Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002308.847ON47447424970.0
KAFR0B039708.847ON4744084202e-45
SAKL0D01298g8.847ON5514303926e-41
TPHA0I002908.847ON5694493716e-38
KLTH0C03718g8.847ON5514323565e-36
ZYRO0G14322g8.847ON5504493195e-31
YMR282C (AEP2)8.847ON5804033161e-30
Smik_13.4958.847ON5763893134e-30
Skud_13.4548.847ON5803743117e-30
Kwal_27.102248.847ON5464483091e-29
Kpol_1068.38.847ON5664603045e-29
TDEL0B005108.847ON5503642781e-25
Suva_13.4718.847ON5813732772e-25
Ecym_46188.847ON5274112593e-23
KLLA0D01408g8.847ON5184142283e-19
NCAS0C003708.847ON4954682273e-19
NDAI0K003408.847ON6244022222e-18
ABL119C8.847ON5374261599e-11
CAGL0M03069g8.847ON5483541543e-10
TBLA0B033108.847ON6133831526e-10
Smik_10.3041.157ON83691732.2
Kpol_2002.121.9ON73996688.9
KAFR0I007508.560ON84581689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00230
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.84...   966   0.0  
KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {O...   166   2e-45
SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly s...   155   6e-41
TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}...   147   6e-38
KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly...   141   5e-36
ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]...   127   5e-31
YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON} ...   126   1e-30
Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {...   125   4e-30
Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {...   124   7e-30
Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282...   123   1e-29
Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..599...   121   5e-29
TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847...   111   1e-25
Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {...   111   2e-25
Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {O...   104   3e-23
KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly...    92   3e-19
NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847...    92   3e-19
NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON...    90   2e-18
ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON} S...    66   9e-11
CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa] ...    64   3e-10
TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {O...    63   6e-10
Smik_10.304 Chr10 complement(469092..471602) [2511 bp, 836 aa] {...    33   2.2  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....    31   8.9  
KAFR0I00750 Chr9 (150956..153493) [2538 bp, 845 aa] {ON} Anc_8.5...    31   9.0  

>KNAG0J00230 Chr10 (30660..32084) [1425 bp, 474 aa] {ON} Anc_8.847
           YMR282C
          Length = 474

 Score =  966 bits (2497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 465/474 (98%), Positives = 465/474 (98%)

Query: 1   MLSMLSRSPVWLKIPTVTCNRVGYSTLRETLQTKNRLINDTVNPQENSQGPNIHKCVTNK 60
           MLSMLSRSPVWLKIPTVTCNRVGYSTLRETLQTKNRLINDTVNPQENSQGPNIHKCVTNK
Sbjct: 1   MLSMLSRSPVWLKIPTVTCNRVGYSTLRETLQTKNRLINDTVNPQENSQGPNIHKCVTNK 60

Query: 61  YPASNNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFM 120
           YPASNNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFM
Sbjct: 61  YPASNNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFM 120

Query: 121 RYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKFDVFMIKNYT 180
           RYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKFDVFMIKNYT
Sbjct: 121 RYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKFDVFMIKNYT 180

Query: 181 KLRCGSSFGKQTLNNKAYKVFDQNTVFQLIGKVEADRKFAFWNNEIVSSLGYTNNITLME 240
           KLRCGSSFGKQTLNNKAYKVFDQNTVFQLIGKVEADRKFAFWNNEIVSSLGYTNNITLME
Sbjct: 181 KLRCGSSFGKQTLNNKAYKVFDQNTVFQLIGKVEADRKFAFWNNEIVSSLGYTNNITLME 240

Query: 241 IYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVER 300
           IYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVER
Sbjct: 241 IYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVER 300

Query: 301 FAKSYPKLLLNVHFWSTLLNCAIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLV 360
           FAKSYPKLLLNVHFWSTLLNCAIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLV
Sbjct: 301 FAKSYPKLLLNVHFWSTLLNCAIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLV 360

Query: 361 TILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNW 420
           TILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNW
Sbjct: 361 TILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNW 420

Query: 421 CTAFIDQWSIDASNKEDLEAFYESRVDVRESKTRREKAYXXXXXXXXXIIGRLW 474
           CTAFIDQWSIDASNKEDLEAFYESRVDVRESKTRREKAY         IIGRLW
Sbjct: 421 CTAFIDQWSIDASNKEDLEAFYESRVDVRESKTRREKAYDDMDDDEDMIIGRLW 474

>KAFR0B03970 Chr2 complement(830202..831626) [1425 bp, 474 aa] {ON}
           Anc_8.847 YMR282C
          Length = 474

 Score =  166 bits (420), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 191/408 (46%), Gaps = 32/408 (7%)

Query: 86  TAMQFSVLLNR------VLASQNYRHLDSKEN-VEKFFAIFMRYKGAIALQSNKLTQIQL 138
           T+M  ++ LNR      +  S+ Y     KE   E  F +F  Y   I+    +LT +Q+
Sbjct: 80  TSMHATIDLNRFARLINIALSEKYNIQRIKERRPEIIFQLFETYVKLIS-SHEELTILQV 138

Query: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQDV----KFDVFMIKNYTKLRCGSSFGKQTLN 194
            D N   +YF+   QLKKAQL+M +L+ +      K+DV   +NY KL CG+       N
Sbjct: 139 EDMNKFINYFVEFKQLKKAQLVMKYLILKSPRVLEKYDVSTTRNYLKLNCGACHELWYTN 198

Query: 195 NKAYKVFD-QNTVFQLIGKVEADRKFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHD 253
              YK+FD  NT    + K   D K  +W+ EI+ SLGY+  I  +E YI   W IS+ D
Sbjct: 199 ---YKIFDFNNTTLDKLVKYSLDNKIGYWDVEIIHSLGYSGRIRSLEDYILKKWGISLCD 255

Query: 254 HSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVH 313
            +  N   +         P S+VL  I++ +   D+ M RA+ I+  F   YP L L + 
Sbjct: 256 RAQVNTTNEA--------PESEVLEAIINGFFYRDKRMFRAIKILNEFVNVYPDLNLKIT 307

Query: 314 FWSTLLNCAIKCGGSKDPSQ---FLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTS 370
           FW T +N  IK    K   +    +  W  MK+W+T  ++ +PF    L  +    ++ +
Sbjct: 308 FWKTFMNNCIKEWDEKVDQKGVVIVEYWETMKRWYTVHNRRIPFNINFLKVMRTCFKKNN 367

Query: 371 NLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSI 430
           NL    DI Q      Y     + + E +V+ +YQ  IL +L++K+ ++    FI+    
Sbjct: 368 NLVLATDIFQNCFHNFYFCATRMNDSELNVIKEYQNFILSRLIEKKGFSNALTFINDHCF 427

Query: 431 DASNKEDLEAFYESRVDVRESKTRR----EKAYXXXXXXXXXIIGRLW 474
              NK  L  +Y  R + +  K  R    EK Y         IIG+LW
Sbjct: 428 SLENKRQLMNYYHGRKEHKLKKMTRNENLEKTY-DDMVEEDFIIGKLW 474

>SAKL0D01298g Chr4 (98188..99843) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  155 bits (392), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 107/430 (24%), Positives = 209/430 (48%), Gaps = 49/430 (11%)

