Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0J002208.848ON49949926620.0
Skud_13.4558.848ON49449615040.0
YMR283C (RIT1)8.848ON51349814900.0
Smik_13.4968.848ON49449614570.0
Suva_13.4728.848ON51049914420.0
TDEL0A079708.848ON48949314200.0
NCAS0C003508.848ON48649813990.0
Kpol_1068.28.848ON49148813960.0
SAKL0D01276g8.848ON50249813640.0
KAFR0B039808.848ON48348813600.0
NDAI0K003508.848ON50450813570.0
KLTH0C03696g8.848ON47447913350.0
Kwal_27.102198.848ON50049113091e-177
ZYRO0G14344g8.848ON47249213011e-176
TPHA0I003008.848ON49349613011e-176
KLLA0D01386g8.848ON48950412881e-174
Ecym_46238.848ON48049212731e-172
AFR451C8.848ON4084209641e-126
AEL081W3.228ON376131800.34
KAFR0G037901.127ON198699770.94
SAKL0A03850g6.240ON543160714.1
Ecym_35443.228ON378131704.7
Smik_9.190na 1ON695145714.7
Suva_3.1316.373ON2152101706.3
NCAS0A039302.382ON542116689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0J00220
         (499 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.84...  1030   0.0  
Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {...   583   0.0  
YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON} ...   578   0.0  
Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {...   565   0.0  
Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {...   560   0.0  
TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON} Anc_8...   551   0.0  
NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848...   543   0.0  
Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..381...   542   0.0  
SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar ...   530   0.0  
KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {O...   528   0.0  
NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON...   527   0.0  
KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} simila...   518   0.0  
Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283...   508   e-177
ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]...   505   e-176
TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}...   505   e-176
KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} simila...   500   e-174
Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar...   494   e-172
AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}...   375   e-126
AEL081W Chr5 (476365..477495) [1131 bp, 376 aa] {ON} Syntenic ho...    35   0.34 
KAFR0G03790 Chr7 (777976..783936) [5961 bp, 1986 aa] {ON} Anc_1....    34   0.94 
SAKL0A03850g Chr1 complement(359511..361142) [1632 bp, 543 aa] {...    32   4.1  
Ecym_3544 Chr3 complement(1029358..1030494) [1137 bp, 378 aa] {O...    32   4.7  
Smik_9.190 Chr9 (314862..316949) [2088 bp, 695 aa] {ON} YIL009W ...    32   4.7  
Suva_3.131 Chr3 (197778..204236) [6459 bp, 2152 aa] {ON} YCR093W...    32   6.3  
NCAS0A03930 Chr1 (795607..797235) [1629 bp, 542 aa] {ON} Anc_2.382     31   9.6  

>KNAG0J00220 Chr10 (29017..30516) [1500 bp, 499 aa] {ON} Anc_8.848
           YMR283C
          Length = 499

 Score = 1030 bits (2662), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/499 (100%), Positives = 499/499 (100%)

Query: 1   MHQLLPKGTGAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFP 60
           MHQLLPKGTGAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFP
Sbjct: 1   MHQLLPKGTGAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFP 60

Query: 61  LIPNERCGLWYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDST 120
           LIPNERCGLWYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDST
Sbjct: 61  LIPNERCGLWYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDST 120

Query: 121 RRGKKIPDALSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPD 180
           RRGKKIPDALSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPD
Sbjct: 121 RRGKKIPDALSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPD 180

Query: 181 LVEKLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDEN 240
           LVEKLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDEN
Sbjct: 181 LVEKLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDEN 240

Query: 241 IVPIILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDS 300
           IVPIILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDS
Sbjct: 241 IVPIILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDS 300

Query: 301 ELYEIVDKMVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLE 360
           ELYEIVDKMVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLE
Sbjct: 301 ELYEIVDKMVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLE 360

Query: 361 KCYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQ 420
           KCYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQ
Sbjct: 361 KCYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQ 420

Query: 421 PIKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLN 480
           PIKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLN
Sbjct: 421 PIKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLN 480

Query: 481 GRNVNPSRATLNSINSFLM 499
           GRNVNPSRATLNSINSFLM
Sbjct: 481 GRNVNPSRATLNSINSFLM 499

>Skud_13.455 Chr13 complement(808556..810040) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/496 (56%), Positives = 369/496 (74%), Gaps = 10/496 (2%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD+ +L SL QI+K+++R+++S+RNR+QSILLDN+FL+ RV + FP FP++PNERCGLWY
Sbjct: 1   MDKEILLSLSQINKDVRRENKSVRNRLQSILLDNKFLQERVVSIFPHFPIVPNERCGLWY 60

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           C PS F +TSYFKSTDGH NQWDFSTRRLNFHLL T+++  G++I+DSTRRGKKIPD+LS
Sbjct: 61  CEPSTFKRTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDKKGIIIIDSTRRGKKIPDSLS 120

Query: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
           KTVP+WCAVLN++ML+   +  +++ VL+VPPETVP+SE D + +K+P+LV KLK LNV 
Sbjct: 121 KTVPIWCAVLNTIMLQKEKEDVDIDKVLYVPPETVPKSEYDMIKRKIPELVAKLKKLNVV 180

Query: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCTVS 250
           D  K + +  GK+LRP WV PGSSLL    D FTGE + Q  WE  +D+NI+PIILCTVS
Sbjct: 181 DSEKLNDLFMGKILRPIWVHPGSSLLNHSVDYFTGELKEQETWEAPKDQNIIPIILCTVS 240

Query: 251 YQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMV 310
           YQAQDG+DKR GFTYVQGAADDHELWS GL++ +FWS++D   +    D +L++ +  +V
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSEMFWSHVDYLGDTDKSDDQLHDYITDLV 300

Query: 311 TQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLS 370
            ++  N       GSLD+I   ID +T+ +SLG++   +T+S +   +L+  Y  VIV S
Sbjct: 301 AKKLENQLSIKDKGSLDEIFGNIDIITNEISLGKVIQGLTISVKLKQELKLRYDKVIVFS 360

Query: 371 ETVHLDKDASQD-----NEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQP--IK 423
           ++V + +D   +     N  + +F+L SG KKSSK LR + P I + + +A   +    K
Sbjct: 361 DSVAITEDTDHEEESSPNSFISVFKLQSGDKKSSKTLRTIFPRIHEELQSAFANRDGGTK 420

Query: 424 PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRN 483
           P+LICCNTG DMSIGV+L++LC  Y E W L PE   P V+KI+IRRHLTKLI+HL GRN
Sbjct: 421 PILICCNTGTDMSIGVILSILCTKYTEDWKLTPE--LPEVNKIIIRRHLTKLISHLRGRN 478

Query: 484 VNPSRATLNSINSFLM 499
           VNPSRATLNS+NSFLM
Sbjct: 479 VNPSRATLNSVNSFLM 494

>YMR283C Chr13 complement(835326..836867) [1542 bp, 513 aa] {ON}
           RIT12'-O-ribosyl phosphate transferase, modifies the
           initiator methionine tRNA at position 64 to distinguish
           it from elongator methionine tRNA
          Length = 513

 Score =  578 bits (1490), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/498 (55%), Positives = 361/498 (72%), Gaps = 10/498 (2%)

Query: 10  GAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGL 69
             MD N+  SL QI+K+++++++S+RNR+QSILLDN+FL+ RV   FP +PLIPNERCGL
Sbjct: 18  SVMDENIYLSLSQINKDIRKENKSVRNRLQSILLDNKFLQDRVIPIFPHYPLIPNERCGL 77

Query: 70  WYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDA 129
           WYCNPS F QTSYFKSTDGH NQWDFSTRRLNFHLL T+++  G++IVDSTRRGKKIPDA
Sbjct: 78  WYCNPSSFKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDA 137

Query: 130 LSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILN 189
           LSKTVP+WCAVLN+LML+   K   ++ VL++PPETVP+SE D + +K+P+LV KL+ LN
Sbjct: 138 LSKTVPIWCAVLNTLMLQETEKNVAIDKVLYLPPETVPKSEYDMIKRKIPELVAKLQKLN 197

