Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0I017506.26ON32432417380.0
TDEL0G044306.26ON3472458151e-107
Kpol_1037.306.26ON3672457811e-102
TPHA0J003806.26ON3562487493e-97
KLTH0C11110g6.26ON2802827381e-96
ZYRO0C07634g6.26ON3822537411e-95
Kwal_56.224436.26ON2802677283e-95
YOL001W (PHO80)6.26ON2932476982e-90
SAKL0E01408g6.26ON3072426974e-90
CAGL0E02541g6.26ON3422516892e-88
Suva_15.1746.26ON2952476833e-88
Smik_15.1696.26ON2912656801e-87
Skud_15.1616.26ON2932516748e-87
TBLA0A071606.26ON2682496683e-86
ACR001C6.26ON3462486702e-85
KLLA0D01287g6.26ON3452576614e-84
Ecym_30296.26ON3512586502e-82
NCAS0D021506.26ON3692665486e-67
NDAI0C026406.26ON4272265292e-63
NCAS0E032207.240ON3411861953e-16
Smik_9.1407.240ON2852081933e-16
YIL050W (PCL7)7.240ON2851671934e-16
Skud_9.1197.240ON2851671908e-16
Suva_9.1497.240ON2861671891e-15
KNAG0D016307.240ON4381901781e-13
Kwal_23.58077.240ON4651771735e-13
ADL075W7.240ON2071261579e-12
CAGL0M12342g7.240ON4571131612e-11
KNAG0L014707.240ON3541741602e-11
Ecym_43367.240ON385951574e-11
KLTH0A04268g7.240ON5801041576e-11
KAFR0I018407.240ON3251181531e-10
NCAS0A134807.240ON4482021522e-10
SAKL0F08602g7.240ON4741651504e-10
KAFR0L008807.240ON3131271484e-10
NDAI0A025607.240ON5031961479e-10
TPHA0C010907.240ON3851351451e-09
KLLA0C08305g7.240ON4092201432e-09
TDEL0H020207.240ON3631861381e-08
TBLA0D040707.240ON661671362e-08
ZYRO0C08118g7.240ON4051941334e-08
Kpol_2000.147.289ON3101321317e-08
Kpol_1033.137.240ON250601271e-07
Smik_5.1897.240ON415601254e-07
Suva_5.1677.240ON424601254e-07
YER059W (PCL6)7.240ON420601247e-07
Skud_5.1737.240ON420601238e-07
NDAI0E047707.240ON303571211e-06
TBLA0C048507.289ON3681181211e-06
NCAS0A137707.289ON3121091093e-05
Suva_14.503.70ON279971067e-05
YDL127W (PCL2)7.289ON3081121068e-05
TBLA0A078903.70ON3611041078e-05
CAGL0E02233g3.70ON2661061051e-04
ZYRO0C09284g7.289ON3111161051e-04
KNAG0A014903.70ON2621141041e-04
Kpol_1020.87.289ON2961051051e-04
AFR159C7.289ON3081101042e-04
SAKL0F09856g7.289ON3351101042e-04
Kwal_23.60067.289ON304971032e-04
Suva_4.1187.289ON3091121032e-04
TPHA0P008107.289ON247981013e-04
YDL179W (PCL9)7.289ON3041051014e-04
Smik_4.1107.289ON3081121014e-04
Ecym_80387.289ON3141161014e-04
YNL289W (PCL1)3.70ON27997995e-04
KLLA0E13223g3.70ON282104995e-04
Skud_14.483.70ON27997995e-04
Smik_14.423.70ON27997996e-04
Suva_4.687.289ON305107996e-04
KNAG0B029307.289ON312107980.001
CAGL0J09328g7.289ON29795970.001
KLTH0A05346g7.289ON301110960.002
TBLA0J006507.289ON36394960.002
Skud_4.1287.289ON308111950.002
Kpol_1020.163.70ON28297950.002
TPHA0A005803.70ON289106950.002
ZYRO0C02068g3.70ON330106940.003
SAKL0C12100g3.70ON31497940.003
TDEL0E007903.70ON25497920.004
TDEL0H015507.289ON309112920.004
NDAI0C019805.347ON226183890.008
KAFR0A082803.70ON24199890.008
NDAI0A022707.289ON330101900.009
KLTH0H03674g6.236ON484105890.016
Skud_4.797.289ON30998870.018
Smik_4.607.289ON30583850.040
NCAS0A098703.70ON29488830.061
KAFR0C015603.70ON26788820.074
Skud_7.1396.236ON434106830.082
TPHA0A032507.289ON289103810.11
CAGL0J10846g5.347ON229159790.16
CAGL0J06336g7.289ON314102770.40
KLLA0F05654g7.289ON31199760.44
NDAI0A060503.70ON28688760.49
Kpol_1005.175.347ON319103760.52
AEL195W3.70ON23799740.61
NDAI0C043005.347ON240104740.65
NCAS0H016505.347ON210119730.83
Kwal_23.52313.70ON25688711.5
KAFR0C011503.141ON46499712.5
KLTH0A01584g3.70ON28188702.5
CAGL0L08448g3.493ON17384657.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0I01750
         (324 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26...   674   0.0  
TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.2...   318   e-107
Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {O...   305   e-102
TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON...   293   3e-97
KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {O...   288   1e-96
ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} simila...   290   1e-95
Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W...   285   3e-95
YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cycli...   273   2e-90
SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar...   273   4e-90
CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} simila...   270   2e-88
Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W...   267   3e-88
Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W...   266   1e-87
Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W...   264   8e-87
TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6....   261   3e-86
ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON} S...   262   2e-85
KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} simila...   259   4e-84
Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to ...   254   2e-82
NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26     215   6e-67
NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {O...   208   2e-63
NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {O...    80   3e-16
Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W (...    79   3e-16
YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p ...    79   4e-16
Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W (...    78   8e-16
Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W (...    77   1e-15
KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.2...    73   1e-13
Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL05...    71   5e-13
ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic hom...    65   9e-12
CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa...    67   2e-11
KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7....    66   2e-11
Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}...    65   4e-11
KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} simila...    65   6e-11
KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.24...    64   1e-10
NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa] ...    63   2e-10
SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} simila...    62   4e-10
KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.2...    62   4e-10
NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.2...    61   9e-10
TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {O...    60   1e-09
KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {...    60   2e-09
TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {O...    58   1e-08
TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa] ...    57   2e-08
ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} simila...    56   4e-08
Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON} (24019.....    55   7e-08
Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON} (30454.....    54   1e-07
Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W ...    53   4e-07
Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W ...    53   4e-07
YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p...    52   7e-07
Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W ...    52   8e-07
NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7....    51   1e-06
TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa] ...    51   1e-06
NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {...    47   3e-05
Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W (R...    45   7e-05
YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,...    45   8e-05
TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3...    46   8e-05
CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar...    45   1e-04
ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {O...    45   1e-04
KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70 Y...    45   1e-04
Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON} (18215..1...    45   1e-04
AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON} Sy...    45   2e-04
SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {...    45   2e-04
Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {...    44   2e-04
Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W (...    44   2e-04
TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {O...    44   3e-04
YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,...    44   4e-04
Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W (...    44   4e-04
Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON} si...    44   4e-04
YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin, ...    43   5e-04
KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} simil...    43   5e-04
Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W (R...    43   5e-04
Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W (R...    43   6e-04
Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W (R...    43   6e-04
KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.28...    42   0.001
CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} simila...    42   0.001
KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {O...    42   0.002
TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {...    42   0.002
Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W (...    41   0.002
Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON...    41   0.002
TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70...    41   0.002
ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {O...    41   0.003
SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa] ...    41   0.003
TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70...    40   0.004
TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.28...    40   0.004
NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON...    39   0.008
KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {...    39   0.008
NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289      39   0.009
KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly...    39   0.016
Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W (R...    38   0.018
Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W (R...    37   0.040
NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {...    37   0.061
KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON...    36   0.074
Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W ...    37   0.082
TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.28...    36   0.11 
CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]...    35   0.16 
CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {...    34   0.40 
KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly ...    34   0.44 
NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {...    34   0.49 
Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON} (29070.....    34   0.52 
AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic hom...    33   0.61 
NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON}                33   0.65 
NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON...    33   0.83 
Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {...    32   1.5  
KAFR0C01150 Chr3 complement(231704..233098) [1395 bp, 464 aa] {O...    32   2.5  
KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar...    32   2.5  
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...    30   7.8  