Query: 86  TAMQFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHD 140
           T +++SV +N++L++ N +      +    + E  F ++  Y+ ++   +  LT +QL+D
Sbjct: 130 TKLEYSVFVNKLLSNTNLKSELTNLIPGTVHTEVLFKLYEIYRDSVVGNAT-LTPVQLYD 188

Query: 141 FNLMCDYFIACNQLKKAQLIMDFLLQQ--DVKFDVFMIKNYTKLRCGS------------ 186
            N     F    QL KAQ ++ F+L+    +  D   + NY +L+CG+            
Sbjct: 189 LNQFIKRFTGDAQLAKAQQVLGFVLENYGSIPRDPQTLINYLELKCGAMPRNWSIPLSRP 248

Query: 187 ----SFGKQTLNNK---AYKVFDQNTVFQLIGKVEADRKFAFWNN-----EIVSSLGYTN 234
               + G Q+  +    +YKV +   +  LI ++  DR + +  N      ++ SLGY  
Sbjct: 249 ELGKTLGSQSFMSNLAHSYKVLETEALLPLIDEMMKDRAWHYKRNCDLEAAVIYSLGYMG 308

Query: 235 NITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRA 294
              L+E YI   W +S+  +++  +++        +YP+S +L +IVS YA     + +A
Sbjct: 309 QFALLERYIKHTWGVSVSSNTSTEVEVP-----KNLYPTSNLLISIVSCYAMKG-NLHQA 362

Query: 295 VDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA--CWNLMKKWHTQRSKL 351
           + I++ F   +P++ L   FW  L   + +    K DP   L+  CW +MK+WH ++ + 
Sbjct: 363 LQIIDSFLSKFPQIELEPLFWRRLFQWSTRLWNQKTDPKGELSNGCWQVMKQWHNKQKRS 422

Query: 352 MPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRK 411
           +P    +L      +++T+N    + I    L  LY+KR N+ + E DV+ K+QK IL+K
Sbjct: 423 LPIDLGILNERYYVLKRTNNFTEALRIHDEALAGLYMKR-NLIDPEVDVIKKFQKLILKK 481

Query: 412 LVDKRKYNWCTAFIDQWSIDASNKEDLEAFYE-------SRVDVRESKTRREKAYXXXXX 464
           +  +  Y+    +I +W ++  N+ ++  +++       +R++ R+ K    +       
Sbjct: 482 MAGRGYYHKPLKYISEWCLNKRNELEMREYFDRHRKAYITRIEQRKQKQETAQVTFDAEE 541

Query: 465 XXXXIIGRLW 474
               ++GRLW
Sbjct: 542 EDDMLLGRLW 551

>TPHA0I00290 Chr9 complement(55148..56857) [1710 bp, 569 aa] {ON}
           Anc_8.847 YMR282C
          Length = 569

 Score =  147 bits (371), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 117/449 (26%), Positives = 208/449 (46%), Gaps = 63/449 (14%)

Query: 86  TAMQFSVLLNRVLASQNY-------RHLDSKENVEKFFAIFMRYKGAIALQSNKLTQIQL 138
           T  +FS+ LNR++  + +       +   + ++ E  F +F  Y  AI   S+KL+ + L
Sbjct: 124 TFNEFSIFLNRLIDRKGFIYDSIVLKEFPNGKHSEMVFKLFQLYGNAIG--SDKLSLLSL 181

Query: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQDVK----FDVFMIKNYTKLRCGS-------- 186
            D NL  ++FI    L +A++++ F+L +       +DV  + +Y +LRCG+        
Sbjct: 182 RDMNLFIEFFINEGHLGRAEIVLTFVLNKTRSILDLYDVDTVTHYLQLRCGALPRYWMFQ 241

Query: 187 ----------SFG------KQTLNNK--------AYKVFDQNTVFQLIGKVEADRKF--- 219
                      FG      K  L  K         YK+ D   V ++  K+  D K+   
Sbjct: 242 NKSAELAYKDKFGNRLSKYKTRLGRKNFAVKLTNRYKILDPLGVLKIANKIITDDKWKSN 301

Query: 220 --AFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYP-SSKV 276
             A  +  +V SL Y+  ++ +  YI   W + I   S  N  +      +A  P  S+V
Sbjct: 302 HSAKLDATVVYSLCYSGQLSNIPSYINSRWNVDI-SMSDGNSDVGTQISNEASKPLPSEV 360

Query: 277 LATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK---DPSQ 333
           +  I+SSY+  D++++RA++I+++   SYP L LN  FW  L+  ++ C   K     S 
Sbjct: 361 MEAILSSYSYDDKSIERAINIIDKIMNSYPNLELNQQFWRRLMQWSVLCWDHKLDRKGSL 420

Query: 334 FLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNI 393
              C+  +KK+H  RS  + F   LL  +   +  T N     +++  ++   + KR + 
Sbjct: 421 VYGCFKTLKKYHEMRSIRINFDEGLLQELYTLVYYTKNSRIAAEVVSEFMPQFFYKRSDE 480

Query: 394 PEF-ERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRESK 452
             F ER +L  +QK+ +  ++ K+ Y   + FI++WS+D  NKE+L  +Y+  +  +  K
Sbjct: 481 ITFGERKLLFYFQKRSIDGMLGKKDYFTASNFIEKWSMDNQNKEELFKYYKDSIAKKLQK 540

Query: 453 TRR-------EKAYXXXXXXXXXIIGRLW 474
            RR       ++           ++GRLW
Sbjct: 541 VRRNSLQQKIKEKLEDHSDEDDTLLGRLW 569

>KLTH0C03718g Chr3 (321675..323330) [1656 bp, 551 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 551

 Score =  141 bits (356), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 110/432 (25%), Positives = 198/432 (45%), Gaps = 59/432 (13%)

Query: 89  QFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNL 143
           +FS  +  +L+  N  H     L +    E  F+++  Y   +      L+ +QLHDFN 
Sbjct: 133 EFSAFIEGLLSVNNLLHKLSATLPNVSGTEMVFSLYQLYLKTVT--PGPLSPLQLHDFNK 190

Query: 144 MCDYFIACNQLKKAQLIMDFLLQQD---VKFDVFMIKNYTKLRCGS----------SFGK 190
              +FI   QL+KAQ ++D +L+ +   +  D     +Y +LRCG+          + G+
Sbjct: 191 FIRFFIRSAQLRKAQTVLDCILKSNNNQLPCDSATATHYLQLRCGALPRNWKVLDENLGR 250

Query: 191 QT----------LNNKAYKVFDQNTVFQLIG------KVEADRKFAFWNNEIVSSLGYTN 234
            T          L + +YK  D  +V   +        V   RK A   + +V SLG+  
Sbjct: 251 STRLGARKNRYQLVSHSYKALDHKSVLTFMSLLSDPKSVWFHRKSAALESAVVYSLGFMG 310

Query: 235 NITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMY--PSSKVLATIVSSYARHDQTMK 292
            + L+E ++W  W IS+ +H+         Q  DA +  PSS+VL  +++SYA  ++ + 
Sbjct: 311 QLKLLEEHVWRNWGISLQEHN---------QVTDASFTSPSSEVLVAVLTSYAS-NKNIS 360

Query: 293 RAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA--CWNLMKKWHTQRS 349
            A+ +++ F   YP L L+  FW  L   + +    K DP   L+  CW +M++WH  R+
Sbjct: 361 SALHLIDGFMAKYPTLELDHVFWRRLFQWSTRVWSEKTDPRGELSRGCWRVMREWHAARN 420