Query: 190 VFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCT 248
           + D  K + +  GKLLRP WV PGSSLL    D FTGE Q    WE   D+NI+PIILCT
Sbjct: 198 IIDSKKLNELFMGKLLRPIWVHPGSSLLDHSVDYFTGEVQEYEAWETPEDQNIIPIILCT 257

Query: 249 VSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDK 308
           VSYQAQDG+DKR GFTYVQGAADDHELWS GL++N+FW++I+   + S  D +L++ +  
Sbjct: 258 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSNMFWAHIEYLGDASYSDDQLHDYIMD 317

Query: 309 MVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIV 368
           +   +  N       GSLD++   IDK+T+ +SLG++   +T++      L+  Y  VI+
Sbjct: 318 LAAAKLRNQCYIQDKGSLDEVFGNIDKITNEISLGKVSSGLTINKNLKQKLKSEYGKVII 377

Query: 369 LSETVHLDKDASQDNE-----MVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIIL--QP 421
            S +V + +D   + E      + I++L SG KKSSK LR+  P I   I +      + 
Sbjct: 378 FSNSVTVAEDTDDEEESGTDPFISIYKLQSGDKKSSKALRSTFPRIHGEIQSLFTNRDEK 437

Query: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481
           IKP+LICCNTG DMSIGV+L++LC  Y E W L  E   P +SK+++R+HLTKLI+HL G
Sbjct: 438 IKPMLICCNTGTDMSIGVILSILCTKYTEEWMLTSE--LPDISKLIVRKHLTKLISHLKG 495

Query: 482 RNVNPSRATLNSINSFLM 499
           RNVNPSRATLNS+NSFLM
Sbjct: 496 RNVNPSRATLNSVNSFLM 513

>Smik_13.496 Chr13 complement(818336..819820) [1485 bp, 494 aa] {ON}
           YMR283C (REAL)
          Length = 494

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/496 (53%), Positives = 368/496 (74%), Gaps = 10/496 (2%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD  +  SL +I+++++++++S+RNR+QSILLDN+FL+ RV   FP FPL+PNERCG+WY
Sbjct: 1   MDEEICLSLTKINRDVRKENKSVRNRLQSILLDNKFLQDRVIPVFPYFPLVPNERCGIWY 60

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           C PS + QTSYFKSTDGH NQWDFSTRRLNFHLL T+++  G++IVDSTRRGKKIPDALS
Sbjct: 61  CKPSTYKQTSYFKSTDGHVNQWDFSTRRLNFHLLETIRDNKGIIIVDSTRRGKKIPDALS 120

Query: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
           KTVP+WCAVLN++ML+   + F+++  L++PPETVP+SE D + +K+P+LV KL+ LN+ 
Sbjct: 121 KTVPIWCAVLNTIMLQETEENFDIDKALYLPPETVPKSEYDMIKRKIPELVTKLRKLNII 180

Query: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCTVS 250
           D  K + +  GK+LRP WV PGSSLL    D FTGE Q    WE   D+NI+PIILCTVS
Sbjct: 181 DSKKLNELFMGKILRPIWVHPGSSLLNHSVDYFTGEIQQHETWETPEDQNIIPIILCTVS 240

Query: 251 YQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMV 310
           YQAQDG+DKR GFTYVQGAADDHELWS GL++ +FW++++   + +  D +L++ +  +V
Sbjct: 241 YQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWAHVEFLCDKNNSDDQLHDYITDLV 300

Query: 311 TQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLS 370
            ++  +       G LD+I   +DK+T  +SLG++   + ++ +   +L+  Y  V++LS
Sbjct: 301 AKKLKSQMYIQDKGGLDEIFGKVDKITDEISLGKVVQGLFINEKLKEELKSEYGKVLILS 360

Query: 371 ETVHLDKD-----ASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAII--LQPIK 423
           ++V + +D     A++ N  + +++L SG KKSSK LR++LP I + +  A     + ++
Sbjct: 361 DSVTVAEDAGVVEATKSNPFITVYKLQSGDKKSSKALRSILPKIHEEVELAFANRAEEMR 420

Query: 424 PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRN 483
           P+L+CCNTG DMSIGV+L++LC  Y E W L  E   P V+KI+IR+HLTKLI+HL+GRN
Sbjct: 421 PMLVCCNTGTDMSIGVILSILCTKYTEEWMLTQE--LPEVNKIIIRKHLTKLISHLHGRN 478

Query: 484 VNPSRATLNSINSFLM 499
           VNPSRATLNS+NSFLM
Sbjct: 479 VNPSRATLNSVNSFLM 494

>Suva_13.472 Chr13 complement(818023..819555) [1533 bp, 510 aa] {ON}
           YMR283C (REAL)
          Length = 510

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/499 (54%), Positives = 362/499 (72%), Gaps = 14/499 (2%)

Query: 12  MDRNLLTSLP--QISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGL 69
           MD  +L SL   QI+K+++++++S+RNR+QSILLDN FL  RV   FP FP++PNERCGL
Sbjct: 15  MDEEILLSLSLSQINKDVRKENKSVRNRLQSILLDNRFLRDRVLPIFPRFPIVPNERCGL 74

Query: 70  WYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDA 129
           WYC PS F QTSYFKSTDGH NQWDFSTRRLNFHLL  +QE  G++IVDSTRRGKKIPDA
Sbjct: 75  WYCEPSSFEQTSYFKSTDGHVNQWDFSTRRLNFHLLEIIQENKGIIIVDSTRRGKKIPDA 134

Query: 130 LSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILN 189
           LSKTVP+WCAVLN++ML+   +  +++ VL+VPPETVP+SE D + +K+P+LV+KL+ LN
Sbjct: 135 LSKTVPIWCAVLNTIMLQETEENVDIDKVLYVPPETVPKSEYDMIKRKIPELVDKLQKLN 194

Query: 190 VFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE-QIQNKWEVSRDENIVPIILCT 248
             D    +++  GK+LRP WV PGSSLL    D FTGE + Q  WE   D+NI+PIILCT
Sbjct: 195 AIDSKTLNKLFKGKILRPIWVHPGSSLLNHSVDCFTGEIEEQEIWESPEDQNIIPIILCT 254

Query: 249 VSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDK 308
           VSYQAQDG+DKR GFTYVQGAADDHELWS GL++ +FWS+ID   + +  D +L   +  
Sbjct: 255 VSYQAQDGMDKRYGFTYVQGAADDHELWSFGLDSKMFWSHIDYLGDTNNSDDQLCAYITD 314

Query: 309 MVTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIV 368
           ++ ++          G+LD I   IDK+T+ +SLG++   +T++ +   +L+  Y  VI+
Sbjct: 315 LIGKKLEYQLSIQDKGNLDDIFENIDKITNEISLGKVIQGLTINEKLEKELKVHYEKVII 374

Query: 369 LSETV----HLDK-DASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQP-- 421
            S +V    H D  + S+ +  + +++L SG KKSSK LR+  P I + +   +   P  
Sbjct: 375 FSNSVAIAAHADSVEESRTDSFISVYKLQSGDKKSSKALRSTFPMIHQEV-QPVFANPAK 433

Query: 422 -IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLN 480
            +KP+L+CCNTG DMSIGV+L++LC  Y+E W L  E   P V+KI+IR+HLTKLI+HL+
Sbjct: 434 GMKPILVCCNTGTDMSIGVILSILCAKYNEEWILTSE--LPVVNKIIIRKHLTKLISHLH 491

Query: 481 GRNVNPSRATLNSINSFLM 499
           GRNVNPSRATLNS+NSFLM
Sbjct: 492 GRNVNPSRATLNSVNSFLM 510

>TDEL0A07970 Chr1 (1391841..1393310) [1470 bp, 489 aa] {ON}
           Anc_8.848 YMR283C
          Length = 489

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/493 (56%), Positives = 356/493 (72%), Gaps = 14/493 (2%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD N + SL  I+K++K++ +SLRNR+QSILLD  FL T V   FP++PL+PNERCGLWY
Sbjct: 6   MDNNFIDSLRCINKDIKKEYKSLRNRLQSILLDYTFLCTEVLPCFPEYPLVPNERCGLWY 65