>KNAG0I01750 Chr9 (344381..345355) [975 bp, 324 aa] {ON} Anc_6.26
           YOL001W
          Length = 324

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/324 (100%), Positives = 324/324 (100%)

Query: 1   MAEGGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKK 60
           MAEGGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKK
Sbjct: 1   MAEGGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKK 60

Query: 61  TGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSI 120
           TGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSI
Sbjct: 61  TGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSI 120

Query: 121 YYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILE 180
           YYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILE
Sbjct: 121 YYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILE 180

Query: 181 SEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYY 240
           SEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYY
Sbjct: 181 SEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYY 240

Query: 241 HKIIQLVGKFSSSLDKSKKANYVFENVPGMSSALSTEKKPALKRHLDHNDQKNQPDFILA 300
           HKIIQLVGKFSSSLDKSKKANYVFENVPGMSSALSTEKKPALKRHLDHNDQKNQPDFILA
Sbjct: 241 HKIIQLVGKFSSSLDKSKKANYVFENVPGMSSALSTEKKPALKRHLDHNDQKNQPDFILA 300

Query: 301 VKKSSTSPYTFKKHVTEELKFQKD 324
           VKKSSTSPYTFKKHVTEELKFQKD
Sbjct: 301 VKKSSTSPYTFKKHVTEELKFQKD 324

>TDEL0G04430 Chr7 (804428..805471) [1044 bp, 347 aa] {ON} Anc_6.26
           YOL001W
          Length = 347

 Score =  318 bits (815), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 157/245 (64%), Positives = 182/245 (74%), Gaps = 18/245 (7%)

Query: 20  EIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDG 79
           EI T+ LP  FS CSR DL  LISRML FLIQIND  A  K    ++ +G          
Sbjct: 29  EISTIYLPRKFSKCSRTDLAVLISRMLTFLIQINDSLALSK---PENARG---------- 75

Query: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT 139
                LTRFHS VPP ISVYNYLIRLTKYS+LE  VLLT++YYIDLLSSVYP FT++SLT
Sbjct: 76  -----LTRFHSRVPPGISVYNYLIRLTKYSSLEHCVLLTAVYYIDLLSSVYPVFTLSSLT 130

Query: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT 199
           VHRFLLTATTVASKGLCDSFCTN HYAKVGGV  SELNILE EFLK++NYR+LPRDDNI 
Sbjct: 131 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHSSELNILECEFLKRVNYRILPRDDNID 190

Query: 200 WCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKK 259
           WCK E +  +FT+Y +  +   S+P ++ +NSGYNVL  Y+ KI+QLVG ++SS DKSK 
Sbjct: 191 WCKLETKLQKFTLYEEPEMGQNSRPQNSLKNSGYNVLDAYFRKIVQLVGSYASSPDKSKV 250

Query: 260 ANYVF 264
            NYV 
Sbjct: 251 VNYVL 255

>Kpol_1037.30 s1037 complement(72024..73127) [1104 bp, 367 aa] {ON}
           complement(72024..73127) [1104 nt, 368 aa]
          Length = 367

 Score =  305 bits (781), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 147/245 (60%), Positives = 189/245 (77%), Gaps = 12/245 (4%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           I+T++LP  F  CSR DL+ALI+RML FLI++ND+       L +          + +  
Sbjct: 43  IETITLPPKFIDCSRSDLVALIARMLSFLIEMNDNDPANTNYLNE----------EPNNR 92

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140
           S   LTRFHS VPP ISVYNYLIRLTKYS+LE  VLL+++YYIDLLSSVYP F INSLTV
Sbjct: 93  SVMNLTRFHSRVPPNISVYNYLIRLTKYSSLEHCVLLSTVYYIDLLSSVYPEFKINSLTV 152

Query: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200
           HRFLLTATT+ASKGLCDSFCTN+HY+KVGGV  SELNILE+EFL+++NYR++PRDDNI  
Sbjct: 153 HRFLLTATTIASKGLCDSFCTNSHYSKVGGVHCSELNILETEFLRRVNYRIIPRDDNIKL 212

Query: 201 CKYEHRAHEFTI-YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKK 259
           CK EH+ ++FT+ ++  ++  ++  ++ Q NSG+N+L +YYHKI+QLVG FS+S DKS+K
Sbjct: 213 CKIEHQQNKFTMDFSDLSMVGMTVQSNHQ-NSGFNILDIYYHKIVQLVGSFSASSDKSRK 271

Query: 260 ANYVF 264
           ANY  
Sbjct: 272 ANYTL 276

>TPHA0J00380 Chr10 complement(84485..85555) [1071 bp, 356 aa] {ON}
           Anc_6.26 YOL001W
          Length = 356

 Score =  293 bits (749), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 148/248 (59%), Positives = 184/248 (74%), Gaps = 7/248 (2%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKG---EATDAADT 77
           I+T+ LP++F  CSR DL+ LISRML FLIQIND    +   L ++        TD  + 
Sbjct: 32  IETIMLPTSFLKCSRSDLVVLISRMLTFLIQIND----RNEILTENNSAMIPTQTDVNNK 87

Query: 78  DGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINS 137
           + ++   LTRFHS VPP ISV NYLIRLTKY++LE SVLL+S+YYIDLLSSVYP F INS
Sbjct: 88  NNNNMINLTRFHSRVPPNISVNNYLIRLTKYASLEHSVLLSSLYYIDLLSSVYPEFKINS 147

Query: 138 LTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDN 197
           LTVHRFLL ATTVASKGL DSFCTN+HYAKVGGV+ SELNILE++FL++INYR++PRDDN
Sbjct: 148 LTVHRFLLAATTVASKGLSDSFCTNSHYAKVGGVRCSELNILETDFLRRINYRIIPRDDN 207

Query: 198 ITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKS 257
           I  CK E ++ +FT+     L    +P  T  NSGYNVL +YY K++Q+VG   +S DKS
Sbjct: 208 IKLCKLEKKSSQFTLDLGDLLAANIQPELTHPNSGYNVLNIYYRKMVQIVGLLKNSTDKS 267

Query: 258 KKANYVFE 265
           KK NY+ +
Sbjct: 268 KKVNYIIQ 275

>KLTH0C11110g Chr3 complement(914257..915099) [843 bp, 280 aa] {ON}
           similar to uniprot|P20052 Saccharomyces cerevisiae
           YOL001W PHO80 Cyclin negatively regulates phosphate
           metabolism Pho80p-Pho85p (cyclin-CDK complex)
           phosphorylates Pho4p and Swi5p deletion of PHO80 leads
           to aminoglycoside supersensitivity truncated form of
           PHO80 affects vacuole inheritance
          Length = 280

