Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0I021302.151ON92924753e-63
NDAI0F028202.151ON128952762e-32
TDEL0B051302.151ON93912699e-32
KAFR0J020902.151ON92912681e-31
Smik_14.2062.151ON113982672e-31
Skud_14.2102.151ON103982645e-31
CAGL0L04070g2.151ON95722638e-31
YNL122C2.151ON1151012622e-30
ZYRO0G06490g2.151ON92922575e-30
Suva_14.2182.151ON112992561e-29
KLLA0F24068g2.151ON95812523e-29
SAKL0E10978g2.151ON95922491e-28
ABR133W2.151ON96972481e-28
Ecym_82022.151ON98682447e-28
Kpol_505.212.151ON85672298e-26
NCAS0G024702.151ON88692281e-25
Kwal_33.147622.151ON91922281e-25
KLTH0B05214g2.151ON91672161e-23
TPHA0F018802.151ON99662063e-22
TBLA0B012302.151ON97671631e-15
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0I02130
         (92 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151...   187   3e-63
NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.15...   110   2e-32
TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}...   108   9e-32
KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.15...   107   1e-31
Smik_14.206 Chr14 complement(377692..377997,378001..378009,37801...   107   2e-31
Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309...   106   5e-31
CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly ...   105   8e-31
YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON} P...   105   2e-30
ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON...   103   5e-30
Suva_14.218 Chr14 complement(394669..394965,394969..394983,39499...   103   1e-29
KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} simila...   101   3e-29
SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some sim...   100   1e-28
ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic homo...   100   1e-28
Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON} s...    99   7e-28
Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON} (56756..570...    93   8e-26
NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}...    92   1e-25
Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON...    92   1e-25
KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some sim...    88   1e-23
TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151...    84   3e-22
TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}...    67   1e-15

>KNAG0I02130 Chr9 (416674..416952) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  187 bits (475), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 92/92 (100%), Positives = 92/92 (100%)

Query: 1  MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60
          MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN
Sbjct: 1  MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60

Query: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
          CGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH
Sbjct: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92

>NDAI0F02820 Chr6 (693148..693534) [387 bp, 128 aa] {ON} Anc_2.151
           YNL122C
          Length = 128

 Score =  110 bits (276), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 54/95 (56%), Positives = 69/95 (72%), Gaps = 3/95 (3%)

Query: 1   MSFLSALSPLFKNGFAAWKIPSAS---MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRK 57
           M  +S++S LFK G  +  +   S   +++TR+LMKTHKGAAKRWRK+A GFKRGI+GR 
Sbjct: 34  MFTVSSMSSLFKTGLLSMGLKGQSFNSLVITRNLMKTHKGAAKRWRKSAQGFKRGIAGRN 93

Query: 58  HGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           HGN GWS R L  LTGR EA  + +K LK++LPYH
Sbjct: 94  HGNVGWSHRYLNKLTGRKEADPTHVKHLKRMLPYH 128

>TDEL0B05130 Chr2 complement(904074..904355) [282 bp, 93 aa] {ON}
          Anc_2.151 YNL122C
          Length = 93

 Score =  108 bits (269), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 70/91 (76%), Gaps = 1/91 (1%)

Query: 1  MSFLSALSPLFKNGFAAW-KIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHG 59
          M F S ++P+F+     + K+ + S+I+TRSLMKTHKGAAKRWRK A  FKRG +GR HG
Sbjct: 2  MFFSSIINPIFRTCLNTFSKVEAPSLILTRSLMKTHKGAAKRWRKTATSFKRGKAGRSHG 61

Query: 60 NCGWSQRGLKALTGRTEAHQSQIKRLKKLLP 90
          N GWS+R LK+L+G+T AH++ IK LK+L+P
Sbjct: 62 NAGWSRRSLKSLSGKTLAHETHIKHLKRLMP 92

>KAFR0J02090 Chr10 (400769..401047) [279 bp, 92 aa] {ON} Anc_2.151
          YNL122C
          Length = 92

 Score =  107 bits (268), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%)

Query: 1  MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60
          M F    S LF  G +  +  S ++I+ R+LMKTHKG AKRWRK ANGFKRGI+GR HGN
Sbjct: 1  MLFKPFFSALFTMGSSVVRRESPTLIIARNLMKTHKGTAKRWRKTANGFKRGIAGRNHGN 60

Query: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPY 91
           GWS+R LK LTGR  A  SQ KRLK+LLP+
Sbjct: 61 GGWSRRSLKCLTGRKTATPSQAKRLKRLLPF 91