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           CNP  F QTSYFKSTDGH NQWDFS+RRLNFH++PT+ ++ G++IVDSTRRGKK+PDALS
Sbjct: 66  CNPKDFTQTSYFKSTDGHTNQWDFSSRRLNFHIIPTIAKSNGIIIVDSTRRGKKVPDALS 125

Query: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
           KT+P+WCAVLN LMLES G      + L+VPPETV ESE   +  ++P+LVEKLK L V 
Sbjct: 126 KTIPIWCAVLNHLMLESQGGSVK-QETLYVPPETVSESEFYSIKSRIPELVEKLKSLEVI 184

Query: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251
           +G +  + L GKLLRPFW++PGSS+LQS TDIFTGE   +KW +  D +I+PIILCTVSY
Sbjct: 185 NGKELHKQLGGKLLRPFWIYPGSSILQSTTDIFTGEVTSDKW-IPVDNSIIPIILCTVSY 243

Query: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311
           QAQDG+DKR GFTYVQGAADDHELWSHGL A IFWSNID   N    + EL   V ++ +
Sbjct: 244 QAQDGVDKRRGFTYVQGAADDHELWSHGLNAKIFWSNIDILGNQESSEEELERFVSQL-S 302

Query: 312 QQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSE 371
            +  ++ +  Q          ID VT  LSLG + DN+  + + I ++ + +S VIVLS+
Sbjct: 303 LRGCDLSKEIQ---FSDAFPQIDLVTPELSLGLVIDNLEFNPKLIGEIRQAHSLVIVLSQ 359

Query: 372 TVHL-DKDASQDN--EMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAI--ILQPIKPLL 426
           +V+   K A  +N  E + I +L SGSK SS+NL+  L  I   I   I  + +  KP+L
Sbjct: 360 SVNFPQKVAEMENASEFISIHKLQSGSKVSSRNLKTELLKIVPLIEKHILDLDKQRKPVL 419

Query: 427 ICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNP 486
           ICCN+G DMSIG+LL VLC+NY+  W L   +   SVSKIV+++HL KLI+HL GRNVNP
Sbjct: 420 ICCNSGTDMSIGLLLVVLCRNYNMDWQL---NTPTSVSKIVVKKHLAKLISHLKGRNVNP 476

Query: 487 SRATLNSINSFLM 499
            RATLNS+NS+LM
Sbjct: 477 PRATLNSVNSYLM 489

>NCAS0C00350 Chr3 (51842..53302) [1461 bp, 486 aa] {ON} Anc_8.848
           YMR283C
          Length = 486

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/498 (55%), Positives = 359/498 (72%), Gaps = 22/498 (4%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD  LL SL QI+K+++++++S+RNR+QSILLDN+FL   V   FPDFP+IPNERCGLWY
Sbjct: 1   MDPLLLESLGQINKDIRKENKSIRNRLQSILLDNKFLNDEVLPCFPDFPIIPNERCGLWY 60

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
             P  F QTSYFKSTDGH NQWDFSTRRLNFHL PTL+ +GG++IVDSTRRGKKIPDALS
Sbjct: 61  VPPEDFKQTSYFKSTDGHTNQWDFSTRRLNFHLFPTLRSSGGIIIVDSTRRGKKIPDALS 120

Query: 132 KTVPLWCAVLNSLMLESV--GKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILN 189
           KT+P+WCAVLN +ML S       ++ DVLF PPET+ ++E D +A+++PDLV KL  L+
Sbjct: 121 KTIPIWCAVLNYIMLLSQRGSDDIDITDVLFTPPETISKTEYDMIARRIPDLVGKLVKLD 180

Query: 190 VFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTV 249
           + DG +   +L GKLLRPFWV+PGSSLLQS  D+FTGE   + W V +  NI+PIILCT+
Sbjct: 181 IVDGNELFILLQGKLLRPFWVYPGSSLLQSSRDVFTGEITGDSWNVPQHANIIPIILCTI 240

Query: 250 SYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKM 309
           SY+AQDG DKR+GFTYVQGAADDHELWS GL   +FWS+I+ F+N++  + ++ + V+ +
Sbjct: 241 SYRAQDGHDKRHGFTYVQGAADDHELWSEGLTPTLFWSHINFFRNMNHTEEQINQFVETL 300

Query: 310 VTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVL 369
           V +Q++  ++S    + D     ID VT  L LG+I DNV +       L   ++  I+L
Sbjct: 301 VQEQDDAGEQSDINDAFDY----IDNVTPQLELGKIKDNVVIGKVLREKLSDRFALSIIL 356

Query: 370 SETVHLDKDASQDNEMV----KIFRLTSGSKKSSKNLRAMLPDI----SKTINNAIILQP 421
           SE V LD     DNE +     IF+L SGSKKSSK LR  + +I       +NNA+    
Sbjct: 357 SENVELD---PVDNENLPISTHIFKLQSGSKKSSKLLRNKIEEIIGLVESQMNNAL---- 409

Query: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481
            KP+LICCNTG DMSIG+LLA+LC+NY E W +L E     + KI+IR+ LT+LI+HL G
Sbjct: 410 NKPILICCNTGTDMSIGILLALLCRNYSERW-VLGEVEAKRLDKIMIRKQLTRLISHLEG 468

Query: 482 RNVNPSRATLNSINSFLM 499
           R +N SRATLNS+N++LM
Sbjct: 469 RTINTSRATLNSVNNYLM 486

>Kpol_1068.2 s1068 (2343..3818) [1476 bp, 491 aa] {ON} (2343..3818)
           [1476 nt, 492 aa]
          Length = 491

 Score =  542 bits (1396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/488 (55%), Positives = 349/488 (71%), Gaps = 15/488 (3%)

Query: 19  SLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHFA 78
           S+ QI K++K++ +SL+NR+QSILLD  FLE  V   FP+FP+IPNERCGLWYCNP  F 
Sbjct: 10  SINQIHKDIKKEYKSLKNRIQSILLDARFLEDTVIPFFPEFPVIPNERCGLWYCNPKLFE 69

Query: 79  QTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLWC 138
           QTSYFKSTDGH NQWDFSTRRLNFHLLPTL + GG+VIVDSTRRGKKIPDALSKTVP+WC
Sbjct: 70  QTSYFKSTDGHINQWDFSTRRLNFHLLPTLAQNGGIVIVDSTRRGKKIPDALSKTVPIWC 129

Query: 139 AVLNSLMLESVGK-KFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKTS 197
           AVLNSLMLESV +   + + VLFVPP TVP SE  ++ KKLP L+E+L  L + DG+   
Sbjct: 130 AVLNSLMLESVDQLNDDYSKVLFVPPSTVPNSEYQRILKKLPLLIERLNKLAIIDGSDLY 189

Query: 198 RMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQDGI 257
           +  +GKLLRP W+ PGSSLLQS TDIFTGE   + WE   DE I+PIILCTVSY+AQDG+
Sbjct: 190 KQFNGKLLRPIWIHPGSSLLQSTTDIFTGESTNDVWETPEDEEIIPIILCTVSYRAQDGV 249

Query: 258 DKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNNNM 317
           DKR+GFTYVQGAADDHELWSHGL  ++FW NI++F +L   +  L   V+ ++  +   +
Sbjct: 250 DKRHGFTYVQGAADDHELWSHGLNPDMFWDNIEQFNDLDRSEDLLQSTVEDLLAAKQKEV 309

Query: 318 QRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHL-- 375
             +    + +     +D +T+ + LG+I D + +     ++L   +S VIV SE+  L  
Sbjct: 310 SETETLEAFNP----LDMITTDIFLGKIADGLIIGDSLTSELLSKFSMVIVFSESCKLSV 365

Query: 376 DKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIK---PLLICCNTG 432
            K+  +  + + I +L SGSKKSSK LR  LP++   I         K   P+LICCN+G
Sbjct: 366 SKNEEKITQRIVINQLQSGSKKSSKALRKTLPELHSRIEPFFSTDKAKSELPILICCNSG 425