 Score =  288 bits (738), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 154/282 (54%), Positives = 194/282 (68%), Gaps = 32/282 (11%)

Query: 4   GGVAKQANRNEET---TGCE-IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQK 59
           G  AK  +  E+T   TG + +  V+LP++FS C R DL+ LISRML FLI+IND   + 
Sbjct: 8   GASAKHPDLTEDTKPDTGEDPVPEVALPNDFSQCPRTDLVILISRMLSFLIRINDSIPK- 66

Query: 60  KTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTS 119
                             D SSE  LTRFHS VPP ISVY+YL+RLT+YS+LEP+VL+ S
Sbjct: 67  ------------------DNSSE--LTRFHSRVPPQISVYDYLMRLTRYSSLEPAVLIAS 106

Query: 120 IYYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNIL 179
           +YYIDLLS++Y AF++NSLTVHRFLLTATTV SKGLCDSFCTN+HYAKVGGVQ SEL++L
Sbjct: 107 VYYIDLLSAMYTAFSLNSLTVHRFLLTATTVGSKGLCDSFCTNSHYAKVGGVQCSELHVL 166

Query: 180 ESEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMY 239
           ESEFLK++NYR+LPRDDNI  CK E R   F       +T      +   N+G+NVL  Y
Sbjct: 167 ESEFLKRVNYRILPRDDNILNCKAERREGLF-------VTATYAKENRGPNNGFNVLDTY 219

Query: 240 YHKIIQLVGKFSSSLDKSKKANYVFENVPGMSSALSTEKKPA 281
           Y KII++VG + SS DK+K+A+YV +  P    A + +KK A
Sbjct: 220 YQKIIEIVGSYDSSPDKTKRAHYVMKTPPAPREAEAPKKKRA 261

>ZYRO0C07634g Chr3 (580486..581634) [1149 bp, 382 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 382

 Score =  290 bits (741), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 177/253 (69%), Gaps = 27/253 (10%)

Query: 20  EIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDG 79
           ++ TV LP  FS CSR DL+ LISRML FLIQ+ND ++              T A D   
Sbjct: 41  DVPTVILPKRFSECSRTDLVILISRMLTFLIQMNDSSS--------------TSALD--- 83

Query: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT 139
            S T LT+FHS VPP ISVYNYL+RLTKYS+L+  VL+ ++YYIDL+SSVYP FT+NSLT
Sbjct: 84  -SVTNLTKFHSKVPPGISVYNYLMRLTKYSSLDHCVLMAAVYYIDLVSSVYPTFTLNSLT 142

Query: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT 199
           VHRFLLTATTVASKGLCDSFCTN HYAKVGGV  SELN+LE E L++INYR++PRDDNI 
Sbjct: 143 VHRFLLTATTVASKGLCDSFCTNTHYAKVGGVHCSELNVLECELLRRINYRIIPRDDNIA 202

Query: 200 WCKYEHRAHEFTIYNKAA------LTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSS 253
           WC  E +   F +  +        L+N+S     + NSGYNVL  YY+KI+QLVG   S+
Sbjct: 203 WCNLESQHRHFVLDTQDGDDWTPILSNLSG---NRNNSGYNVLDTYYNKIVQLVGSLKST 259

Query: 254 LDKSKKANYVFEN 266
            DKSK  NY F N
Sbjct: 260 QDKSKLVNYTFAN 272

>Kwal_56.22443 s56 (131419..132261) [843 bp, 280 aa] {ON} YOL001W
           (PHO80) - The Pho80p Cyclin [contig 185] FULL
          Length = 280

 Score =  285 bits (728), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 185/267 (69%), Gaps = 39/267 (14%)

Query: 4   GGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGL 63
           G       R EE     +  V+LP +FS CSR DL+ LISRML FL +IND   +     
Sbjct: 15  GSPKSPGERLEEAP---VPEVALPEDFSQCSRTDLVILISRMLSFLTRINDSVPK----- 66

Query: 64  ADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYI 123
            D  K               +LTRFHS VPP ISVY+Y++RLT+YS+LEP+VL+ S+YYI
Sbjct: 67  -DDAK---------------ELTRFHSRVPPQISVYDYMMRLTRYSSLEPAVLVASVYYI 110

Query: 124 DLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEF 183
           DLLS++YP+F++NSLTVHRFLLTATTVASKGLCDSFCTN+HYAKVGGVQ SEL++LESEF
Sbjct: 111 DLLSAMYPSFSLNSLTVHRFLLTATTVASKGLCDSFCTNSHYAKVGGVQCSELHVLESEF 170

Query: 184 LKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQR----NSGYNVLQMY 239
           LKK+NYR+LPRDDNI+ CK E +A  F             PT+++     N+G+NVL  Y
Sbjct: 171 LKKVNYRILPRDDNISNCKAEKKAGLFVT-----------PTYSKSCRGPNNGFNVLDTY 219

Query: 240 YHKIIQLVGKFSSSLDKSKKANYVFEN 266
           Y KII++VG F SS DK+K+A+YV  N
Sbjct: 220 YRKIIEIVGSFDSSPDKTKRAHYVMIN 246

>YOL001W Chr15 (325249..326130) [882 bp, 293 aa] {ON}  PHO80Cyclin,
           interacts with cyclin-dependent kinase Pho85p; regulates
           the response to nutrient levels and environmental
           conditions, including the response to phosphate
           limitation and stress-dependent calcium signaling
          Length = 293

 Score =  273 bits (698), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 138/247 (55%), Positives = 179/247 (72%), Gaps = 22/247 (8%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           I  V LP++F+ CSR DL+ LISRMLV LI IN+++A KK+                   
Sbjct: 18  IPKVILPADFNKCSRTDLVVLISRMLVSLIAINENSATKKS------------------D 59

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140
            +  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YYIDLL +VYP FT+NSLT 
Sbjct: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTVYPDFTLNSLTA 119

Query: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200
           HRFLLTATTVA+KGLCDSF TNAHYAKVGGV+  ELNILE++FLK++NYR++PRD NIT 
Sbjct: 120 HRFLLTATTVATKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179

Query: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQRN---SGYNVLQMYYHKIIQLVGKFSSSLDKS 257
           C  E +  +F I +K AL ++   +++  N   SGYNVL  YY +I+QLVG F++S DKS
Sbjct: 180 CSIEQKQKKFVI-DKNALGSLDLDSYSYVNRPKSGYNVLDKYYRRIVQLVGSFNASPDKS 238

Query: 258 KKANYVF 264
           +K +YV 
Sbjct: 239 RKVDYVL 245

>SAKL0E01408g Chr5 (106229..107152) [924 bp, 307 aa] {ON} similar to
           uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 307

 Score =  273 bits (697), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 168/242 (69%), Gaps = 28/242 (11%)

Query: 24  VSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSET 83
           + LP  F  CSR  L+ LISRML  LIQ+ND   + K                       
Sbjct: 47  IMLPDEFLKCSRTALVVLISRMLSSLIQMNDSMCKDKN---------------------L 85

Query: 84  KLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRF 143
           KLTRFHS VPP ISVYNYLIRL KYS+LEP+VL+ ++YYIDLLSSVYP+FT+NSLTVHRF
Sbjct: 86  KLTRFHSRVPPGISVYNYLIRLAKYSSLEPAVLIAAVYYIDLLSSVYPSFTLNSLTVHRF 145