Query: 350 KLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQIL 409
           + +P  + LL      + +T+N    +++++      + ++ N+   E  +  K+ K IL
Sbjct: 421 RQLPADAVLLNERFVVLSRTNNYRDAIEVVEQCYSS-FFQKANLSRHEAVLFQKFAKLIL 479

Query: 410 RKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRES-KTRREKAYXXX------ 462
           + +     Y+    FI +WS +   +  L A++E   +   + K RR +A          
Sbjct: 480 KNMAHLGYYHKPLKFIKEWSPNKLLEHTLRAYFEKHRNAYSARKQRRTEAAQKAQKRFDD 539

Query: 463 XXXXXXIIGRLW 474
                 ++GRLW
Sbjct: 540 EEEDSMLLGRLW 551

>ZYRO0G14322g Chr7 complement(1146574..1148226) [1653 bp, 550 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282C AEP2 Mitochondrial protein likely
           involved in translation of the mitochondrial OLI1 mRNA
           exhibits genetic interaction with the OLI1 mRNA 5'-
           untranslated leader
          Length = 550

 Score =  127 bits (319), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 109/449 (24%), Positives = 205/449 (45%), Gaps = 70/449 (15%)

Query: 78  NVFNILSPTAMQFSVLLNRVLASQNYRHLDSK--------ENVEKFFAIFMRYKGAIALQ 129
            +F     T  ++S+ +N++L+ +    LD K         + E  + ++  Y   I  Q
Sbjct: 120 GLFTTGGLTKSEYSLFINKLLSEE---ELDVKLSNVIPDTPHTELIYKLYEFYCDHIVDQ 176

Query: 130 SNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQD------VKFDVFMIKNYTKLR 183
            N LT +QL+D NL    FIA  QL KA  ++DF+L +          DV ++  + +L+
Sbjct: 177 HN-LTPLQLYDLNLFLKTFIAEAQLSKAHNVLDFILLRRPLNDLLANTDVEILIQFLRLK 235

Query: 184 CGS------------------SFGKQTLN---NKAYKVFDQNTVFQLIGKVEAD-----R 217
           CG+                  + G++  +    K+YK  ++  + Q+I  V  +     R
Sbjct: 236 CGALSKFWKIQPASQRNSTAITLGEKASDCHLAKSYKFQNEKVLLQIINSVLGEHNWKNR 295

Query: 218 KFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVL 277
           +    +  I+ SLGY     L+E Y+   W  S      E +K +         P+S +L
Sbjct: 296 RSPKLDAAIIYSLGYLGQTDLIEKYVNRTWSPS----KDEGVKTN---------PNSDLL 342

Query: 278 ATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSK-DPSQFLA 336
             +++SY   +  M++ +++++RF + YP++ L+  FW  LL  +      K D    L+
Sbjct: 343 VAVLTSYCVKEGNMRKGLEVLDRFIRDYPEVELDPLFWRRLLQLSSLLWDKKRDRKATLS 402

Query: 337 --CWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDIL-QYWLGPLYLKRGNI 393
             CW +MK+WH QR + +P+   ++  +     +T N +G ++++ + + G        I
Sbjct: 403 HGCWTIMKQWHAQRQRKIPYDYGIMKELYPIFVRTKNKNGALEVITKSFFGAFIQPEFTI 462

Query: 394 PEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY--------ESR 445
              E  +L KYQ+ IL+ +  K  Y+    F  +WS  ++NK +L++++        + R
Sbjct: 463 RPNELSLLCKYQRFILKMIALKGNYHKGFEFCQEWSFSSTNKFELQSYFMKWRGIHEQRR 522

Query: 446 VDVRESKTRREKAYXXXXXXXXXIIGRLW 474
               + K   ++ Y         ++GRLW
Sbjct: 523 TSQSKQKAALQEKY-DEMEEDDMLLGRLW 550

>YMR282C Chr13 complement(833356..835098) [1743 bp, 580 aa] {ON}
           AEP2Mitochondrial protein, likely involved in
           translation of the mitochondrial OLI1 mRNA; exhibits
           genetic interaction with the OLI1 mRNA 5'-untranslated
           leader
          Length = 580

 Score =  126 bits (316), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 104/403 (25%), Positives = 178/403 (44%), Gaps = 58/403 (14%)

Query: 123 KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFM 175
           +  + L++ KL   ++ D NLM   FI   QL KAQ I+ F+L ++          D+  
Sbjct: 185 RNQVNLRNTKLDACEIFDANLMIKNFIELGQLGKAQKILSFILDRNPDILLSPKNADIST 244

Query: 176 IKNYTKLRCGS----------SFGKQTLNNK---------------AYKVFDQNTVFQLI 210
           I ++ +LRCG+          S  KQ    K                YK  D  T+ ++ 
Sbjct: 245 IVHFLQLRCGALAPYWKIPDNSEQKQGFLRKMVRLGAKNTSIRLSSTYKAMDHQTLLKIA 304

Query: 211 GKVEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQ 265
                ++K    N+E     ++ S G+     ++E  I  +W+IS  +  + ++ I H  
Sbjct: 305 DLALQEKKLL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISPQEFPS-HVVIKH-- 359

Query: 266 QGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC---A 322
                YPSSK+L +I+ S+  +D  + R + I++ F K YP + L+  FW  L      A
Sbjct: 360 --RGCYPSSKILVSILVSFYFNDHDLHRGLSILDSFIKHYPDVKLDALFWRRLFQLSHFA 417

Query: 323 IKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYW 382
                 K  +  + CW+LMK+W+  +          L  +   M++T N    +D+L+ +
Sbjct: 418 WTPANDKKATSVVRCWHLMKQWYASKRLRPSVDYETLRQLYDIMKKTGNFPLGIDVLRSF 477

Query: 383 LGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY 442
              +   R        +++IKYQK I+++LV++ +++    FID +  D    +DL  F 
Sbjct: 478 KPGIERTRAENAGKVNNIIIKYQKCIIKELVNRGRFSAVREFIDSYGFDRKMTKDLNIFC 537

Query: 443 ESRVDVR--------ESKTRREKA---YXXXXXXXXXIIGRLW 474
            +R+ +R        E+K  REK              IIG LW
Sbjct: 538 ANRMFLRSKKMKNKIENKKEREKVRLDSFDDDEDDGMIIGSLW 580

>Smik_13.495 Chr13 complement(816375..818105) [1731 bp, 576 aa] {ON}
           YMR282C (REAL)
          Length = 576

 Score =  125 bits (313), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 98/389 (25%), Positives = 179/389 (46%), Gaps = 54/389 (13%)

Query: 113 EKFFAIFMRY-------KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLL 165
           E +F IF  Y       +  I L++  L   ++ D NL+   FI   QL KAQ I+ F++
Sbjct: 164 EFWFKIFSLYAEKVDAKRNHINLRNTTLDACEIFDINLLIRNFIELGQLGKAQKILTFII 223

Query: 166 QQDVKF-------DVFMIKNYTKLRCGS----------------------SFGKQTLN-- 194
            ++          D+  + ++ KLRCG+                        G +  +  
Sbjct: 224 DRNPDILLSPNNADIGTMVHFLKLRCGALAAYWKIPDNSGQDQKQLRKIVRLGAKNTSIR 283