Query: 433 KDMSIGVLLAVLCQNYDEVWDLLPEDVKPS-VSKIVIRRHLTKLIAHLNGRNVNPSRATL 491
            DMSI ++L +LC++YD  W+      KP+ V+KI+IR+HLTKLI+HL GRNVNPSRATL
Sbjct: 426 TDMSIALVLMLLCKHYDLDWNT----SKPNEVNKIIIRKHLTKLISHLKGRNVNPSRATL 481

Query: 492 NSINSFLM 499
           NS+N +LM
Sbjct: 482 NSVNEYLM 489

>SAKL0D01276g Chr4 (96411..97919) [1509 bp, 502 aa] {ON} similar to
           uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 502

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/498 (54%), Positives = 358/498 (71%), Gaps = 15/498 (3%)

Query: 4   LLPKGTGAMDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIP 63
           + P  +  MD   L SL  I KE+K++ +SLRNR+QSI+ D++FL T V   FPD+PL+P
Sbjct: 18  VYPNYSRNMDTETLKSLNLIKKEIKKEYKSLRNRLQSIIWDHQFLTTYVIPTFPDYPLVP 77

Query: 64  NERCGLWYCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRG 123
           NERCGLWYCNP  F+Q SYFKSTDGH NQWDFSTRRLNFHLLP++ + GG+VI+DSTRRG
Sbjct: 78  NERCGLWYCNPESFSQMSYFKSTDGHINQWDFSTRRLNFHLLPSIAQHGGIVIIDSTRRG 137

Query: 124 KKIPDALSKTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVE 183
           KKIPDALSKT+P+WCAV+N+L+LE+  +     +VLF PP TVP+SE D++  ++P LVE
Sbjct: 138 KKIPDALSKTIPIWCAVINTLILEASNRS---EEVLFCPPGTVPQSEYDRIKNRIPSLVE 194

Query: 184 KLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEVSRDENIV 242
           KLK L +  G +  +   GK+LRP WV+PGSSL  S TDIFTG+Q ++ KWE   D++ +
Sbjct: 195 KLKNLGIVSGDELLKQFGGKILRPLWVYPGSSLFSSSTDIFTGKQTRSQKWEKPEDQDFL 254

Query: 243 PIILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSEL 302
           P+ILCT SYQ QDG+DKR GFTYVQGAADDHELW+ GL  ++FW N +   + +  + EL
Sbjct: 255 PVILCTASYQCQDGVDKRYGFTYVQGAADDHELWAEGLTPDMFWDNKNFLGDETKSEQEL 314

Query: 303 YEIVDKMVTQQNNNMQRSAQAGSLD-KIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEK 361
            E V+K   Q+    +R+ +A   D      +D +T  L LG + D + L+ + ++ L+ 
Sbjct: 315 IEYVNK---QKREATERTKEASGNDLNQCFSVDAITKELHLGTVVDGLELNEKLLSQLDS 371

Query: 362 CYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQP 421
            Y+  +VLSE+V +   + Q+N   KIF LTSG+KKSSK LR+ L +I   I  A +  P
Sbjct: 372 RYALTVVLSESVKI--ASIQENPNTKIFPLTSGNKKSSKELRSKLIEICPLI-QASLNSP 428

Query: 422 IKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNG 481
           + P+LICCNTGKDMS+GVLLA LCQNYDE W +   +   S +K +IR+HLT+LI+HL G
Sbjct: 429 L-PILICCNTGKDMSVGVLLATLCQNYDEDWCIGSPN---SFNKTIIRKHLTRLISHLKG 484

Query: 482 RNVNPSRATLNSINSFLM 499
           RNVNPSRATLNS+N++LM
Sbjct: 485 RNVNPSRATLNSVNAYLM 502

>KAFR0B03980 Chr2 complement(832133..833584) [1452 bp, 483 aa] {ON}
           Anc_8.848 YMR283C
          Length = 483

 Score =  528 bits (1360), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/488 (55%), Positives = 347/488 (71%), Gaps = 10/488 (2%)

Query: 17  LTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSH 76
           + SL  I K++K + RSL+NR+QSI+LDN FLE  V   FP++P+IPNERCGLWYC+P H
Sbjct: 1   MDSLSHIKKDIKNEYRSLKNRLQSIILDNSFLENEVVPCFPNYPIIPNERCGLWYCDPKH 60

Query: 77  FAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPL 136
           F QTSYFKSTDGH NQWDFSTRRLNFHLLP L ++ G++IVDSTRRGKKIPDALSKT+P+
Sbjct: 61  FEQTSYFKSTDGHINQWDFSTRRLNFHLLPILAKSNGIIIVDSTRRGKKIPDALSKTIPI 120

Query: 137 WCAVLNSLMLESVGKK-FNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTK 195
           WCAVLN L+LE    +  +   VLFVPP TV  SE  ++ +K+ +LV KLK L V    +
Sbjct: 121 WCAVLNCLILEHASNEPIDYEKVLFVPPATVSNSEYHRILEKIEELVWKLKALEVLKPKE 180

Query: 196 TSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQD 255
              M +GKL+RPFWV+PGSSLL +  D FTGE    +W V  +ENI+PIILCTVSYQAQD
Sbjct: 181 LYNMTNGKLIRPFWVYPGSSLLHTIVDPFTGEPTGERWSVPENENIIPIILCTVSYQAQD 240

Query: 256 GIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNN 315
           G+DKR GF YVQGAADDHELWS GLE   FW NID   ++   D+ L E VD +  ++N+
Sbjct: 241 GVDKRRGFIYVQGAADDHELWSCGLEPKTFWENIDYLNDIGKTDAVLKEFVDTLTLEENH 300

Query: 316 NMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHL 375
             + S+   S+  I   +++VT  +SLG+I DN  + S+   +L   +S VI+LSET+ +
Sbjct: 301 EKKASS---SIIDIFESLNRVTPEISLGKIIDNCVIDSKLGGELSGKFSLVIILSETIEI 357

Query: 376 DKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTIN----NAIILQPIKPLLICCNT 431
            K      +++K+F+L SGSKKSSK+LR  LP+I  TIN    +A  L   KP+LICCN+
Sbjct: 358 TKLEEATTKIIKLFKLQSGSKKSSKSLRLQLPEIFDTINPYFQDASNLAK-KPILICCNS 416

Query: 432 GKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATL 491
           G DMS+ V+L +L + Y E W L   D    +SK VIR+HL KLI+ L GRNVNPSRATL
Sbjct: 417 GNDMSVAVILTILSKKYSEGWQLETSD-DLLISKTVIRKHLAKLISSLQGRNVNPSRATL 475

Query: 492 NSINSFLM 499
           NSINS+LM
Sbjct: 476 NSINSYLM 483

>NDAI0K00350 Chr11 complement(66993..68507) [1515 bp, 504 aa] {ON}
           Anc_8.848 YMR283C
          Length = 504

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 354/508 (69%), Gaps = 24/508 (4%)

Query: 12  MDRN-LLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLW 70
           MD++    SL QI+K++K++ +SLRNR+QSILLDNEFL   +   FP++P+IPNERCGLW
Sbjct: 1   MDQSYFFDSLSQINKDIKKEYKSLRNRLQSILLDNEFLNDEIIATFPNYPIIPNERCGLW 60

Query: 71  YCNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDAL 130
           Y +PS + QTSYFKSTDGH NQWDFSTRRLNFHLL T+ ++ G+ I+DSTRRGKKIPDAL
Sbjct: 61  YVSPSQYNQTSYFKSTDGHTNQWDFSTRRLNFHLLETIAKSKGITIIDSTRRGKKIPDAL 120

Query: 131 SKTVPLWCAVLNSLMLESVGKK---FNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKI 187
           SKT+P+WCAVLN +ML  +        V D LFVPP TVP+SE D + +K+P LVEKL  
Sbjct: 121 SKTIPIWCAVLNYIMLRELKGGNDIVKVEDCLFVPPATVPKSEYDCILQKIPTLVEKLDK 180