Query: 144 LLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKY 203
           LLTATTVASKGL DSFCTN HYAKVGGVQ SELN+LE+EFLK++NYR++PRDDNI  CK 
Sbjct: 146 LLTATTVASKGLSDSFCTNVHYAKVGGVQCSELNVLETEFLKRVNYRIIPRDDNIFNCKE 205

Query: 204 EHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKANYV 263
           E++   F  +  A    +  P     N+G+NVL  YY K+IQLVG  +SS DK+ K +YV
Sbjct: 206 EYQQGVFITFPLA--DKIKGP-----NNGFNVLDTYYKKMIQLVGPSNSSPDKTSKVSYV 258

Query: 264 FE 265
            E
Sbjct: 259 LE 260

>CAGL0E02541g Chr5 (244814..245842) [1029 bp, 342 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001w PHO80
           cyclin
          Length = 342

 Score =  270 bits (689), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 137/251 (54%), Positives = 177/251 (70%), Gaps = 26/251 (10%)

Query: 17  TGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAAD 76
           T  EI T+ LP +F  C + DL+ LI+RML F+IQIND   +                  
Sbjct: 10  TDEEIPTIKLPRDFLKCPKGDLVILIARMLQFIIQINDSNIK------------------ 51

Query: 77  TDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN 136
            +   +  LTRFHS + P ISV+NY  RLTKYS LE SVLL+++YYIDLLS+VYPAF +N
Sbjct: 52  -ENERKYGLTRFHSKIAPNISVFNYFTRLTKYSLLEHSVLLSAVYYIDLLSNVYPAFNLN 110

Query: 137 SLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDD 196
           SLT HRFLLTATT+ASKGLCDSFCTN HY+KVGGVQ +ELN+LE+EFL+K+NYR++PRD+
Sbjct: 111 SLTAHRFLLTATTIASKGLCDSFCTNTHYSKVGGVQCNELNVLENEFLRKVNYRIIPRDN 170

Query: 197 NITWCKYEHRAHEFTIYNKAALTNVSKPTHTQ-----RNSGYNVLQMYYHKIIQLVGKFS 251
           NIT+CK E + + F +    ++ +   P+  Q      N+GYNVL  YY+KII++VGK+S
Sbjct: 171 NITFCKMEVQKNFFIL--PESIESDLAPSLRQGYSSISNAGYNVLTRYYYKIIEVVGKYS 228

Query: 252 SSLDKSKKANY 262
           SS DK+KK NY
Sbjct: 229 SSPDKTKKVNY 239

>Suva_15.174 Chr15 (299761..300648) [888 bp, 295 aa] {ON} YOL001W
           (REAL)
          Length = 295

 Score =  267 bits (683), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 172/247 (69%), Gaps = 22/247 (8%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           I  + LPS F  CSR DL+ LISRMLV LI IN++++ K+                    
Sbjct: 18  IPKIILPSEFKKCSRTDLVVLISRMLVSLIAINENSSTKRPD------------------ 59

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140
            +  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YYIDLL + YP FT+NSLT 
Sbjct: 60  DQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLITSLYYIDLLQTAYPDFTLNSLTA 119

Query: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200
           HRFLLTATTVA+KGLCDSF TNAHY+KVGGV+  ELNILE++FLK++NYR+LPRD NIT 
Sbjct: 120 HRFLLTATTVAAKGLCDSFSTNAHYSKVGGVRCHELNILENDFLKRVNYRILPRDHNITL 179

Query: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQRN---SGYNVLQMYYHKIIQLVGKFSSSLDKS 257
           C  E +   F I +K AL +V   +++  N   SGYNVL  YY +I+QLVG F +S DKS
Sbjct: 180 CSIEQKQKTFVI-DKNALGSVDLGSYSYANRSKSGYNVLDKYYQRIVQLVGSFDASPDKS 238

Query: 258 KKANYVF 264
           ++ NY  
Sbjct: 239 RRVNYAL 245

>Smik_15.169 Chr15 (292553..293428) [876 bp, 291 aa] {ON} YOL001W
           (REAL)
          Length = 291

 Score =  266 bits (680), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 140/265 (52%), Positives = 181/265 (68%), Gaps = 24/265 (9%)

Query: 3   EGGVAKQANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTG 62
           E  V   +    E  G  IQ V LP++F+ CSR DL+ LISRMLV LI IN+++  K   
Sbjct: 2   ESTVGDLSENMHEDQG--IQKVILPTDFNKCSRTDLVVLISRMLVSLIAINENSVSKIP- 58

Query: 63  LADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYY 122
                             ++  LTR+HS +PP IS++NY IRLTK+S+LE  VL+TS+YY
Sbjct: 59  -----------------ENQITLTRYHSKIPPNISIFNYFIRLTKFSSLEHCVLMTSLYY 101

Query: 123 IDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESE 182
           IDLL + YP FT+NSLT HRFLLTATT+A+KGLCDSF TNAHYAKVGGV+  ELNILE++
Sbjct: 102 IDLLQTAYPDFTLNSLTAHRFLLTATTIATKGLCDSFSTNAHYAKVGGVRCHELNILEND 161

Query: 183 FLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALT--NVSKPTHTQR-NSGYNVLQMY 239
           FLK++NYR++PRD NI  C  E +  +F I +K AL   ++   ++T R  SGYNVL  Y
Sbjct: 162 FLKRVNYRIIPRDHNIMLCSIEQKQKKFVI-DKNALGSFDLDSYSYTDRPKSGYNVLDKY 220

Query: 240 YHKIIQLVGKFSSSLDKSKKANYVF 264
           Y +I+QLVG F++S DKSKK +YV 
Sbjct: 221 YRRIVQLVGSFNASPDKSKKIDYVL 245

>Skud_15.161 Chr15 (284851..285732) [882 bp, 293 aa] {ON} YOL001W
           (REAL)
          Length = 293

 Score =  264 bits (674), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 171/251 (68%), Gaps = 30/251 (11%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           I  V LP+ F  CSR DL+ LISRMLV LI IN+++  KK                    
Sbjct: 18  IPKVILPAEFYKCSRTDLVVLISRMLVSLIAINENSTTKKP------------------D 59

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140
            +  LTR+HS VPP IS++NY IRLTK+S+LE  VL+TS+YYIDLL + YP FT+NSLT 
Sbjct: 60  DQITLTRYHSKVPPNISIFNYFIRLTKFSSLEHCVLMTSLYYIDLLQTAYPDFTLNSLTA 119

Query: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200
           HRFLLTATTVA+KGLCDSF TNAHYAKVGGV+  ELNILE++FLK++NYR++PRD NIT 
Sbjct: 120 HRFLLTATTVAAKGLCDSFSTNAHYAKVGGVRCHELNILENDFLKRVNYRIIPRDHNITL 179

Query: 201 CKYEHRAHEFTI-------YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSS 253
           C  E +  +F         ++  + + VS+P      SGYNVL  YY +I+QLVG F++S
Sbjct: 180 CSIEQKQKKFVADKNAPGSFDLDSYSYVSRP-----KSGYNVLDKYYRRIVQLVGSFNAS 234

Query: 254 LDKSKKANYVF 264
            DKSKK +YV 
Sbjct: 235 PDKSKKVDYVL 245

>TBLA0A07160 Chr1 (1782941..1783747) [807 bp, 268 aa] {ON} Anc_6.26
           YOL001W
          Length = 268