>Smik_14.206 Chr14
           complement(377692..377997,378001..378009,378013..378036)
           [339 bp, 113 aa] {ON} YNL122C (REAL)
          Length = 113

 Score =  107 bits (267), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 65/98 (66%), Gaps = 6/98 (6%)

Query: 1   MSFLSALSPL------FKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGIS 54
           MS  S  +PL      FK  F  +   + S +  R+LMKTHKG AKRWR+  N FKRGI+
Sbjct: 16  MSMFSIFNPLLKGSNNFKARFHGFLFNNVSTVTIRTLMKTHKGTAKRWRRTGNTFKRGIA 75

Query: 55  GRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           GRKHGN GWS R LKALTGR  A+ + +K LK+LLPYH
Sbjct: 76  GRKHGNIGWSHRSLKALTGRKTANSAYLKHLKRLLPYH 113

>Skud_14.210 Chr14 complement(388110..388406,388410..388421) [309
           bp, 103 aa] {ON} YNL122C (REAL)
          Length = 103

 Score =  106 bits (264), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 63/98 (64%), Gaps = 6/98 (6%)

Query: 1   MSFLSALSPLFKNG------FAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGIS 54
           MS  + L+PL K        F      +   I  R+LMKTHKG AKRWR+  N FKRGI+
Sbjct: 6   MSLFNVLNPLLKGSNSLRPKFNGILFNNVCTITIRTLMKTHKGTAKRWRRTGNTFKRGIA 65

Query: 55  GRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           GRKHGN GWS R LKALTGR  AH + +K LK+LLPYH
Sbjct: 66  GRKHGNIGWSHRSLKALTGRKTAHPAYLKHLKRLLPYH 103

>CAGL0L04070g Chr12 (478686..478973) [288 bp, 95 aa] {ON} highly
          similar to uniprot|P53921 Saccharomyces cerevisiae
          YNL122c
          Length = 95

 Score =  105 bits (263), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 46/72 (63%), Positives = 60/72 (83%)

Query: 20 IPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQ 79
          + S  M+  R+LMKTH+GA KRWR+ + GFKRGI+GRKHGN GWS R LK+LTGRT+AH 
Sbjct: 23 VSSFGMVFCRTLMKTHRGALKRWRQTSTGFKRGIAGRKHGNIGWSHRSLKSLTGRTDAHP 82

Query: 80 SQIKRLKKLLPY 91
          +Q+KRL++L+PY
Sbjct: 83 TQMKRLRRLMPY 94

>YNL122C Chr14 complement(398023..398370) [348 bp, 115 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to mitochondria;
           YNL122C is not an essential gene
          Length = 115

 Score =  105 bits (262), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 64/101 (63%), Gaps = 12/101 (11%)

Query: 1   MSFLSALSPLFK---------NGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKR 51
           MS  + L PL K         NGF      + S I  R+LMKTHKG AKRWR+  N FKR
Sbjct: 18  MSVFNVLKPLLKGSNSFKVKLNGFL---FNNVSTITIRTLMKTHKGTAKRWRRTGNTFKR 74

Query: 52  GISGRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           GI+GRKHGN GWS R LKALTGR  AH +  K LK+LLPYH
Sbjct: 75  GIAGRKHGNIGWSHRSLKALTGRKIAHPAYSKHLKRLLPYH 115

>ZYRO0G06490g Chr7 complement(515132..515410) [279 bp, 92 aa] {ON}
          similar to uniprot|Q75D91 Ashbya gossypii ABR133W 50S
          ribosomal protein L35 and some similarites with YNL122C
          uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 92

 Score =  103 bits (257), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 70/92 (76%), Gaps = 1/92 (1%)

Query: 1  MSFLSALSPLFKNGFAAWK-IPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHG 59
          M F S +    ++ FA++    S+S++ TR+LMKTHKG AKRW+K A+GFKRG +GR HG
Sbjct: 1  MFFNSIVGLGSRSAFASFGGFNSSSLVFTRNLMKTHKGTAKRWKKTADGFKRGKAGRNHG 60

Query: 60 NCGWSQRGLKALTGRTEAHQSQIKRLKKLLPY 91
          N GWS+R LK L+G+T AH+S I+RL++LLPY
Sbjct: 61 NVGWSRRSLKVLSGKTPAHESHIQRLRRLLPY 92

>Suva_14.218 Chr14
           complement(394669..394965,394969..394983,394990..395013)
           [336 bp, 112 aa] {ON} YNL122C (REAL)
          Length = 112