Query: 188 LNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEVSRDENIVPIIL 246
           L + +  +      GKLLRP W++PGSS+L S  D+FTGE+ +   WE    ENI+PI+L
Sbjct: 181 LEIINANELISTFHGKLLRPLWIYPGSSILHSSRDVFTGEKTKALAWEAP--ENIIPIVL 238

Query: 247 CTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIV 306
           CT+SYQAQDG+DKR GFTYVQGAADDHELWS GL   +FWS+I+   N +  D EL E V
Sbjct: 239 CTISYQAQDGVDKRYGFTYVQGAADDHELWSCGLTPELFWSHINYLGNPTHSDDELMEYV 298

Query: 307 DKMVTQQNNNMQRSAQAGSLDKIM-TGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYST 365
             M+  +  +        ++D I   G+D +T  +SLG+I +N+ ++   + + +K +S 
Sbjct: 299 RHMIEMKIKDSAAKTVELTMDAIFPNGVDPITPEISLGKIDNNIKITKSMLHEFKKGFSL 358

Query: 366 VIVLSETVHLDKD--ASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIK 423
           V++LSETV L+ D    Q ++ VKI++LTSGSKKSSK LR  +P I + +     L   K
Sbjct: 359 VVILSETVTLNSDDKDEQQSDSVKIYKLTSGSKKSSKRLRTEIPKIYEVMREN--LTNGK 416

Query: 424 PLLICCNTGKDMSIGVLLAVLCQNY------DEVWDLLPEDVKPS------VSKIVIRRH 471
           P+LICCNTG D+SIG++L +LC+NY       + W  L ++ + S      + K +IR++
Sbjct: 417 PILICCNTGTDISIGIILTILCKNYKLDPDNKKAWLRLEKETQDSNVPVKRLDKTIIRKN 476

Query: 472 LTKLIAHLNGRNVNPSRATLNSINSFLM 499
           LT LI+HL GRNVNPSRATLNS+N +LM
Sbjct: 477 LTTLISHLEGRNVNPSRATLNSVNDYLM 504

>KLTH0C03696g Chr3 (320129..321553) [1425 bp, 474 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 474

 Score =  518 bits (1335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/479 (54%), Positives = 341/479 (71%), Gaps = 18/479 (3%)

Query: 23  ISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHFAQTSY 82
           +++E+K++ RSLRNR+QSI+ D++FL+ +V   FPD+P+IPNERCG+WYC+P  + QTSY
Sbjct: 12  LNREIKKEYRSLRNRLQSIVFDHKFLDEQVKAVFPDYPIIPNERCGVWYCDPKDYLQTSY 71

Query: 83  FKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLWCAVLN 142
           FKSTDGH NQWDFS RRLNFHLLP L  +GG+V+VDSTRRGK++PDALSKTVP+WCAVLN
Sbjct: 72  FKSTDGHTNQWDFSLRRLNFHLLPALAASGGIVVVDSTRRGKRMPDALSKTVPIWCAVLN 131

Query: 143 SLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKTSRMLDG 202
           SL+LE  G +    +VLF PP+TV E E +++  ++PDLV K K +N+  G    R+  G
Sbjct: 132 SLLLEYQGLE---GEVLFCPPQTVSEFEFERIKSRIPDLVAKFKKMNILTGADIDRLFKG 188

Query: 203 KLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQDGIDKRNG 262
           K+LRP WVFPG+SLL S  D FTGE +  KW  +  EN +P++LCTVSYQ QDG+DKR+G
Sbjct: 189 KILRPLWVFPGASLLSSQRDPFTGEVLSQKWHTAELENFIPVVLCTVSYQCQDGVDKRHG 248

Query: 263 FTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNNNMQRSAQ 322
           FTYVQGAADDHELW+ GL A +FW +I    N++  D EL   V+  +  Q  N   SA+
Sbjct: 249 FTYVQGAADDHELWAQGLTAELFWKHISILSNINLSDQELESFVEDKIHPQEPN---SAE 305

Query: 323 AG-SLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHLDKDASQ 381
            G SLD+I+   D +T  L LG+I  NV L    + +L   YS VI+LS TV L    S+
Sbjct: 306 NGLSLDQILY-TDILTEELHLGKISSNVHLGEHLVKELRLKYSLVIILSNTVTL----SE 360

Query: 382 DNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLICCNTGKDMSIGVLL 441
           D   +KIF+L S  KKSSK LR  L  I   +  A +   + P+L+CCNTGKDMS+ V L
Sbjct: 361 DEAAIKIFKLQSECKKSSKALRTELIKIC-PLAEAYLPNSL-PMLVCCNTGKDMSVCVSL 418

Query: 442 AVLCQNYD-EVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATLNSINSFLM 499
           A+LC+NY+   WDL   +V+ S+ KI I++HL+K+I  L GRNVNP RA+LNS+N++LM
Sbjct: 419 AILCRNYNVGSWDL---NVQQSIHKIDIKKHLSKIITKLEGRNVNPPRASLNSVNAYLM 474

>Kwal_27.10219 s27 (246213..247715) [1503 bp, 500 aa] {ON} YMR283C
           (RIT1) - Initiator methionine tRNA 2'-O-ribosyl
           phosphate transferase [contig 39] FULL
          Length = 500

 Score =  508 bits (1309), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 253/491 (51%), Positives = 356/491 (72%), Gaps = 20/491 (4%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD     +L  ++KE+K+++++LRNR+QSIL D+ FLE +V   FP++PLIPNERCGLWY
Sbjct: 27  MDLTFDQTLNSLNKEIKKENKALRNRLQSILFDHRFLEEQVLALFPNYPLIPNERCGLWY 86

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           C+P  ++QTSYFKSTDGH+NQWDFS RRLN HLLPT+ + GG+VIVDSTRRGK++PDALS
Sbjct: 87  CDPERYSQTSYFKSTDGHSNQWDFSLRRLNVHLLPTITQKGGIVIVDSTRRGKRMPDALS 146

Query: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
           KTVP+WCAVLNS+MLE  G++ +  +VLF PP TV  SE +++  ++P LV + K L +F
Sbjct: 147 KTVPIWCAVLNSIMLE--GRQ-SEEEVLFCPPNTVSGSEFERIKSRIPSLVARFKELGLF 203

Query: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251
              +  ++LDGK+LRP WV+PG+SLL S  D FTG+ +   WE +++EN +P++LCTVSY
Sbjct: 204 TSDELFKILDGKILRPIWVYPGASLLNSHRDPFTGDIVTPTWE-AQNENFMPVVLCTVSY 262

Query: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311
           Q QDG+DKR+GFTYVQGAADDHELW+ GL A +FW +I+ FK+ +  D EL   V+ +VT
Sbjct: 263 QCQDGVDKRHGFTYVQGAADDHELWAEGLTAELFWQHIEIFKDTALSDQELSTYVNNLVT 322

Query: 312 Q--QNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVL 369
               NN + +S +   LD ++   +++T  L LG++ +N+ L    +  L+  YS V++L
Sbjct: 323 SGDANNKLTKSLR---LDDMLNA-NELTRELHLGQVAENIELDKNLVDQLKLKYSLVVLL 378

Query: 370 SETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLICC 429
           S ++ + ++A    E ++IF+L SGSKKSS+ LRA L  I   I     LQ   P+LICC
Sbjct: 379 STSISVYEEA----ENIRIFKLQSGSKKSSRALRAALTQICPLIEAN--LQNSLPVLICC 432

Query: 430 NTGKDMSIGVLLAVLCQNYD-EVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSR 488
           N GKDMS+ V+L+VLC+N++ E W L   + +PSV K +I++HL K+I  L+GRN+NP R
Sbjct: 433 NNGKDMSVCVVLSVLCRNFNVESWQL---EQRPSVHKSIIKKHLAKMITKLDGRNLNPPR 489