 Score =  261 bits (668), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 136/249 (54%), Positives = 175/249 (70%), Gaps = 18/249 (7%)

Query: 16  TTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAA 75
           ++G E Q V L  NF  CS+ DLI LISRML F I IND         + +  G  T+  
Sbjct: 4   SSGEEAQLVVLDQNFMKCSKIDLITLISRMLSFFIDIND---------SHNIHGNVTN-- 52

Query: 76  DTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTI 135
             +  S   LTRFHS VPP IS+++YLIRLTKYS+LE SVL+TS+YYIDLLS+VYP F++
Sbjct: 53  --NRLSPLFLTRFHSKVPPNISIFDYLIRLTKYSSLESSVLITSVYYIDLLSNVYPEFSL 110

Query: 136 NSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRD 195
           NSLTVHR+LLTATT+ASKGLCDSFCTN+HYAKVGG++ +ELN+LE+EFL+++ YRV+PRD
Sbjct: 111 NSLTVHRYLLTATTIASKGLCDSFCTNSHYAKVGGIRCNELNVLETEFLERVRYRVIPRD 170

Query: 196 DNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLD 255
           + I  CK E++       N     ++  P   Q NSGYNVL  YY+K++QLVG   SS +
Sbjct: 171 NTIKLCKLEYKYSPIEDINN----DIHIPDELQ-NSGYNVLSTYYNKMVQLVGNCKSSKN 225

Query: 256 KSKKANYVF 264
             +  NY+F
Sbjct: 226 SFRNVNYIF 234

>ACR001C Chr3 complement(357962..359002) [1041 bp, 346 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL001W
           (PHO80)
          Length = 346

 Score =  262 bits (670), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 135/248 (54%), Positives = 164/248 (66%), Gaps = 23/248 (9%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           +  + LP  F  CSR  L+ LISRML  LI +ND                    A  D S
Sbjct: 13  VTEMELPRQFLSCSRTYLVVLISRMLTSLIGMND--------------------AQGDKS 52

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV 140
              KLTRFHS VPP ISVYNYLIRLTKYS+LE  VLL S+YYIDLL++VYP F ++SLTV
Sbjct: 53  KPIKLTRFHSRVPPAISVYNYLIRLTKYSSLEHCVLLASVYYIDLLTNVYPEFRLDSLTV 112

Query: 141 HRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITW 200
           HRFLLTATTVASKGLCDSFCTN HYAKVGGVQ SELN+LE+EFL+++NYR+LPRDDNI  
Sbjct: 113 HRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCSELNVLENEFLERVNYRILPRDDNIRR 172

Query: 201 CKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKA 260
           C  E +   F+  N     + +      RN+G+ VL+ YYH++I L+G F+ S DKS   
Sbjct: 173 CSLERQERIFSYSNIPMDKDCAL---QDRNNGFGVLEKYYHRMIHLIGDFNMSPDKSCNL 229

Query: 261 NYVFENVP 268
           ++     P
Sbjct: 230 SFTLAESP 237

>KLLA0D01287g Chr4 (112866..113903) [1038 bp, 345 aa] {ON} similar
           to uniprot|P20052 Saccharomyces cerevisiae YOL001W PHO80
           Cyclin negatively regulates phosphate metabolism
           Pho80p-Pho85p (cyclin-CDK complex) phosphorylates Pho4p
           and Swi5p deletion of PHO80 leads to aminoglycoside
           supersensitivity truncated form of PHO80 affects vacuole
           inheritance
          Length = 345

 Score =  259 bits (661), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 136/257 (52%), Positives = 170/257 (66%), Gaps = 32/257 (12%)

Query: 22  QTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSS 81
           Q + LP  +  CSR  L+ +ISRML FLIQIND                    A+  G+ 
Sbjct: 17  QIIPLPEEYLRCSRTHLVVIISRMLSFLIQIND--------------------ANNAGNQ 56

Query: 82  ETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVH 141
             +LTRFHS   P I+VY YLIRLTKYS+LE SVLL+++YYIDLLS+VYP FT+NSLTVH
Sbjct: 57  TMELTRFHSKAAPSITVYQYLIRLTKYSSLEHSVLLSAVYYIDLLSAVYPEFTLNSLTVH 116

Query: 142 RFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           RFLLTATT+ASKGLCDSFCTN HY+KVGGVQ SELNILE+EFL+++ YR++PRDDNI  C
Sbjct: 117 RFLLTATTIASKGLCDSFCTNTHYSKVGGVQCSELNILENEFLERVRYRIIPRDDNIENC 176

Query: 202 KYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGKFSSSLDKSKKAN 261
           K E +           L  +   +    ++G+NVLQ YY KI+QLVG   +S DK+  + 
Sbjct: 177 KIEQK------LGSNMLIPMKNASQRGPDNGFNVLQNYYRKIVQLVGNPLNSPDKT--ST 228

Query: 262 YVFENV----PGMSSAL 274
           Y F+ V    PG+   L
Sbjct: 229 YFFKMVDPMNPGIGGTL 245

>Ecym_3029 Chr3 (56667..57722) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR001C
          Length = 351

 Score =  254 bits (650), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 135/258 (52%), Positives = 166/258 (64%), Gaps = 27/258 (10%)

Query: 11  NRNEETTGCEIQTV---SLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSG 67
           N N E    + Q V    LP  F  CSR  L+ LISRML  LI++ND   +  T      
Sbjct: 7   NSNVEVENRKAQPVPEFRLPRKFLDCSRTHLVVLISRMLSSLIRLNDAYTESNT------ 60

Query: 68  KGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLS 127
                           +LTRFHS VPP ISVY+YLIRLTKYS+LE  VLL S+YYIDLLS
Sbjct: 61  ---------------LQLTRFHSRVPPSISVYDYLIRLTKYSSLEHCVLLASVYYIDLLS 105

Query: 128 SVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKI 187
           SV+P F ++SLTVHRFLLTATTVASKGLCDSFCTN HYAKVGGVQ +ELN+LE+EFL ++
Sbjct: 106 SVFPEFRLDSLTVHRFLLTATTVASKGLCDSFCTNTHYAKVGGVQCNELNVLENEFLTRV 165

Query: 188 NYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLV 247
           NYR+LPRD+NI  C  EH+   F+  N  A     + +   R   ++VL+ YYH++I L+
Sbjct: 166 NYRILPRDENIKRCSREHQEGTFSFANIPADAEQDQKSEENR---FDVLENYYHRMIHLI 222

Query: 248 GKFSSSLDKSKKANYVFE 265
           G   +S DKS   N+  E
Sbjct: 223 GNLDASPDKSYDLNFTLE 240

>NCAS0D02150 Chr4 (400750..401859) [1110 bp, 369 aa] {ON} Anc_6.26
          Length = 369

 Score =  215 bits (548), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 159/266 (59%), Gaps = 23/266 (8%)

Query: 14  EETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATD 73
           E     +IQ + +P  +  CSR DL+ L+SRMLV LIQ ND                 ++
Sbjct: 19  ESPMTSKIQVIEVPYEYIKCSRSDLVVLVSRMLVLLIQSND---------------MTSN 63

Query: 74  AADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAF 133
            +++   S   LTRFHS +PP IS++NYL RLTKY  +E  VLL+ IYYIDL ++ YP F
Sbjct: 64  TSNSSSDSNMHLTRFHSRIPPNISIFNYLFRLTKYCYVEHCVLLSIIYYIDLFTAAYPTF 123