 Score =  103 bits (256), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 65/99 (65%), Gaps = 8/99 (8%)

Query: 1   MSFLSALSPLFKNGFAAWK-------IPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGI 53
           MS  +  +PL K G  ++K         + S I  R+LMKTHKG AKRWR+  N FKRGI
Sbjct: 15  MSLFNLFNPLLK-GSNSFKPRLNQLLFNNVSTITIRTLMKTHKGTAKRWRRTGNTFKRGI 73

Query: 54  SGRKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           +GRKHGN GWS R LK LTGR  A+ S +K LK+LLPYH
Sbjct: 74  AGRKHGNIGWSHRSLKVLTGRKTANSSYLKHLKRLLPYH 112

>KLLA0F24068g Chr6 (2242939..2243226) [288 bp, 95 aa] {ON} similar
          to uniprot|P53921 Saccharomyces cerevisiae YNL122C
          Hypothetical ORF
          Length = 95

 Score =  101 bits (252), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 61/81 (75%)

Query: 12 KNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKAL 71
          + G    K   +S+I+TR+LMKTHKGAAKRWRK AN FKRG +GR HGN GWS+  LK+L
Sbjct: 15 RTGLLGSKTNVSSLILTRNLMKTHKGAAKRWRKTANSFKRGKAGRNHGNAGWSRNSLKSL 74

Query: 72 TGRTEAHQSQIKRLKKLLPYH 92
          +GR+ A  + + RLK+LLPYH
Sbjct: 75 SGRSLADSTHMHRLKRLLPYH 95

>SAKL0E10978g Chr5 (919541..919828) [288 bp, 95 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 95

 Score =  100 bits (249), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 67/92 (72%), Gaps = 1/92 (1%)

Query: 2  SFLSALSPL-FKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60
          S L  LS +  K G +  +I   S+++TR+LMKTHKGAAKRW+K AN +KRG +GR HGN
Sbjct: 4  SLLRPLSNISVKFGTSLSQIQHPSLVLTRNLMKTHKGAAKRWKKTANSYKRGRAGRNHGN 63

Query: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           GW++  LK+L G+T AH + IK LK+LLPYH
Sbjct: 64 AGWNKSTLKSLDGKTLAHPTHIKHLKRLLPYH 95

>ABR133W Chr2 (644796..645086) [291 bp, 96 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YNL122C
          Length = 96

 Score =  100 bits (248), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 55/97 (56%), Positives = 67/97 (69%), Gaps = 9/97 (9%)

Query: 3  FLSALSPL------FKNG-FAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISG 55
          F + L PL      F +G FAA   PS  +I+ R+LMKTHKGAAKRWRK A G+KR  +G
Sbjct: 2  FFNMLRPLTGLPVRFGSGAFAATTQPS--LIMVRTLMKTHKGAAKRWRKTAGGYKRSKAG 59

Query: 56 RKHGNCGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
          R HGN GW QR LK L+GRT A  + +KRL++LLPYH
Sbjct: 60 RSHGNTGWGQRALKQLSGRTMAASAHLKRLRRLLPYH 96

>Ecym_8202 Chr8 complement(418239..418535) [297 bp, 98 aa] {ON}
          similar to Ashbya gossypii ABR133W
          Length = 98

 Score = 98.6 bits (244), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 55/68 (80%)

Query: 25 MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84
          +I +RSLMKTHKGAAKRWRK AN FKRG +GR HGN GWS+  LK L+GR  A+ SQ+ R
Sbjct: 31 LIFSRSLMKTHKGAAKRWRKTANSFKRGKAGRSHGNSGWSKNSLKVLSGRALANGSQLNR 90

Query: 85 LKKLLPYH 92
          LK+LLPYH
Sbjct: 91 LKRLLPYH 98

>Kpol_505.21 s505 (56756..57013) [258 bp, 85 aa] {ON}
          (56756..57013) [258 nt, 86 aa]
          Length = 85

 Score = 92.8 bits (229), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 45/67 (67%), Positives = 54/67 (80%), Gaps = 2/67 (2%)

Query: 27 VTRSLMKTHKGAAKRWR--KNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84
          +TRSLMKTHKG AKRW+  K+ + FKRG SGR+HGN GWSQR LK L+GRT AH + + R
Sbjct: 18 ITRSLMKTHKGTAKRWKFIKSLDTFKRGKSGRQHGNVGWSQRSLKHLSGRTYAHTTHVSR 77