Query: 489 ATLNSINSFLM 499
            +LNS+N +LM
Sbjct: 490 VSLNSVNDYLM 500

>ZYRO0G14344g Chr7 complement(1148368..1149786) [1419 bp, 472 aa]
           {ON} similar to uniprot|P23796 Saccharomyces cerevisiae
           YMR283C RIT1 Modifies initiator methionine tRNA to
           distinguish it from elongator methionine tRNA Initiator
           methionine tRNA 2'-O-ribosyl phosphate transferase
          Length = 472

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 254/492 (51%), Positives = 342/492 (69%), Gaps = 24/492 (4%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD +L  SL QI++++K++  SLRNR+QSIL DN F+  RV   FP++PLIPNERCGLWY
Sbjct: 1   MDPDLAFSLNQINRDIKKEYTSLRNRIQSILFDNAFIAQRVIPRFPNYPLIPNERCGLWY 60

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           C+P  F QTSYFKSTDGH NQWDFSTRRLN HLLP LQE  G++IVDSTRRGK +PDALS
Sbjct: 61  CDPKDFDQTSYFKSTDGHTNQWDFSTRRLNLHLLPILQEKNGIIIVDSTRRGKLMPDALS 120

Query: 132 KTVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
           KT+P+WCAVLNSLM      + + ++VLF PP+ V +SE D +  ++P LV++L+ L++ 
Sbjct: 121 KTIPIWCAVLNSLM------QPDKSEVLFTPPKCVSQSEHDSIKTRIPSLVDRLEKLDIL 174

Query: 192 DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSY 251
           D         GK+LRPFWV+PGS +L+S TD FTGE I+ +WE   +E I+PIILCT SY
Sbjct: 175 DAQDLRNKFQGKILRPFWVYPGSDMLRSSTDPFTGEIIEIQWEPGPNEQIIPIILCTASY 234

Query: 252 QAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVT 311
           +AQDG+DKR+GFTYVQGAADDHELWS GL+  + W+N   F +L   D EL   V  ++ 
Sbjct: 235 RAQDGVDKRHGFTYVQGAADDHELWSCGLDPKLLWNNWHYFHDLDRNDKELESHVKTLIE 294

Query: 312 QQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSE 371
                  R+  A      +  +D +T  LSLG++ D+  ++     +L+  +S VI+LS+
Sbjct: 295 LAETTDHRNHLAD-----IVEMDPITKELSLGKLKDHTAITPNIARELDSQFSLVIILSQ 349

Query: 372 TVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDI----SKTINNAIILQPIKPLLI 427
           +V L    S+  + +K + L SGSK+SSK+LRA L +I    S  +N  ++ +  KP+++
Sbjct: 350 SVTL----SKPFDFIKTYNLQSGSKRSSKDLRAALIEIDHIVSAHLNKDVVKR--KPIMV 403

Query: 428 CCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPS 487
           CCN+G D+S+GV+L +LC+ Y + W L   D   SV+K VIRRHL ++I  +  RNVNPS
Sbjct: 404 CCNSGTDISVGVILMILCKYYSQDWLLGKPD---SVNKFVIRRHLVQIINKIKRRNVNPS 460

Query: 488 RATLNSINSFLM 499
           RATLNSINSFLM
Sbjct: 461 RATLNSINSFLM 472

>TPHA0I00300 Chr9 complement(57211..58692) [1482 bp, 493 aa] {ON}
           Anc_8.848 YMR283C
          Length = 493

 Score =  505 bits (1301), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 252/496 (50%), Positives = 343/496 (69%), Gaps = 21/496 (4%)

Query: 18  TSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYCNPSHF 77
            S+ QI+K+++++++SL+NR+ SILLD++FL+ +V   FP +PL+PNERCGLWYC  ++F
Sbjct: 5   ASVNQITKDIRKENKSLKNRIHSILLDSKFLDEKVIPFFP-YPLVPNERCGLWYCKRANF 63

Query: 78  AQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLW 137
             TSYFKSTDGH NQWDFSTRRLNFHL+P ++E  G++I+DSTRRGKKIPDALSKTVP+W
Sbjct: 64  TTTSYFKSTDGHINQWDFSTRRLNFHLIPLIEEQKGIIIIDSTRRGKKIPDALSKTVPIW 123

Query: 138 CAVLNSLMLESV-GKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKT 196
           CAVLN+++L+    ++    +VLFVPP TV +SE +++  K+P+LVEKL  L+V DG K 
Sbjct: 124 CAVLNTMILQHCENEEDKSREVLFVPPATVSKSEYERIKNKIPELVEKLCKLDVIDGKKL 183

Query: 197 SRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEV-SRDENIVPIILCTVSYQAQ 254
               +G LLRP W+ PGSS+LQS  D FTGE + N  WE  S++E I+PI+LCTVSYQ Q
Sbjct: 184 YEQFEGNLLRPIWIHPGSSILQSQFDPFTGEIVSNSSWEEPSKEEKIIPIVLCTVSYQVQ 243

Query: 255 DGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQN 314
           DG+D R+GFTYVQGAADDHELWSHGL   +FW NI+   NL   +  L + V++++  ++
Sbjct: 244 DGVDVRDGFTYVQGAADDHELWSHGLSPQLFWDNIELLNNLELSEEMLEDYVEEILLSES 303

Query: 315 NNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVH 374
             +        +D +   IDK+T  L LG I D + +    +    K YS VI+LS ++ 
Sbjct: 304 MKITNL----EVDGVFKSIDKITEELYLGNIVDGLEIKQNLMEMFNKSYSLVIILSNSIK 359

Query: 375 LDKDASQDNE---------MVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIIL--QPIK 423
           L  D   +           ++K+FRL SGSKKSSK LR+ LP+I   + + +       K
Sbjct: 360 LASDEQNEQSANAKTSKTNIIKLFRLQSGSKKSSKELRSCLPEICDLLTDELSSSGSTKK 419

Query: 424 PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRN 483
           P+L+CCN G DMSI V+L  L + Y + W    E  +  ++KI IR+HLTK+I+HL GRN
Sbjct: 420 PILVCCNNGSDMSIAVILVTLSKFYTQEWRRTSEHTE--INKITIRKHLTKVISHLGGRN 477

Query: 484 VNPSRATLNSINSFLM 499
           VNPSRATLNS+N FLM
Sbjct: 478 VNPSRATLNSVNDFLM 493

>KLLA0D01386g Chr4 (118965..120434) [1470 bp, 489 aa] {ON} similar
           to uniprot|P23796 Saccharomyces cerevisiae YMR283C RIT1
           Modifies initiator methionine tRNA to distinguish it
           from elongator methionine tRNA Initiator methionine tRNA
           2'-O-ribosyl phosphate transferase
          Length = 489

 Score =  500 bits (1288), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 262/504 (51%), Positives = 351/504 (69%), Gaps = 31/504 (6%)

Query: 12  MDRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWY 71
           MD+  L  + +ISKEL+++D+SL+NR+QSI+ DN FL+ +V   F  +P++PNERCGLWY
Sbjct: 1   MDKETLREIKEISKELRKEDKSLKNRLQSIIFDNNFLKEQVFPTF-QYPVVPNERCGLWY 59

Query: 72  CNPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALS 131
           C+P  +  TSYFKSTDGH NQWDFSTRRLNFHLLP L E GG+VI+DSTRRGKKIPDALS
Sbjct: 60  CDPKIYDTTSYFKSTDGHMNQWDFSTRRLNFHLLPLLGENGGLVILDSTRRGKKIPDALS 119

Query: 132 KTVPLWCAVLNSLMLESVGKKFNV-NDVLFVPPETVPESERDQMAKKLPDLVEKLKILNV 190
           KTVP+WCAVLN LMLE+ GK++    ++LFVPP TVPESE D+M  KLP+LV+KLK L++
Sbjct: 120 KTVPIWCAVLNYLMLEADGKQWPFEEEILFVPPSTVPESEFDRMFAKLPELVQKLKKLDI 179

Query: 191 FDGTKTSRMLD-----GKLLRPFWVFPGSSLLQSCTDIFTGEQIQN-KWEVSRDENIVPI 244
            D  K  + L       KLLRP WV+PGSSLLQ   D+F+GE I+N  WE     NI+P+
Sbjct: 180 IDVKKLRKSLQIEEGHDKLLRPIWVYPGSSLLQLKHDLFSGEVIENTHWEPP--SNIIPV 237