Query: 134 TINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLP 193
           T NSLT HRFLLTA TVA KGLCDSFCT A YAK+GGVQ  ELNILE+ FL+ +NYR++P
Sbjct: 124 TFNSLTAHRFLLTAITVAGKGLCDSFCTTAQYAKIGGVQNEELNILETYFLRIVNYRIIP 183

Query: 194 RDDNITWCKYEHRAHEFTI----YNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLVGK 249
           R  N+T  K E     FT+         L+ +S       ++GY+VL +YY  I+++ G 
Sbjct: 184 RSSNVTLIKLERGNQVFTLDHLDMKDPKLSFLSY--DYLPDNGYSVLNIYYQNIVRITGA 241

Query: 250 FSSSLDKSKKANYVFENVPGMSSALS 275
            S  L   K+  Y F N   ++  L+
Sbjct: 242 SSDLL--FKRVIYTFPNNSALTQKLN 265

>NDAI0C02640 Chr3 complement(611899..613182) [1284 bp, 427 aa] {ON}
           Anc_6.26 YOL001W
          Length = 427

 Score =  208 bits (529), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 114/226 (50%), Positives = 145/226 (64%), Gaps = 19/226 (8%)

Query: 24  VSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSET 83
           ++LP  F  C R DL+ LISRMLV LI+IND                 T A D +  S  
Sbjct: 57  ITLPIKFMECPRRDLVVLISRMLVTLIKIND-----------------TKANDNNLPSNY 99

Query: 84  KLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRF 143
             TRFHS V P IS+ NYL+RLTK+  L+PSVLLT++YYIDLLS+V+P+F+ NSLT HRF
Sbjct: 100 A-TRFHSRVIPGISIGNYLLRLTKFCILQPSVLLTAVYYIDLLSAVFPSFSFNSLTAHRF 158

Query: 144 LLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWCKY 203
           +LTA  VASK LCDS  +  HYAK GGVQ +EL +LE+ FLK I YRVLPRD N   C  
Sbjct: 159 ILTAVIVASKSLCDSCLSITHYAKYGGVQPNELLMLEAYFLKLIKYRVLPRDKNTDLCSM 218

Query: 204 EHRAHEFTIYNKAALTNVSKPTHTQ-RNSGYNVLQMYYHKIIQLVG 248
           E+    F + +     + +  ++ Q  +SGYNVL MYY +II ++G
Sbjct: 219 EYHFDTFALNDGQIKESGTSFSYRQLPHSGYNVLHMYYRRIIDIIG 264

>NCAS0E03220 Chr5 complement(639650..640675) [1026 bp, 341 aa] {ON}
           Anc_7.240
          Length = 341

 Score = 79.7 bits (195), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 57/186 (30%), Positives = 84/186 (45%), Gaps = 38/186 (20%)

Query: 38  LIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTR----FHSSVP 93
           LI +IS +L  LI+ ND+       L +  +    D  D D S E+KL R    F     
Sbjct: 137 LIKMISTILEKLIKSNDE-------LRERNETSLNDRTDDDNSDESKLVRSIKSFRGKHI 189

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--------------------- 132
           PPI +  Y  R+ KY      VLL  + Y D +S V                        
Sbjct: 190 PPIKLEQYFHRIQKYCPTNNLVLLAILIYFDRISKVLNGSKENESDPNISTHHHLLRNYD 249

Query: 133 ------FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKK 186
                 F ++S  +HR +++A TV++K   D F +N+ YAKVGG+   E+N LE +FL  
Sbjct: 250 CKIEDKFLLDSYNIHRLIISAITVSTKFWSDFFYSNSRYAKVGGISLDEMNYLELQFLLI 309

Query: 187 INYRVL 192
            N+ ++
Sbjct: 310 SNFDLI 315

>Smik_9.140 Chr9 (233007..233864) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 79.0 bits (193), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 97/208 (46%), Gaps = 39/208 (18%)

Query: 3   EGGVAKQANRNEETTGCE----IQTVSLPSNFSLCSRYDLIALISRMLVFLIQIND---D 55
           E    KQ + N+ET G      +  V  P++       +LI ++S +L  +I +ND   D
Sbjct: 79  EAETNKQ-DLNDETNGESSENVLNIVDFPTD-------ELIIMVSALLNKIITVNDATTD 130

Query: 56  AAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSV 115
            +Q+  G             DT+    T +  F+    P I V  YL R+ KY      +
Sbjct: 131 ISQQVPG-------------DTEEKFLTPILAFYGKNVPEIDVVQYLERIQKYCPTTNDI 177

Query: 116 LLTSIYYIDLLSSVY-----------PAFTINSLTVHRFLLTATTVASKGLCDSFCTNAH 164
            L+ + Y D +S  Y             F ++S  +HR L+T  T+ +K L D F +N+ 
Sbjct: 178 FLSLLVYFDRISKNYGHSPEENGHSKQLFVMDSGNIHRLLITGITICTKFLSDFFYSNSR 237

Query: 165 YAKVGGVQGSELNILESEFLKKINYRVL 192
           YAKVGG+   ELN LE +FL   ++++L
Sbjct: 238 YAKVGGISLQELNHLELQFLVLCDFKLL 265

>YIL050W Chr9 (258913..259770) [858 bp, 285 aa] {ON}  PCL7Pho85p
           cyclin of the Pho80p subfamily, forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p; involved in glycogen
           metabolism, expression is cell-cycle regulated
          Length = 285

 Score = 79.0 bits (193), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 81/167 (48%), Gaps = 21/167 (12%)

Query: 37  DLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPI 96
           +LI +IS +L  +I  ND+       ++D  + E            T +  F+    P I
Sbjct: 109 ELILMISALLNRIITANDETTDVSQQVSDETEDELL----------TPILAFYGKNVPEI 158

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVY-----------PAFTINSLTVHRFLL 145
           +V  YL R+ KY      + L+ + Y D +S  Y             F ++S  +HR L+
Sbjct: 159 AVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGHSSERNGCAKQLFVMDSGNIHRLLI 218

Query: 146 TATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 219 TGVTICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLILCDFKLL 265

>Skud_9.119 Chr9 (227792..228649) [858 bp, 285 aa] {ON} YIL050W
           (REAL)
          Length = 285

 Score = 77.8 bits (190), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/167 (29%), Positives = 82/167 (49%), Gaps = 21/167 (12%)

Query: 37  DLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPI 96
           +LI +IS +L  ++  ND+ A+    ++   + E              +  F+    P I
Sbjct: 109 ELIQMISALLNRIVTANDEYAEISQQVSKDNQDELL----------APILAFYGKSVPEI 158

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFT-----------INSLTVHRFLL 145
           SV  YL R+ KY      + L+ + Y D +S  Y  F+           ++S  +HR L+
Sbjct: 159 SVVQYLERIQKYCPTTNDIFLSLLVYFDRISKKYGHFSDRNAHTKQMFGMDSGNIHRLLI 218

Query: 146 TATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           T  T+ +K L D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 219 TGITICTKFLSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 265

>Suva_9.149 Chr9 (247583..248443) [861 bp, 286 aa] {ON} YIL050W
           (REAL)
          Length = 286

 Score = 77.4 bits (189), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 82/167 (49%), Gaps = 21/167 (12%)

Query: 37  DLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPI 96
           +LI ++S +L  +++ ND+       + + G+ E              +  F+    P I
Sbjct: 110 ELILMVSALLNKIVKANDETTDPSQQVVEDGEDELL----------APVLAFYGKNVPEI 159

