-LSHKEANMVRHILIRIAKSYPQ 3165

>YHR099W Chr8 (302761..313995) [11235 bp, 3744 aa] {ON}  TRA1Subunit
            of SAGA and NuA4 histone acetyltransferase complexes;
            interacts with acidic activators (e.g., Gal4p) which
            leads to transcription activation; similar to human
            TRRAP, which is a cofactor for c-Myc mediated oncogenic
            transformation
          Length = 3744

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 47/99 (47%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ +   +S   N I+CY  A G Y   K ++ L     ++S+   S  +   + S+  E
Sbjct: 3068 LSEEPNNISFASNAISCYLQAAGLYKNSKIRELLCRILWLISIDDASGMLTNAFDSFRGE 3127

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P  L + L  + +N+ R   I I  +YPQ
Sbjct: 3128 IPVWYWITFIPQLLTS-LSHKEANMVRHILIRIAKSYPQ 3165

>SAKL0B07832g Chr2 (668304..669746) [1443 bp, 480 aa] {ON} similar
           to uniprot|P16661 Saccharomyces cerevisiae YBR110W ALG1
           Mannosyltransferase in the endoplasmic reticulum
          Length = 480

 Score = 30.0 bits (66), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 26/51 (50%)

Query: 16  LSLLLGILYIYASTSKIGSFNYTNLETLGEHDINSVNLVIAHPDDEVMFFA 66
           L L + IL ++ S   + + NY  L+ L +HD+N +  +      E + FA
Sbjct: 393 LDLPMKILDMFGSGLPVIALNYPVLDELVQHDVNGLKFIDRRELHEALIFA 443

>KLLA0F22066g Chr6 complement(2051033..2062327) [11295 bp, 3764 aa]
            {ON} similar to uniprot|P38811 Saccharomyces cerevisiae
            YHR099W TRA1 Histone acetyltransferase component putative
            ortholog of human TRRAP which is an essential cofactor of
            c-Myc
          Length = 3764

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 154  LTFDGKGVSGHLNHIACYRAALGYYNEFKSKQKLT----VLSLQSYSKNIVKKYSSYIWE 209
            L+ + K +S   N ++CY  A G Y   K+++ L+    +L     S ++   + S+  E
Sbjct: 3060 LSEEPKNISFASNAMSCYLQAAGLYKNSKTRKLLSRILWLLGRDDSSNSLAYAFDSFRGE 3119

Query: 210  LIKLLYSSWVPSRLGNVLPKRGSNVARK--ITIFSTYPQ 246
            +    + +++P +L   L  + + + RK  I I  +YPQ
Sbjct: 3120 IPVWYWITFIP-QLLTALSHKEAFLVRKILIRIAKSYPQ 3157

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,953,835
Number of extensions: 1360680
Number of successful extensions: 3926
Number of sequences better than 10.0: 53
Number of HSP's gapped: 3943
Number of HSP's successfully gapped: 53
Length of query: 286
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 178
Effective length of database: 41,097,471
Effective search space: 7315349838
Effective search space used: 7315349838
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)