Query: 195 -NKAYKVFDQNTVFQLIGKVEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWR 248
            +  YKV D  T+ ++   V  +++F   N+E     ++ S G+     ++E  I  +W 
Sbjct: 284 LSSTYKVMDHQTLLKIADLVLHEKRFL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWH 341

Query: 249 ISIHDHSTENIKIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKL 308
           I+  +  + ++ I    +    YPSSK+L +I+ S+  +D  + R + I++ F K YP++
Sbjct: 342 ITTQEFPS-HVAI----KPRGCYPSSKILISILVSFHYNDNDLHRGLSILDSFIKHYPEV 396

Query: 309 LLNVHFWSTLL---NCAIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRY 365
            L+  FW  L    N A      K  +  + CW+LMK+WH  +   +      L  +   
Sbjct: 397 KLDALFWRRLFQLSNFAWTPAKDKKATSVIRCWHLMKQWHVSKGLSLSVDYETLRQLYDI 456

Query: 366 MRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFI 425
           M++T N    +D+L+ +   +   R    +    VLIKYQK I+++LVD+ + +    FI
Sbjct: 457 MKKTGNFPLGIDVLKSFKSGIERLRETNSDKLNIVLIKYQKYIIKQLVDRGRISAVREFI 516

Query: 426 DQWSIDASNKEDLEAFYESRVDVRESKTR 454
           + +  D +  ++L  F  +R+ +R  K +
Sbjct: 517 NDFGFDRTITKNLNIFCTNRLLLRSKKNK 545

>Skud_13.454 Chr13 complement(806601..808343) [1743 bp, 580 aa] {ON}
           YMR282C (REAL)
          Length = 580

 Score =  124 bits (311), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 94/374 (25%), Positives = 171/374 (45%), Gaps = 47/374 (12%)

Query: 123 KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFM 175
           +  + L++  L   ++ D NL+   FI   QL KAQ I+ F+L ++          D+  
Sbjct: 185 RDQVNLRNTALDSCEIFDLNLLIKNFIELGQLSKAQKILSFILDRNPDILLSPRNADIGT 244

Query: 176 IKNYTKLRCGS----------------------SFGKQTLN---NKAYKVFDQNTVFQLI 210
           I ++ +LRCG+                        G +  +   +  YK  D  T+ ++ 
Sbjct: 245 IVHFLQLRCGALTAYWKIPDNSGRKQNQLRRMVRLGAKNTSIRLSSTYKAMDHQTLLKIA 304

Query: 211 GKVEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQ 265
             V  D++F   N+E     ++ S G+     ++E  I  +W+IS  +  + ++ I    
Sbjct: 305 DLVLQDKRFL--NSEDLLSTLIQSFGHLGQTQILERCIEHIWQISSQEFPS-HVAI---- 357

Query: 266 QGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC---A 322
           +    YPSSK+L +I+ S+  +D+ + R + I++ F K YP++ L+  FW  LL     A
Sbjct: 358 KPRGCYPSSKILISILVSFHLNDKDLHRGLSILDSFIKHYPEVKLDALFWRRLLQLSHFA 417

Query: 323 IKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYW 382
                 K  +  + CW+LMK W+  +          L  +   M++T N    +D+L+ +
Sbjct: 418 WTPVNDKRAASIVKCWHLMKHWYESKELSPSVDYETLRQLYEVMKKTGNFSLGIDVLKSF 477

Query: 383 LGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY 442
              +   R   PE    +LIKYQK I+++LV++ K +    FI  +  +    +DL  F 
Sbjct: 478 KSGIEKMRTANPEKLEAILIKYQKCIIKQLVNRGKISAARKFIGDFGFNRRAAKDLNIFC 537

Query: 443 ESRVDVRESKTRRE 456
            +R+  R  K + +
Sbjct: 538 SNRIFSRSKKIKND 551

>Kwal_27.10224 s27 (248037..249677) [1641 bp, 546 aa] {ON} YMR282C
           (AEP2) - basic, hydrophilic 67.5 kDa protein [contig 39]
           FULL
          Length = 546

 Score =  123 bits (309), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/448 (23%), Positives = 196/448 (43%), Gaps = 65/448 (14%)

Query: 76  GHNVF--NILSPTAMQFSVLLNRVLASQNYRH-----LDSKENVEKFFAIFMRYKGAIAL 128
            H +F  N+L+P   +FS LLN +L  +N        L S ++ E  F ++  Y   + +
Sbjct: 115 SHKIFEDNLLTPN--EFSTLLNGLLTERNLSTKLETVLPSVQSTEMIFGLYQTY--LMTI 170

Query: 129 QSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQD---VKFDVFMIKNYTKLRC- 184
            +  L  +QLHD N    YFI   QL KAQ+++D +L  +   +  D     +Y +LRC 
Sbjct: 171 PAGSLNPLQLHDLNSFVQYFIETAQLGKAQIVLDRILASNNDQLPCDTTTGIHYLQLRCG 230

Query: 185 -------------------GSSFGKQTLNNKAYKVFDQNTVFQLIGKVEAD------RKF 219
                              GS   K    +  YK  DQ++V + +  +  +      +K 
Sbjct: 231 ALPRNWKVFDSRVGHSCRLGSHRNKSQPVSHTYKALDQSSVLEFVNVLNDENSEWFHKKS 290

Query: 220 AFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLAT 279
                 ++ SLG+   +TL++ +I   W I+        +      + + + PS +VL  
Sbjct: 291 PTLEAAVIYSLGFMGQLTLLKEHIAVRWGIT-------ELGASLATEVNEVPPSPEVLIA 343

Query: 280 IVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCA-----IKCGGSKDPSQF 334
           I +S+A H Q +   + +++ F   Y ++ L++ FW  L         +K     D S+ 
Sbjct: 344 IFTSFASH-QEVTLGLRLMDAFITKYSEINLDIVFWRRLFQWTNLVWDVKTDPRGDLSR- 401

Query: 335 LACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIP 394
             CW +M +WH + SK +   + LL      + QT+N    + ++      LY ++  + 
Sbjct: 402 -GCWRVMTEWHEKGSKKLQPDTTLLNERYFVLAQTNNYKEALTVISQSFPQLY-EKPTLS 459

Query: 395 EFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVD------- 447
             E  ++ KY K +L+ + +   Y+    FI +WS + + ++ L  +++   D       
Sbjct: 460 SKEMAIVQKYSKLVLKSMAELGYYHKPLTFITEWSPNKAVEDSLRVYFKKHRDGFTKRKE 519

Query: 448 -VRESKTRREKAYXXXXXXXXXIIGRLW 474
            +RE   R++  Y         ++GRLW
Sbjct: 520 RLREESRRKQNTY-DDEEEDNMLLGRLW 546

>Kpol_1068.3 s1068 (4295..5995) [1701 bp, 566 aa] {ON} (4295..5995)
           [1701 nt, 567 aa]
          Length = 566

 Score =  121 bits (304), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 120/460 (26%), Positives = 204/460 (44%), Gaps = 69/460 (15%)

Query: 78  NVFNILSPTAMQFSVLLNRVLAS---------QNYRHLDSKENVEKFFAIFMRYKGAIAL 128
           N+F     T  + S+ +NR+  S         QN+  L   E +   + IF  Y   I  
Sbjct: 113 NLFKSGDLTYNELSIFINRIYKSNGHDIKRVIQNHHSLSYTELI---YEIFELYTSTIPK 169