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA-----------FTINSLTVHRFLL 145
           +V  YL R+ KY      + L+ + Y D +S  Y +           F ++S  +HR L+
Sbjct: 160 AVVQYLERIQKYCPTTNDIFLSLLVYFDRISKNYGSSPDRNGHVRQIFVMDSGNIHRLLI 219

Query: 146 TATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           T  T+ +K + D F +N+ YAKVGG+   ELN LE +FL   ++++L
Sbjct: 220 TGITICTKFMSDFFYSNSRYAKVGGISLQELNHLELQFLVLCDFKLL 266

>KNAG0D01630 Chr4 (274260..275576) [1317 bp, 438 aa] {ON} Anc_7.240
           YIL050W
          Length = 438

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/190 (24%), Positives = 84/190 (44%), Gaps = 24/190 (12%)

Query: 27  PSNFSLCSRYDLIAL----ISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSE 82
           P   +   RY+ I++    I  +L  L  + D        L + G     +    D  + 
Sbjct: 221 PQETNCPKRYESISIATLPIDDILQMLTALLDKIVSSNDELNNGGPPAGCEDKQQDHDTI 280

Query: 83  TKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLS--------------- 127
             +T F+    P I++  YL+R+ KY      + L+ + + D +S               
Sbjct: 281 NAITSFYGKHVPQITIEQYLLRIQKYCPTTNDIFLSLLVFFDRISKKFNIHQQKQQSNVS 340

Query: 128 -----SVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESE 182
                + +  F ++S  +HR L+   TV++K   D F +NA YA+VGG+   E+N LE +
Sbjct: 341 DSDEQAPHQTFVMDSYNIHRLLIAGVTVSTKFFSDFFYSNARYARVGGISLQEMNHLELQ 400

Query: 183 FLKKINYRVL 192
           FL   ++++L
Sbjct: 401 FLILCDFKLL 410

>Kwal_23.5807 s23 (1326104..1327501) [1398 bp, 465 aa] {ON} YIL050W
           (PCL7) - PHO85 cyclin [contig 11] FULL
          Length = 465

 Score = 71.2 bits (173), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/177 (27%), Positives = 87/177 (49%), Gaps = 9/177 (5%)

Query: 21  IQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGS 80
           IQ  + P++  L     L AL+ +++    Q+N D    +     S + E  D  DT  +
Sbjct: 261 IQIATFPTDRLLSM---LTALLDKIVKSNDQLNRDRPFDEDQFLASARTEDADN-DTRPN 316

Query: 81  SETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSV-----YPAFTI 135
             +++  F     P I++  Y  R+ KY      V L+ + Y D ++          F +
Sbjct: 317 IASEILSFRGKHVPAITLQQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHGKEQLFVM 376

Query: 136 NSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           +S  +HR +++A TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 377 DSYNIHRLIISAVTVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 433

>ADL075W Chr4 (550941..551564) [624 bp, 207 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL050W (PCL7) and
           YER059W (PCL6)
          Length = 207

 Score = 65.1 bits (157), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 67/126 (53%), Gaps = 12/126 (9%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA-----FTINSLTVHRFLLTAT 148
           P I++ +Y  R+ KY  +   V L+ + Y D ++    A     F ++S  +HR ++ A 
Sbjct: 71  PTITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNALDPQLFVMDSYNIHRLIIAAV 130

Query: 149 TVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRV------LPRDDNITWCK 202
           TV++K   D F +N+ YA+VGG+   ELN LE +F    ++ +      L R  ++ + K
Sbjct: 131 TVSTKFFSDFFYSNSRYARVGGISLEELNRLELQFSILCDFELIVSIQELQRYADLLY-K 189

Query: 203 YEHRAH 208
           + HR H
Sbjct: 190 FWHREH 195

>CAGL0M12342g Chr13 complement(1234192..1235565) [1374 bp, 457 aa]
           {ON} weakly similar to uniprot|P40038 Saccharomyces
           cerevisiae YER059w PCL6 cyclin like protein interacting
           with PHO85P
          Length = 457

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 58/113 (51%), Gaps = 14/113 (12%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLS-----------SVYPA---FTINSLT 139
           P I++Y Y  R+ KY      V L+ + Y D +S              PA   F ++S  
Sbjct: 311 PQITLYQYFQRIQKYCPTTNDVFLSLLVYFDRISKKCNSSDSESADTSPADQLFVMDSYN 370

Query: 140 VHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           +HR ++   TV +K   D F +N+ YA+VGG+  SELN LE +FL   ++ +L
Sbjct: 371 IHRLVIAGVTVCTKFFSDFFYSNSRYARVGGISLSELNHLELQFLVLCDFELL 423

>KNAG0L01470 Chr12 (259883..260947) [1065 bp, 354 aa] {ON} Anc_7.240
           YIL050W
          Length = 354

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 22/174 (12%)

Query: 38  LIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDG---SSETKLTRFHSSVPP 94
           LI +++ +L  ++Q ND   + +T  + +      DA DTDG   S+   +  F     P
Sbjct: 161 LIKMLTALLDKIVQAND---RLETPDSATLLKVNDDARDTDGYYESAVNAILSFKGKHIP 217

Query: 95  PISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA----------------FTINSL 138
            I++  Y  R+ KY      V L+ + Y D +S    +                F +NS 
Sbjct: 218 QITLEQYFHRIQKYCPTTNDVFLSLLIYFDRISEKCNSIPRGGDDDKVQDDTLLFVMNSY 277

Query: 139 TVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
            +HR ++    V++K   D F +NA YAKVGG+   E+N LE +FL   ++ +L
Sbjct: 278 NIHRLIIAGVAVSTKFSSDFFYSNARYAKVGGISLREMNYLELQFLVLCDFSLL 331

>Ecym_4336 Chr4 complement(720123..721280) [1158 bp, 385 aa] {ON}
           similar to Ashbya gossypii ADL075W
          Length = 385

 Score = 65.1 bits (157), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 54/95 (56%), Gaps = 5/95 (5%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA-----FTINSLTVHRFLLTAT 148
           P I++ +Y  R+ KY  +   V L+ + Y D ++    A     F ++S  +HR ++ A 
Sbjct: 240 PAITLGDYFARIQKYCPITNDVFLSLLVYFDRIAKRCNAMDPQLFVMDSYNIHRLIIAAV 299

Query: 149 TVASKGLCDSFCTNAHYAKVGGVQGSELNILESEF 183
           TV++K   D F +N+ YA+VGG+   ELN LE +F
Sbjct: 300 TVSTKFFSDFFYSNSRYARVGGISLHELNRLELQF 334

>KLTH0A04268g Chr1 (358035..359777) [1743 bp, 580 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 580

 Score = 65.1 bits (157), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSV-----YPAFTINSLTVHRFLLTAT 148
           P I+++ Y  R+ KY      V L+ + Y D ++          F ++S  +HR +++A 
Sbjct: 441 PAITLHQYFQRIQKYCPTTNDVFLSLLVYFDRIAKTCNHAKEQLFVMDSYNIHRLIISAV 500

Query: 149 TVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 501 TVSTKFFSDFFYSNSRYARVGGISLKELNHLELQFLVLCDFELI 544

>KAFR0I01840 Chr9 (376802..377779) [978 bp, 325 aa] {ON} Anc_7.240
           YIL050W
          Length = 325

 Score = 63.5 bits (153), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 10/118 (8%)