Query: 85 LKKLLPY 91
          L+KLLPY
Sbjct: 78 LRKLLPY 84

>NCAS0G02470 Chr7 complement(439576..439842) [267 bp, 88 aa] {ON}
          Anc_2.151 YNL122C
          Length = 88

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 54/69 (78%)

Query: 23 ASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQI 82
           ++ +TR+LMKTHKG AKRWR+ A  FKRGI+GR HGN GWS+R LK L+GR +A  S +
Sbjct: 19 TTLTITRNLMKTHKGTAKRWRRTAQSFKRGIAGRNHGNAGWSRRSLKHLSGRKDADPSYL 78

Query: 83 KRLKKLLPY 91
          + LK+L+PY
Sbjct: 79 RHLKRLMPY 87

>Kwal_33.14762 s33 complement(808878..809153) [276 bp, 91 aa] {ON}
          YNL122C - Hypothetical ORF [contig 101] FULL
          Length = 91

 Score = 92.4 bits (228), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 48/92 (52%), Positives = 62/92 (67%), Gaps = 2/92 (2%)

Query: 1  MSFLSALSPLFKNGFAAWKIPSASMIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGN 60
          +S+L  +  +F  G +  +I    M  TR+LMKTHKG AKRWRK +  +KRG +GR HGN
Sbjct: 2  LSYL--VRSVFSFGKSFSQIQQPFMQQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGN 59

Query: 61 CGWSQRGLKALTGRTEAHQSQIKRLKKLLPYH 92
           GW +  LKAL G+T AH + IK LK+LLPYH
Sbjct: 60 AGWGKSTLKALDGKTLAHSTHIKHLKRLLPYH 91

>KLTH0B05214g Chr2 (430231..430506) [276 bp, 91 aa] {ON} some
          similarities with uniprot|P53921 Saccharomyces
          cerevisiae YNL122C Hypothetical ORF
          Length = 91

 Score = 87.8 bits (216), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 41/67 (61%), Positives = 51/67 (76%)

Query: 25 MIVTRSLMKTHKGAAKRWRKNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84
          M+ TR+LMKTHKG AKRWRK +  +KRG +GR HGN GW +  LK+L G+T AH + IK 
Sbjct: 24 MMQTRNLMKTHKGTAKRWRKTSTSYKRGRAGRNHGNAGWGKSTLKSLDGKTLAHPTHIKH 83

Query: 85 LKKLLPY 91
          LK+LLPY
Sbjct: 84 LKRLLPY 90

>TPHA0F01880 Chr6 (428432..428731) [300 bp, 99 aa] {ON} Anc_2.151
          YNL122C
          Length = 99

 Score = 84.0 bits (206), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 40/66 (60%), Positives = 51/66 (77%), Gaps = 2/66 (3%)

Query: 29 RSLMKTHKGAAKRWR--KNANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKRLK 86
          R+LMKTHKG AKRW+     + FKRG SGR+HGN GWSQR LK L+GRT A ++ + +L+
Sbjct: 34 RTLMKTHKGTAKRWKYISKLDTFKRGKSGRQHGNIGWSQRSLKTLSGRTYADKTHVSKLR 93

Query: 87 KLLPYH 92
          KLLPY+
Sbjct: 94 KLLPYN 99

>TBLA0B01230 Chr2 complement(262437..262730) [294 bp, 97 aa] {ON}
          Anc_2.151 YNL122C
          Length = 97

 Score = 67.4 bits (163), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 41/67 (61%), Gaps = 7/67 (10%)

Query: 32 MKTHKGAAKRWRKN-------ANGFKRGISGRKHGNCGWSQRGLKALTGRTEAHQSQIKR 84
          +KTHKG  KRWR+        A  F R  +GR HGN GWS R L AL+ R  AH + +K 
Sbjct: 31 LKTHKGTLKRWRRRVAPGGPAAEQFVRSKAGRNHGNIGWSHRALAALSRRVPAHSTHVKA 90

Query: 85 LKKLLPY 91
          L+KLLPY
Sbjct: 91 LRKLLPY 97

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.131    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,154,906
Number of extensions: 296559
Number of successful extensions: 598
Number of sequences better than 10.0: 20
Number of HSP's gapped: 595
Number of HSP's successfully gapped: 20
Length of query: 92
Length of database: 53,481,399
Length adjustment: 63
Effective length of query: 29
Effective length of database: 46,257,441
Effective search space: 1341465789
Effective search space used: 1341465789
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)