Query: 129 QSN--KLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF----DVFMIKNYTKL 182
           +S   KL  + L D NL    FI   QL KAQ ++ +++  +       D   + N+ +L
Sbjct: 170 ESGIIKLNALHLKDLNLFITIFIKEAQLSKAQNVLQYIIDAEGSIEKITDHDTMVNFLRL 229

Query: 183 RCGS------------SFGKQTLNNK-------------AYKVFDQNTV-FQLIG----- 211
           RCG             +  KQT  N              +YK    NTV F++I      
Sbjct: 230 RCGGLPKFWLVPQASYAVTKQTKKNSRLSSNSPNTRFPSSYKSTVPNTVLFEVINMILNK 289

Query: 212 KVEADRKFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMY 271
           KV   +     ++ IV SL +T    +M+ +I + W IS H    + + +   ++  A  
Sbjct: 290 KVWKSKHSGILDSTIVYSLAHTFQKQMMDGFIKEHWGISSHG---DPLDLFIKKKKVASA 346

Query: 272 PSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSKDP 331
           PS+++L  I+SSY   D+ +  A+ I+++F + YP + L+  FW  L+    +    K  
Sbjct: 347 PSNEILIAIMSSYIYKDRNIDGAMKILDKFIRMYPDISLDNMFWRRLIQWCNRLWDPKID 406

Query: 332 SQFL---ACWNLMKKWH---TQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGP 385
            Q      CWN+MK W+   T +  ++P+   +     R  ++T+N     +I+   L P
Sbjct: 407 RQGTFGYGCWNMMKNWNGAGTGKDVVLPYDFQIYEEFYRLFKRTNNGKIAAEIVSNVLIP 466

Query: 386 -LYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYES 444
            L  K   + + E ++L KYQ   +  L+++R++     FI++WSID +N+  L   ++ 
Sbjct: 467 HLSEKNVAVKKAELNLLNKYQTLAMNWLIERRQFKKAAFFIEEWSIDRNNRIQLREAFKK 526

Query: 445 R-------VDVRESKTRREKAYX---XXXXXXXXIIGRLW 474
           R       +  R+ K++ +K              IIGRLW
Sbjct: 527 RKQLMLRKLSTRDKKSQSQKKRQDRYDEMEEEDMIIGRLW 566

>TDEL0B00510 Chr2 (92878..94530) [1653 bp, 550 aa] {ON} Anc_8.847
           YMR282C
          Length = 550

 Score =  111 bits (278), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/364 (25%), Positives = 157/364 (43%), Gaps = 42/364 (11%)

Query: 110 ENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDV 169
           E +   + I+  Y   I    N LT +Q+HD N     FI   QLKKAQ  + FL+ +  
Sbjct: 159 EIIFNLYQIYCTY--VIKDSQNGLTPLQVHDINRFIKRFIDEAQLKKAQECLQFLIDKQG 216

Query: 170 ------KFDVFMIKNYTKLRCGS----------------SFGKQTLNNKAYKVFDQNTVF 207
                   DV  I  + +LRCG+                   K   + K+Y +  +    
Sbjct: 217 LHNILQSGDVETITQFLQLRCGALQKFWRVDSNSTKVLGEDSKHFKSPKSYNLLKEQPFL 276

Query: 208 QLIGKVEAD-----RKFAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKID 262
           +++  +  D     R     ++ IV SL       L++ YI   W IS         +  
Sbjct: 277 EIVNFLLKDKSWRLRSSPIIDSAIVYSLSNLGQTKLIDQYIQLKWGIS---------EDG 327

Query: 263 HLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCA 322
           H+   +   P  +VL  IVS+Y   +    + + I+++F K YP+  L   FW  LL  +
Sbjct: 328 HVAVKNEAVPGHEVLINIVSAYCLKNGDTGKGLRILDQFMKKYPQTELEKLFWRRLLQLS 387

Query: 323 IKCGGSKDPSQFL---ACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDIL 379
                 +   + L    CWN+MK+WH Q+   + + S  L  + +  + T N  G  +++
Sbjct: 388 FHNWDKQKDKKALVCHGCWNIMKQWHEQKGVSITYDSGTLRLLYQLFKFTRNGRGAAEVV 447

Query: 380 QYWLGPLYLKRG-NIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDL 438
           +     +Y K+   I + E D+L+ +QK  L+ +  K +YN     I +W++D  N+  L
Sbjct: 448 RTCFSSVYAKQPYQISKDEMDLLLMFQKLALKTMALKGRYNEPLQLIKEWNVDKINQHYL 507

Query: 439 EAFY 442
             ++
Sbjct: 508 LDYF 511

>Suva_13.471 Chr13 complement(816054..817799) [1746 bp, 581 aa] {ON}
           YMR282C (REAL)
          Length = 581

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/373 (24%), Positives = 170/373 (45%), Gaps = 49/373 (13%)

Query: 123 KGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------DVFM 175
           +  I L++  L   ++ D NL+   FI   QL KAQ ++ F+L ++          D+  
Sbjct: 186 RNQINLRNTALDSSEIFDMNLIIKNFIELGQLGKAQKVLSFILDRNSDILLSPKNADIGT 245

Query: 176 IKNYTKLRCGS--SFGKQTLNNK---------------------AYKVFDQNTVFQLIGK 212
           I ++ +LRCG+  ++ K   N++                     +YK  D  T+ ++   
Sbjct: 246 IIHFLQLRCGALAAYWKMPDNSEQKYSRKMVRLGAKNTSIRITSSYKAMDHQTLLKIADL 305

Query: 213 VEADRKFAFWNNE-----IVSSLGYTNNITLMEIYIWDLWRISIHD---HSTENIKIDHL 264
           V   +K    N+E     ++ S G+     ++E  I  +W+IS+ +   H+T   K    
Sbjct: 306 VL--QKERLLNSEDLLSTLIQSFGHLGQTQILERCIEHIWQISLQEFPSHATIKPKTR-- 361

Query: 265 QQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNC--- 321
                  PSSK+L +I+ S+  +D  + R + I++ F K YP++ ++  FW  L      
Sbjct: 362 ----GCCPSSKILISILVSFHLNDNDLHRGLSILDSFIKHYPEVKVDELFWRRLFQLSHF 417

Query: 322 AIKCGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQY 381
           A      K  +  + CW+LMK+WH  +   +      L  +    ++T N    +D+LQ 
Sbjct: 418 AWTPTHDKRATSIVRCWHLMKQWHESKGFSLSVDYETLRQLYDLTKKTGNYSLGIDVLQN 477

Query: 382 WLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAF 441
           +   +        E    ++IK+QK I+++LV++ K +    FI+ +S D    ++L  F
Sbjct: 478 FKPGITRTSAMKTEKINGIVIKHQKYIIKQLVNRGKTSAAREFINDFSFDIGAVKELNVF 537

Query: 442 YESRVDVRESKTR 454
             +R+ +R  K +
Sbjct: 538 CTNRILLRSKKLK 550

>Ecym_4618 Chr4 complement(1210600..1212183) [1584 bp, 527 aa] {ON}
           similar to Ashbya gossypii ABL119C
          Length = 527

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 100/411 (24%), Positives = 190/411 (46%), Gaps = 49/411 (11%)

Query: 86  TAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFMR---YKGAIAL----QSNKLTQIQL 138
           ++ +FS+  NR+L +        KE + +   + +    Y+  +A+    +  + T ++L
Sbjct: 98  SSEEFSIFFNRLLPTSG-SSFSLKEAIPENMVVPLANKLYQFYMAILEREKKTRFTPMEL 156