Query: 245 ILCTVSYQAQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYE 304
           ILCTVSYQ QDG DKR GFTYVQGAADDHELW+  L   +FW NID+  ++S  D+EL +
Sbjct: 238 ILCTVSYQCQDGTDKRYGFTYVQGAADDHELWAENLTPQLFWENIDELGDISKSDAELKD 297

Query: 305 IVDKMVTQQNNNMQRSAQ-AGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCY 363
             + ++ +    +Q S   +G + K M  ID +T+ L LG+I     ++ + +  L + Y
Sbjct: 298 SYNAVILRA--KVQNSLDISGDISK-MLEIDTITARLHLGKITSQFRITPKTVKYLNQKY 354

Query: 364 STVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIK 423
           S V++  E + +  + ++    + IF L SGSKKSS+ LR+ L  I     NA+I + + 
Sbjct: 355 SAVVLCHEAISV-TEITELPRSIHIFPLPSGSKKSSRELRSHLIKI-----NALIEEQLS 408

Query: 424 --------PLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKL 475
                   P+LI C++GKD+S+ +LL  LC+ Y+  W+L P+D   SV+K +I++HL K+
Sbjct: 409 RPDTAANLPILIACDSGKDISVSILLVALCKYYNLDWELQPQD---SVNKTIIKKHLAKI 465

Query: 476 IAHLNGRNVNPSRATLNSINSFLM 499
           I  L GRNVNPSRA+LNS+NSFLM
Sbjct: 466 IESLQGRNVNPSRASLNSVNSFLM 489

>Ecym_4623 Chr4 (1219438..1220880) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR451C
          Length = 480

 Score =  494 bits (1273), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 244/492 (49%), Positives = 338/492 (68%), Gaps = 19/492 (3%)

Query: 13  DRNLLTSLPQISKELKRDDRSLRNRVQSILLDNEFLETRVHTAFPDFPLIPNERCGLWYC 72
           D + L +L QI KE++RD  SLRNR+QS+  D++F+   V   FP++PL+PNERCGLWYC
Sbjct: 3   DESGLDTLKQIKKEIRRDCTSLRNRLQSVFYDSKFIANEVLPMFPNYPLVPNERCGLWYC 62

Query: 73  NPSHFAQTSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSK 132
           NP  + QT YFKSTDGH NQWDFSTRRLNFH+L  + EAGG++IVDSTRRGKK+PDALSK
Sbjct: 63  NPGKYEQTCYFKSTDGHTNQWDFSTRRLNFHILSKMAEAGGIIIVDSTRRGKKMPDALSK 122

Query: 133 TVPLWCAVLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFD 192
           T+P+WCAVLN+LML+  GK+ ++   LF PP TV + E D +  K+PDLVEKLK LN+  
Sbjct: 123 TIPIWCAVLNNLMLDYKGKEDSIPS-LFCPPGTVSKLEFDGIHSKVPDLVEKLKKLNIIS 181

Query: 193 GTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQ 252
           G +   M  GK+LRPFWV+PGS LL +  DIFTGE + N W+   ++N +P+ILCT SYQ
Sbjct: 182 GEELYNMFQGKVLRPFWVYPGSPLLDTSRDIFTGEVLGNVWQ--SEQNSIPVILCTASYQ 239

Query: 253 AQDGIDKRNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKM--- 309
            QDG DK +GFTYVQGAADDHELW++GL   IFW NI+   +    + EL + V ++   
Sbjct: 240 CQDGEDKHHGFTYVQGAADDHELWANGLNPEIFWKNIEFLGDPDKSEFELEDFVQRIGRT 299

Query: 310 --VTQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVI 367
             +T Q+N       + S  K    +D++T  L LG + + + L+     +L+  YS  I
Sbjct: 300 EKLTAQSNKQSDRESSSSFIK----VDEITKNLYLGTVAEGIALTENIEKELKSKYSLCI 355

Query: 368 VLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLI 427
           + S++V    D   + E +K++ + + SKKSS++LR  L +IS  I   I  Q   P+LI
Sbjct: 356 ICSQSVTAKADC--NCERIKVYPINNNSKKSSRDLRVALIEISGLIKQHITDQ--LPILI 411

Query: 428 CCNTGKDMSIGVLLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPS 487
           CCNTGKD+SIG++L  LCQ+YD  W L  ++   +V+K ++++HL ++I  L+G N+NPS
Sbjct: 412 CCNTGKDISIGIMLTALCQHYDLQWHLEEQE---TVNKTIVKKHLARIITKLSGININPS 468

Query: 488 RATLNSINSFLM 499
           R+TL ++N+FL+
Sbjct: 469 RSTLKNVNAFLL 480

>AFR451C Chr6 complement(1248648..1249874) [1227 bp, 408 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR283C
           (RIT1)
          Length = 408

 Score =  375 bits (964), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 197/420 (46%), Positives = 276/420 (65%), Gaps = 16/420 (3%)

Query: 80  TSYFKSTDGHANQWDFSTRRLNFHLLPTLQEAGGVVIVDSTRRGKKIPDALSKTVPLWCA 139
           T YFKSTDGH N WDFS RRLNFHLLP L E  G +IVDSTRRGKKIPDALSKT+P+WCA
Sbjct: 5   TCYFKSTDGHVNGWDFSVRRLNFHLLPLLAERSGAIIVDSTRRGKKIPDALSKTIPIWCA 64

Query: 140 VLNSLMLESVGKKFNVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVFDGTKTSRM 199
           VLN+L+LE         +VLF PP TV + E +++  KLP+LV+KLK ++   G +   +
Sbjct: 65  VLNTLILEHTEGS---GEVLFCPPGTVSQLEYNRIQAKLPELVQKLKRVDAISGAELCSL 121

Query: 200 LDGKLLRPFWVFPGSSLLQSCTDIFTGEQIQNKWEVSRDENIVPIILCTVSYQAQDGIDK 259
           L G+LLRPFWV+PG+++L +  D+FTGE +Q  W+      ++P+ILCT S Q QDG+DK
Sbjct: 122 LGGRLLRPFWVYPGAAMLGTTRDLFTGESLQEPWQ--PPPGVIPLILCTASRQCQDGVDK 179

Query: 260 RNGFTYVQGAADDHELWSHGLEANIFWSNIDKFKNLSGGDSELYEIVDKMVTQQNNNMQR 319
             G+ YVQGAADDHELW++GL  ++FW+N+    + S  +  L   V+++V + + +   
Sbjct: 180 SQGYAYVQGAADDHELWANGLTPSLFWANVQLLADDSMPEQLLQGHVERIV-ELHKSTHT 238

Query: 320 SAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETVHLDKDA 379
            A A  L    T  D VT  L LG +     +S +    LE+ YS V++   ++ L   A
Sbjct: 239 EAVAHELPCRET--DVVTEHLRLGSVAP-CQISDKQAELLEQQYSLVVLCGSSIEL--SA 293

Query: 380 SQDNEMVKIFRLTSGSKKSSKNLRAMLPDISKTINNAIILQPIKPLLICCNTGKDMSIGV 439
           +  +  ++I+ L SG KKSS+ LR  L +I   I+ A  L    P+LICC++G D+S+G+
Sbjct: 294 AAPHPRIRIYPLNSGCKKSSRALRPALIEIIPLISTA--LCEALPVLICCSSGSDISVGI 351

Query: 440 LLAVLCQNYDEVWDLLPEDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATLNSINSFLM 499
           +LA LC+NYD  W    ED K  ++K +I++HL KL + ++GR +NPSR TLNS+N+FLM
Sbjct: 352 VLAALCKNYDLEWR--HEDQK-DMTKTIIKKHLIKLTSKIHGRIINPSRTTLNSVNAFLM 408

>AEL081W Chr5 (476365..477495) [1131 bp, 376 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR026C (ETR1)
          Length = 376