Query: 139 HDFNLMCDYFIACNQLKKAQLIMDFLLQQ----DVKFDVFMIKNYTKLRCGS-------- 186
           HD N   ++F+  N+LK A+ ++  +L+Q     +  D   +  Y +L  GS        
Sbjct: 157 HDLNKFSNWFLNENKLKLARKVLQQILRQTGSEQLPRDHQTLVTYFQLYLGSLASLWPTP 216

Query: 187 ----------SFGKQTLNNKAYKVFDQNTVFQLIGK-VEADR----KFAFWNNEIVSSLG 231
                       G +      Y    +  ++ ++ K +E D     + +  + +I+ SL 
Sbjct: 217 KVQSACYDKLVRGSRRPKYVVYNSLPEGIMYDVLQKLLENDDWKHLRSSELDAKILYSLC 276

Query: 232 YTNNITLMEIYIWDLWRISIHDHSTE-NIKIDHLQQGDAMYPSSKVLATIVSSYA-RHDQ 289
           + N + L E ++   W I  H    E  + +D        YP S+VL  IV+S++ R+D 
Sbjct: 277 HYNRMDLFEGFMERAWGIVDHPKKVEKEVPVDI---SSGTYPGSEVLIAIVTSFSYRND- 332

Query: 290 TMKRAVDIVERFAKSYPKLLLNVHFWSTL-LNCAIKCGGSKDPSQFL--ACWNLMKKWHT 346
            +++AV +V+ F   YP++ L   FW  L L   +      DP   L  ACW  M  W+ 
Sbjct: 333 -LEKAVRLVDAFLNKYPQMDLRTEFWEKLFLWTRVMFDRKLDPLGSLQKACWLRMLSWYK 391

Query: 347 QRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERDVLIKYQK 406
            R + +P+ S L       ++QTSN    + +   ++  +Y K     +    V+ KYQK
Sbjct: 392 SRGESVPYSSYLASCRYEILKQTSNYKDAMAMFPDYMSAVYAKSA-AAKHNLTVVRKYQK 450

Query: 407 QILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYE---SRVDVRESKTR 454
            ++R+L  + K + CT FI+QW  +  N+++L+  ++   ++  +R+ K R
Sbjct: 451 FVIRELSARGKRDACTQFIEQWRFNEENEKELQDTFQRHWNKYTIRQEKRR 501

>KLLA0D01408g Chr4 (120712..122268) [1557 bp, 518 aa] {ON} weakly
           similar to uniprot|P22136 Saccharomyces cerevisiae
           YMR282C AEP2 Mitochondrial protein likely involved in
           translation of the mitochondrial OLI1 mRNA exhibits
           genetic interaction with the OLI1 mRNA 5'- untranslated
           leader
          Length = 518

 Score = 92.4 bits (228), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 92/414 (22%), Positives = 178/414 (42%), Gaps = 53/414 (12%)

Query: 86  TAMQFSVLLNRVLA--SQNYRHLDSKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNL 143
           T   +SV +N+++   S++   L+  E  +  + I+  +        N +    L+D N 
Sbjct: 98  TPEDYSVFVNQLMDVYSKDIELLNKTEVWKSLYHIYRVFVVNAVDDGNAMV---LYDLNQ 154

Query: 144 MCDYFIACNQLKKAQLIMDFLLQQ----DVKFDVFMIKNYTKLRCGSS------------ 187
               FI  N L  A+ +   +L+     ++  DV  I  Y +L CG+             
Sbjct: 155 FVRMFINLNDLPLARNVFQLILKNSKNGEIPKDVQTICMYLRLYCGALSELWTTQTSRNF 214

Query: 188 ----FGKQTLNNKAYKVFDQNTVFQLIG---------KVEADRKFAFWNNE-----IVSS 229
                G  + +N +      +  +  IG         K+  D +++   N      I+ +
Sbjct: 215 YQDLIGSLSGSNASSIRIPSHIAYPTIGVPQFQLLLRKLVEDPEYSKLRNTEMDSLIIQA 274

Query: 230 LGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQG-DAMYPSSKVLATIVSSYARHD 288
           LG+   +  ++ YI      SI     EN+ I     G   + P S++L +++S+Y  H+
Sbjct: 275 LGHYKEVPFLKQYI------SIFYGIDENVTITETHPGIKKLTPDSQLLKSVISAYG-HN 327

Query: 289 QTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI----KCGGSKDPSQFLACWNLMKKW 344
             +   + ++  F + YP++ L+  FW T +  ++    K   SK  SQ    WNLM  W
Sbjct: 328 NNITSGMTVIGSFMEKYPEMNLDKSFWRTTIYWSLREWNKYKDSKG-SQPKKAWNLMLNW 386

Query: 345 HTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLK-RGNIPEFERDVLIK 403
           +    K +PF   +++  L +++   + +  +  +Q     +++K   N    ER VL  
Sbjct: 387 YATIGKAVPFDQKIMLYRLSFLKSRKDHNAAIRDVQQVFKRIFIKTEKNTFIVERLVLYA 446

Query: 404 YQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYESRVDVRESKTRREK 457
           YQ+ I++ LV++ +   C  FI++W ID  N   LE +++     +     ++K
Sbjct: 447 YQRFIIKNLVNQNENAKCVDFINEWRIDFENGRYLERYFKELTHPKNESDEQKK 500

>NCAS0C00370 Chr3 (54433..55920) [1488 bp, 495 aa] {ON} Anc_8.847
           YMR282C
          Length = 495

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 109/468 (23%), Positives = 195/468 (41%), Gaps = 77/468 (16%)

Query: 27  LRETLQTKNRLINDTVNPQEN--SQGPNIHKCVTNKYPASNNLSELLDLLAGHNVFN--- 81
           LR  L T +R +N   +   N  S+ P I   +     ASN+       L   N FN   
Sbjct: 15  LRRGLGTTSRALNSPASSIANATSKEPTISISMDKGTIASNSRVRFSSTLLKKNEFNKYE 74

Query: 82  --------------ILSP--------TAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIF 119
                         IL+P        T  ++S+ L +VL+ +     DS  NV   F +F
Sbjct: 75  HFLRGGRIKDLISMILNPMVSIHEHFTLEEYSLFLGKVLSMK-----DSDVNVNVVFQLF 129

Query: 120 MRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-------D 172
             Y   +      L  +Q++D N +  YFI  +QLK+ Q+++DF++ +           D
Sbjct: 130 EIY-ARMYCGEGSLNALQIYDLNKLIKYFIKRDQLKQGQIVLDFIIMKYGGIENMIAHRD 188

Query: 173 VFMIKNYTKLRCGSSFGKQTLNNK------------AYKVFDQNTVFQLIGKVEAD--RK 218
           +  + N+ KL+ GS         K             YK  D  ++ ++   V  D  + 
Sbjct: 189 LISLNNHLKLKNGSLVKDWKFEGKNLRYLQSRQGRLNYKFLDGWSLLKIADLVLNDPMKC 248

Query: 219 FAFWNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQQGDAMYPSSKVLA 278
                N I+ SLG+   + L++ +I  +W   + +    N           +YP +  + 
Sbjct: 249 QNVLTNSIIYSLGHLRQVELLDHFIDQMW---MQETRPRN---------GLLYPDTNNII 296

Query: 279 TIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIKCGGSKDPSQFLA-C 337
            I++SY  +   M ++ D+++R  + Y  L  +  FW  L    I    + +    L  C
Sbjct: 297 AIITSYCYNYGNMDKSFDVLDRILEKYSGLKFDKFFWRRLFQWCILTEPNANKGFILGQC 356

Query: 338 WNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWLGPLYLKRGN-IPEF 396
           W+LM+K        + F   LL  +   + +  ++   + +L+  +  + LK+ N I E 
Sbjct: 357 WSLMEKQEK-----VEFDGVLLELLREKIVKVRDVPLALRVLKMIV--IELKKVNFINEL 409

Query: 397 ERDVLIKYQKQILRKLVDKRKYNWCTAFI--DQWSIDASNKEDLEAFY 442
           + ++L+KYQK +  KL +  K       +  D ++I+  NK  + A+Y
Sbjct: 410 DMELLLKYQKFVFSKLGEINKTVKAMELLSCDDYTINKENKAFMRAYY 457

>NDAI0K00340 Chr11 complement(64928..66802) [1875 bp, 624 aa] {ON}
           Anc_8.847 YMR282C
          Length = 624

 Score = 90.1 bits (222), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 97/402 (24%), Positives = 183/402 (45%), Gaps = 60/402 (14%)

Query: 113 EKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFL------LQ 166
           E  F++F   K      +N+L  + ++D N    YF+   QLKKAQL++D++      ++
Sbjct: 194 EVIFSLFNICKDEYCNNTNQLNPLMVYDLNQFIKYFLREGQLKKAQLVLDYIIDRFGGIE 253

Query: 167 QDVKF-DVFMIKNYTKLRCGSSFG----------------KQTLNNKA--------YKVF 201
           Q +K  D+  + N+ KL+ G+ +                 + +L +K+        YK  
Sbjct: 254 QLIKSKDLTTLDNHLKLKNGAIYKNWKPLTDSESNTFLQYRLSLEDKSHNFKGFKNYKFL 313

Query: 202 DQNTVFQLIGKVEADRKFAF--WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENI 259
           D  ++ ++I  V  D+       N  I+ SLG    I  ME +I  +W +   D   E  
Sbjct: 314 DGWSLLKIIDMVLTDKTHCLNILNESILYSLGTLRQIEFMEHFIKQIWDVHPDDAVEER- 372

Query: 260 KIDHLQQGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLL---LNVH-FW 315
             +H      + P +  L  I++SY +  ++M RA  ++++  + YP+ +   LN + FW
Sbjct: 373 --NHQLDKYNLPPDTNELIAILTSYCQTYKSMDRAFLLLDKLIQKYPEPMKSRLNDNKFW 430

Query: 316 STLLNCAIKC----GGSKDPSQFLACWNLMKKWHTQRSKLMPFQ--------SALLVTIL 363
             +L   IK     G + + +    C  +M++W  +  K    +         ++L+ +L
Sbjct: 431 IKMLQWGIKIADKNGNNVNGTTIDNCLEIMEEWFLKGKKKTALEHWKIDDDYGSILINLL 490

Query: 364 R-YMRQTSNLHGTVDILQYWLGPLYLKRGNIPEFERD---VLIKYQKQILRKLVDKRKYN 419
              M++  N+   +  ++ ++  L L   N   +ER+   VL   QK I RK+ +   YN
Sbjct: 491 HNIMKERKNVDIGLKAIENFVQKLKLGSVN-KYYERNLTHVLYGLQKCIFRKIAESGSYN 549

Query: 420 WCTAFIDQ--WSIDASNKEDLEAFYESRV-DVRESKTRREKA 458
              A ID   ++ ++  +  L  +Y + V ++R  ++RR KA
Sbjct: 550 KGLALIDNGAYTQNSGVESMLREYYITTVKEIRSKRSRRNKA 591

>ABL119C Chr2 complement(175840..177453) [1614 bp, 537 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR282C
           (AEP2)
          Length = 537

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 85/426 (19%), Positives = 172/426 (40%), Gaps = 64/426 (15%)

Query: 62  PASNNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLA----SQNYRHLDSKEN----VE 113
           P    LSELL    G             FSV ++R+L     S + +HL SK+     ++
Sbjct: 118 PQKTTLSELLSQEEG-------------FSVFIHRLLPTYTPSSDLKHLVSKDGTIALLQ 164

Query: 114 KFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKF-- 171
           K +  F R + A A    + +  +LHD N    +F+A ++L+ A+ +   L+    +   
Sbjct: 165 KLYG-FYREQFADA-PIGRPSPGRLHDANSFARWFMAESKLRLARTVFAELVGNPTELAK 222

Query: 172 ---DVFMIKNYTKLRCGSSF------------GKQTLNNK------AYKVFDQNTVFQLI 210
              D   I    +L  G+              G Q           AY    + T+ +L+
Sbjct: 223 LPRDTETIITLLQLHLGAKHIFWRDPGNSVGRGGQLFTPAHMAVVTAYNSLGEETLLRLL 282

Query: 211 GKVEADRKFAF-----WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHLQ 265
             +++D ++        +  I+ +L + N + L+       +  +   H   +       
Sbjct: 283 RLLQSDPQWKSVCSPDLDRNIILALAFHNRLDLVHAQAARYYAPAAPGHGLPSTP----- 337

Query: 266 QGDAMYPSSKVLATIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAIK- 324
               + P   ++  +V+++A   Q + + + I  +F   +  L      W  +     + 
Sbjct: 338 ----LLPDGALVGAVVTAFAFKHQ-LAQGLAIAYQFLDRFTHLPNEHELWKIIFTWLARR 392

Query: 325 -CGGSKDPSQFLACWNLMKKWHTQRSKLMPFQSALLVTILRYMRQTSNLHGTVDILQYWL 383
              GS+  + +   W+ M+  + +  +  P+  ++     R +R+ S+L     +L  ++
Sbjct: 393 HPTGSQGAALYDEAWSKMRTRYAEHGQPTPYDYSIARASYRIVRRDSSLRRVRALLNDYM 452

Query: 384 GPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFYE 443
            PLY +    P  +R +L+K Q  I+ +LV  R+ +    F+DQW++D+  +  L     
Sbjct: 453 SPLYQQPAVAPR-DRLLLLKCQAHIVGRLVRARRNSAAADFVDQWALDSEARSHLLEHIA 511

Query: 444 SRVDVR 449
           +R   R
Sbjct: 512 ARASSR 517

>CAGL0M03069g Chr13 complement(347584..349230) [1647 bp, 548 aa]
           {ON} weakly similar to uniprot|P22136 Saccharomyces
           cerevisiae YMR282c AEP2 required for the expression of
           subunit-9 of atp synthase
          Length = 548

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 84/354 (23%), Positives = 146/354 (41%), Gaps = 65/354 (18%)

Query: 140 DFNLMCDYFIACNQLKKAQLIMDFLLQ------QDV---KFDVFMIKNYTKLRCGS---- 186
           D N     FI  +QLK+AQ  + FLL       +D+     D   I ++  LR G+    
Sbjct: 169 DMNKFIKRFIEGSQLKRAQTALQFLLDGYKERGEDLLGPYGDKQTIAHFLMLRSGALQDL 228

Query: 187 -SFGKQTLNNK----------------AYKVFDQNTVFQLIGKV------EADRKFAFWN 223
                   NNK                 Y V D   +F+++  +      +   +  +++
Sbjct: 229 WKIDVSNGNNKKQAFYKINGSHRNVKSTYNVLDSVKLFEIVRYILRYNDKDNHSQPVYFD 288