 Score = 35.4 bits (80), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 33/131 (25%), Positives = 59/131 (45%), Gaps = 12/131 (9%)

Query: 303 YEIVDKMVT---QQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADL 359
           Y++V+  V      N  + ++A   ++ KI+T + +   + +L  I D    + E   +L
Sbjct: 159 YQLVNDYVQWDPSGNEWIVQNAGTSAVSKIVTQVAQARGVKTLSVIRDRENFA-EVAKEL 217

Query: 360 EKCYSTVIVLSETVHLDKDASQD--------NEMVKIFRLTSGSKKSSKNLRAMLPDISK 411
           E+ Y    V+SET + DKD S+D        N  V++   + G K S    R +  D + 
Sbjct: 218 EERYGATKVISETQNNDKDFSKDELPVILGPNARVRLALNSVGGKSSGAIARKLERDGTM 277

Query: 412 TINNAIILQPI 422
                +  QP+
Sbjct: 278 LTYGGMSRQPV 288

>KAFR0G03790 Chr7 (777976..783936) [5961 bp, 1986 aa] {ON} Anc_1.127
            YJL207C
          Length = 1986

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 29/99 (29%), Positives = 43/99 (43%), Gaps = 11/99 (11%)

Query: 134  VPLWCAVLNSLMLESVGKKF--NVNDVLFVPPETVPESERDQMAKKLPDLVEKLKILNVF 191
            +PLW   L   M+ + G +    +ND      E +PES+R +M    P  +  +K+L   
Sbjct: 1500 IPLWIVSLREFMMITHGARARKQINDS--NKDENLPESKRSEMELYEPVWLNFVKVLGAI 1557

Query: 192  ---DGTKTSRMLDGKLLRPFWVFPGSSLLQSCTDIFTGE 227
               D  K S  LD + L  F       L+  C DI + E
Sbjct: 1558 LQTDAKKISDYLDKEELESF----SFVLVAKCFDIISKE 1592

>SAKL0A03850g Chr1 complement(359511..361142) [1632 bp, 543 aa] {ON}
           similar to gnl|GLV|KLLA0B01936g Kluyveromyces lactis
           KLLA0B01936g and weakly similar to YGL138C
           uniprot|P53122 Saccharomyces cerevisiae YGL138C
           Hypothetical ORF
          Length = 543

 Score = 32.0 bits (71), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 31/160 (19%), Positives = 61/160 (38%), Gaps = 18/160 (11%)

Query: 355 AIADLEKCYSTVIVLSETVHLDKDASQDNEMVKIFRLTSGSKKSSKNLRAMLP------- 407
            +A +   +    V +E   L + A +D +    F++    K  ++N+    P       
Sbjct: 217 TMAKIRSMFKNSTVQAEAETLKQLAIKDIKNFNCFKIARRKKYVNRNVSIYFPNSWVGGI 276

Query: 408 -----------DISKTINNAIILQPIKPLLICCNTGKDMSIGVLLAVLCQNYDEVWDLLP 456
                      DI  T+NN +  +       C N     +   L  ++  NY   W    
Sbjct: 277 FYCDLSDVKKRDILNTMNNNLQFENSVSQSQCMNACHRRNSVPLQPLISDNYLNHWTEYK 336

Query: 457 EDVKPSVSKIVIRRHLTKLIAHLNGRNVNPSRATLNSINS 496
           E+ K  + K + +  + K+I +L   N +PS +   +++S
Sbjct: 337 ENSKIPILKKIFKLDMNKIIPYLYTPNSSPSDSNFTTLHS 376

>Ecym_3544 Chr3 complement(1029358..1030494) [1137 bp, 378 aa] {ON}
           similar to Ashbya gossypii AEL081W
          Length = 378

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 12/131 (9%)

Query: 303 YEIVDKMV---TQQNNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADL 359
           Y++V+  +    + N  + ++A    + KI+T I K   + +L  I D      E   +L
Sbjct: 161 YQLVNDYIDWDPKGNEWLIQNAGTSGVSKIVTQIAKANGIKTLSVIRDRDNFE-EVAKEL 219

Query: 360 EKCYSTVIVLSETVHLDKDASQD--------NEMVKIFRLTSGSKKSSKNLRAMLPDISK 411
           E+ Y    V+SE+ + DK  S          N  +++   + G K S+   R + P+ + 
Sbjct: 220 EQRYGATKVISESQNSDKHFSASELPQILGPNAKIRLALNSVGGKSSASIARKLSPNSTM 279

Query: 412 TINNAIILQPI 422
                +  QP+
Sbjct: 280 LTYGGMSKQPV 290

>Smik_9.190 Chr9 (314862..316949) [2088 bp, 695 aa] {ON} YIL009W
           (REAL)
          Length = 695

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 37/145 (25%), Positives = 59/145 (40%), Gaps = 19/145 (13%)

Query: 326 LDKIMTGIDKVTSLLSLGE---IHDNVTLSSEAIADLEKCYSTVIVLSETVH-----LDK 377
           L  I  GI  VT+  +LGE   IH  V   S AI    +  + +IV  ++       +  
Sbjct: 145 LGCISQGIPVVTAYDTLGESGLIHSMVETESSAIFTDNQLLAKMIVPLQSARDIKILIHN 204

Query: 378 DASQDNEMVKIFRLTSGSKKSSKNLRAMLPDI-----------SKTINNAIILQPIKPLL 426
           +    N+  +  +L   +K +   +R + PDI            K   + I+L P KP  
Sbjct: 205 EPIDPNDKRQNGKLYKAAKDAINKIREVRPDIKIYSFEEVIKIGKKSKDEIVLHPPKPED 264

Query: 427 ICCNTGKDMSIGVLLAVLCQNYDEV 451
           + C      SIG    V+  +Y+ V
Sbjct: 265 LACIMYTSGSIGAPKGVMLTHYNIV 289

>Suva_3.131 Chr3 (197778..204236) [6459 bp, 2152 aa] {ON} YCR093W
            (REAL)
          Length = 2152

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 45/101 (44%), Gaps = 14/101 (13%)

Query: 169  SERDQMAKKLPDLVEKLKILNVFDGTKTSRMLDGKLLRPFWVFPGSSLLQ--SCTDIFTG 226
            S  D+  KK     E  KI+ V  GTKT+R     L+   WV     LLQ   C D+ T 
Sbjct: 1583 SLEDESVKKFIQDFEDTKIMPVKKGTKTTRTEKFYLVFTEWV----KLLQRVECNDVITA 1638

Query: 227  ---EQIQNKWEVSRDENIVPII-----LCTVSYQAQDGIDK 259
               +Q+  K  +S  +N++  +     L   S++  D  D+
Sbjct: 1639 VFIKQLVEKGVISDTDNLITFVKSSLELSVSSFKESDPTDE 1679

>NCAS0A03930 Chr1 (795607..797235) [1629 bp, 542 aa] {ON} Anc_2.382
          Length = 542

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 51/116 (43%), Gaps = 13/116 (11%)

Query: 314 NNNMQRSAQAGSLDKIMTGIDKVTSLLSLGEIHDNVTLSSEAIADLEKCYSTVIVLSETV 373
           N NMQR  Q    D ++ GI   ++  ++  +++N     E I+D EK    V+   ET 
Sbjct: 190 NENMQRELQL-DYDYLVVGIGAQSTTFNIPGVYENANFLKE-ISDSEKIRLKVLKNIETA 247

Query: 374 -HLDKDASQDNEMVKIFRLTSGSKKS----------SKNLRAMLPDISKTINNAII 418
             L KD  +   ++    +  G              S++L+  LPDISK I   ++
Sbjct: 248 SFLKKDDPERQRLLNFVVVGGGPTGVEFAAELNDYVSQDLKKWLPDISKDIKVTLV 303

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,012,084
Number of extensions: 2395771
Number of successful extensions: 7500
Number of sequences better than 10.0: 43
Number of HSP's gapped: 7613
Number of HSP's successfully gapped: 43
Length of query: 499
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 385
Effective length of database: 40,409,475
Effective search space: 15557647875
Effective search space used: 15557647875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)