Query: 224 NEIVSS----LGYTNNITLMEIYIWDLWRI-SIHDHSTENIKIDHLQQGDAMYPSSKVLA 278
             I+ +    LGY    TL+E  I  +W + S+      NI +           +S +L 
Sbjct: 289 EGILKNVILCLGYVGQTTLIEDIINKIWELDSVSVPPKYNITV-----------TSDLLT 337

Query: 279 TIVSSYARHDQTMKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI----KCGGSKDPSQF 334
            IVS+Y++  ++++  + I ++F    P +++   FW  L    I    K   + D S+ 
Sbjct: 338 AIVSAYSKCGKSIQPGLVIADKFFGKIPNIIVKDDFWINLQKWNIILPNKWRSTIDLSK- 396

Query: 335 LACWNLMKKWH--TQRSKLMPFQSALLVTILRYMR----QTSNLHGTVDILQYWLGPLYL 388
              W LMK W   T     +      L  + + +     +  +L    DI Q+ L  LY 
Sbjct: 397 -RTWELMKSWRNSTNNGGFITANVEFLNLVYKVLSSDYIKLKDLEWIYDIFQHSLVTLY- 454

Query: 389 KRGNIPEFERDVLIKYQKQILRKLVDKRKYNWCTAFIDQWSIDASNKEDLEAFY 442
            + ++   E  +L K+Q   ++K+V    Y+ C  FI +WS DA+NK+ L   +
Sbjct: 455 SKNSLTVDEIKLLKKFQIFTIKKMVYFGHYSKCLQFIKEWSYDAANKQQLTNLF 508

>TBLA0B03310 Chr2 complement(772555..774396) [1842 bp, 613 aa] {ON}
           Anc_8.847 YMR282C
          Length = 613

 Score = 63.2 bits (152), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 84/383 (21%), Positives = 160/383 (41%), Gaps = 76/383 (19%)

Query: 130 SNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQDVKFDVFMIK------NYTKLR 183
           S  L  IQL+D N +  +FI   QLKKA   + ++L++    ++F I       N+ KL 
Sbjct: 218 STPLNPIQLYDLNKVITWFIKAGQLKKATTALMYILKR-YNAEIFQIPDSKTIINFLKLY 276

Query: 184 CGS----------------SFGKQTL---NNKAY-------KVFDQNTVFQLIGKVE--- 214
           CG                 + GK++    NN +Y       K   +    Q++  ++   
Sbjct: 277 CGGLPTNWRIEPINHRFIKNQGKRSFKLGNNSSYYRLPSSYKAVYEKVPIQIVEHIKKNT 336

Query: 215 -----ADRKFAF-----WNNEIVSSLGYTNNITLMEIYIWDLWRISIHDHSTENIKIDHL 264
                + + F F     +++ ++ SL       L E Y  D W       S +++++   
Sbjct: 337 NDMKLSGKLFHFIRTGEFDSTLIYSLTSLGRFDLAEQYFKDNWL----SDSCDDVEL--- 389

Query: 265 QQGDAMYPSSKVLATIVSSYARHDQT-MKRAVDIVERFAKSYPKLLLNVHFWSTLLNCAI 323
                   +S ++  I SSY  ++   +++A  +++   K YP L LN+  W  ++   I
Sbjct: 390 --------TSDIVIAIFSSYVYNNSNNIEKANKLIQEIIKRYPDLHLNISTWCRIIRWNI 441

Query: 324 KC-------GGSKDPSQFLACWNLMKKWHTQRSKL----MPFQSALLVTILRYMRQTSNL 372
           +         G      F         + ++ S      +P+   LL  +        +L
Sbjct: 442 QMWDTTTDFNGEIPYDSFYTMLTYYSNYCSRNSTFKSCHIPYNKMLLGDLYHLFNTKISL 501

Query: 373 HGTVDILQY-WLGPLYLKRGNIPEFERDVLIKYQKQILRKLVDKRKY--NWCTAFIDQWS 429
           +  + I+   +   L+     +   +  +L+KYQK IL+ L++ RK   N    FI+++S
Sbjct: 502 NKCLFIMDNCFKKSLFKTPSKVTTKDYQILLKYQKMILKYLINDRKLTSNKPLDFIEKYS 561

Query: 430 IDASNKEDLEAFYESRVDVRESK 452
           +D +NKE L  +   R++ R+S+
Sbjct: 562 LDTNNKEQLLEYRLERLEYRKSR 584

>Smik_10.304 Chr10 complement(469092..471602) [2511 bp, 836 aa] {ON}
           YJR030C (REAL)
          Length = 836

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 25/91 (27%), Positives = 46/91 (50%), Gaps = 4/91 (4%)

Query: 17  VTCNRVGYSTLRETLQTKNRLINDTVNPQENSQGPNIHKCVTNKYPASNNLSELLDLLAG 76
           ++CN + Y ++R+ +  +  LIN  +   E       ++    K+  +N L E+ +L +G
Sbjct: 155 ISCNSLKYESVRDIMSREFCLINPPLIDLEQVVKRAYYRLDIEKFTINNKLVEIFELESG 214

Query: 77  H-NVFNILS---PTAMQFSVLLNRVLASQNY 103
           H  +F +LS   P  +Q    L + LAS N+
Sbjct: 215 HIAIFEVLSGEMPYTLQTIDNLFQSLASGNH 245

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 30.8 bits (68), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 23/96 (23%), Positives = 52/96 (54%), Gaps = 7/96 (7%)

Query: 108 SKENVEKFFAIFMRYKGAIALQSNKLTQIQLHDFNLMCDYFIACNQLKKAQLIMDFLLQQ 167
           S   VE F   +M ++  ++   N+LT +Q    ++  D  I  + +K  +LI +F ++ 
Sbjct: 95  SSPTVENFIVPYMNHENKVSPLINQLTFLQ----HVSADKDIRDSSMKATELIQNFEIEA 150

Query: 168 DVKFDVFM--IKNYTKLRCGSSFGKQTLNNKAYKVF 201
            ++ D+F+   K +T ++  S F +++ ++K Y+ +
Sbjct: 151 SLRKDLFIQFDKIWTDVKDNSEFNEKS-DSKNYESY 185

>KAFR0I00750 Chr9 (150956..153493) [2538 bp, 845 aa] {ON} Anc_8.560
           YPL084W
          Length = 845

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 41/81 (50%), Gaps = 10/81 (12%)

Query: 65  NNLSELLDLLAGHNVFNILSPTAMQFSVLLNRVLASQNYRHLDSKENVEKFFAIFMRYKG 124
           N L EL + L   ++ N+L         +LN+  +  + R L S E +EKF  +  R + 
Sbjct: 572 NTLEELKEKLNEDDITNLL---------ILNKASSETDLRDLFSSE-LEKFSPLSSRIEA 621

Query: 125 AIALQSNKLTQIQLHDFNLMC 145
           AI  Q++ + QI++H  N+  
Sbjct: 622 AIFKQNSLINQIKIHLDNIFA 642

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.135    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,399,231
Number of extensions: 2185566
Number of successful extensions: 6057
Number of sequences better than 10.0: 30
Number of HSP's gapped: 6177
Number of HSP's successfully gapped: 31
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 68 (30.8 bits)