Query: 85  LTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSS----------VYPAFT 134
           L  FH    P I++  Y  R+ KY      V L  +   D ++               F 
Sbjct: 178 LLCFHGKHVPDITIEKYFNRIQKYCPTTNDVFLLLLIAFDRIAKRCNTDSFGNKSQQLFV 237

Query: 135 INSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           ++S  +HRF++   TV +K L D F +N+ YAKVGG+   E+N LE +FL   +++++
Sbjct: 238 MDSYNIHRFIIAGVTVCTKFLSDFFYSNSRYAKVGGISVHEMNNLELQFLVLCDFKLI 295

>NCAS0A13480 Chr1 complement(2653843..2655189) [1347 bp, 448 aa]
           {ON} Anc_7.240
          Length = 448

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 88/202 (43%), Gaps = 31/202 (15%)

Query: 10  ANRNEETTGCEIQTVSLPSNFSLCSRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKG 69
           AN+  E     I     P+N        L+ +++ +L  +++ ND     K  ++ S   
Sbjct: 213 ANKTTEDDNESINIAEFPTN-------KLLEMLTALLDKIVKSND-----KLNVSSSNSE 260

Query: 70  EATDAADTDGSSET----KLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDL 125
              D   ++ +S       +  F     P IS++ Y  R+ KY      V L+ + Y D 
Sbjct: 261 SIDDILRSEDNSNNAYVGSILAFRGKHVPQISLHQYFQRIQKYCPTTNDVFLSLLVYFDR 320

Query: 126 LS-----SVYPA----------FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGG 170
           +S     SV             F ++S  +HR ++   TV +K   D F +N+ YA+VGG
Sbjct: 321 ISKRCNNSVTSQGDSPTNKSQLFVMDSYNIHRLIIAGVTVCTKFFSDFFYSNSRYARVGG 380

Query: 171 VQGSELNILESEFLKKINYRVL 192
           V   ELN LE +FL   ++ ++
Sbjct: 381 VSLQELNHLELQFLVLCDFELM 402

>SAKL0F08602g Chr6 (657898..659322) [1425 bp, 474 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 474

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 79/165 (47%), Gaps = 22/165 (13%)

Query: 38  LIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPIS 97
           L+ +++ +L  +++ ND    + T + +S   + T          +++  F     P IS
Sbjct: 299 LLNMLTSLLNKIVKSNDQL--RNTNVQESAFNDYT----------SQVLSFRGKHVPAIS 346

Query: 98  VYNYLIRLTKYSALEPSVLLTSIYYIDLLS----------SVYPAFTINSLTVHRFLLTA 147
           +  Y  R+ KY      V L+ + Y D ++               F ++S  +HR ++ A
Sbjct: 347 LDQYFQRIQKYCPTTNDVFLSLLVYFDRIAKRCNINEEGEDGQQLFVMDSYNIHRLIIAA 406

Query: 148 TTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
            TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ ++
Sbjct: 407 VTVSTKFFSDFFYSNSRYARVGGISLQELNRLELQFLILCDFELI 451

>KAFR0L00880 Chr12 (163476..164417) [942 bp, 313 aa] {ON} Anc_7.240
           YIL050W
          Length = 313

 Score = 61.6 bits (148), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 64/127 (50%), Gaps = 17/127 (13%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA------------FTINSLTVH 141
           P I++  Y  R+ KY      V L+ + Y D + +   +            F ++S  +H
Sbjct: 181 PQINLEQYFKRIQKYCPTTNDVFLSLLIYFDRIFNKCNSKFDNYGHDNPQIFVMDSYNIH 240

Query: 142 RFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           R ++   TV++K L D F +N+ YAKVGG+   ELN LE +FL   ++ +L     I+  
Sbjct: 241 RLIIAGVTVSTKFLSDFFYSNSRYAKVGGISLKELNYLELQFLILCDFNLL-----ISIE 295

Query: 202 KYEHRAH 208
           +YE  A+
Sbjct: 296 EYERYAN 302

>NDAI0A02560 Chr1 (571529..573040) [1512 bp, 503 aa] {ON} Anc_7.240
           YER059W
          Length = 503

 Score = 61.2 bits (147), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 94/196 (47%), Gaps = 17/196 (8%)

Query: 13  NEETTGCEIQTVSLPSNFSLC--SRYDLIALISRMLVFLIQINDDAAQKKTGLADSGKGE 70
           N ++T  E+ +  +P +F++   S  +L+ +++ +L  +++ ND     ++  +      
Sbjct: 276 NNDSTINEVNSYHMPDSFNIAEFSTDNLLEMLTALLDKIVKSNDKLNTSQSPTSPPPLNS 335

Query: 71  ATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLS--- 127
            ++  + +    + L  F     P I+++ Y  R+ KY      V L+ + Y D +S   
Sbjct: 336 NSENNNKNAYYNSILA-FKGKHVPQITLHQYFQRIQKYCPTTNDVFLSLLVYFDRISKRC 394

Query: 128 SVYPA-----------FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSEL 176
           +  P            F ++S  +HR ++   TV +K   D F +N+ YA+VGG+   EL
Sbjct: 395 NSTPTTNSINDNNSQMFVMDSYNIHRLIIAGITVCTKFFSDFFYSNSRYARVGGISLQEL 454

Query: 177 NILESEFLKKINYRVL 192
           N LE +FL   ++ ++
Sbjct: 455 NHLELQFLILCDFELM 470

>TPHA0C01090 Chr3 complement(247987..249144) [1158 bp, 385 aa] {ON}
           Anc_7.240 YIL050W
          Length = 385

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 61/135 (45%), Gaps = 36/135 (26%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSS------------------------- 128
           P IS+  Y  R+ KY  +   V L+ + Y D +S                          
Sbjct: 214 PQISLEQYFQRIQKYCPITNDVFLSLLVYFDRISKKCNNINLEKENVISNDADESQNNVK 273

Query: 129 ----------VYP-AFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELN 177
                     V P  F ++S  +HR ++TA TV++K   D F +N+ YA+VGG+   ELN
Sbjct: 274 QMKDENNSSIVKPQVFVMDSFNIHRLIITAVTVSTKFFSDLFYSNSRYARVGGISLQELN 333

Query: 178 ILESEFLKKINYRVL 192
            LE +FL   +++++
Sbjct: 334 HLELQFLILCDFQLM 348

>KLLA0C08305g Chr3 complement(728996..730225) [1230 bp, 409 aa] {ON}
           similar to uniprot|P40186 Saccharomyces cerevisiae
           YIL050W PCL7 Pho85p cyclin of the Pho80p subfamily forms
           a functional kinase complex with Pho85p which
           phosphorylates Mmr1p and is regulated by Pho81p involved
           in glycogen metabolism expression is cell-cycle
           regulated and weakly similar to YER059W uniprot|P40038
           Saccharomyces cerevisiae YER059W PCL6 Pho85p cyclin of
           the Pho80p subfamily forms the major Glc8p kinase
           together with Pcl7p and Pho85p involved in the control
           of glycogen storage by Pho85p stabilized by Elongin C
           binding
          Length = 409

 Score = 59.7 bits (143), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/220 (23%), Positives = 94/220 (42%), Gaps = 39/220 (17%)

Query: 36  YDLIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPP 95
           Y L+ +++ +L  +I+ ND            GK               ++  F     P 
Sbjct: 197 YKLLDMLTGLLTKIIKSNDSLGSTPNFETSQGKNIPL---------MREILSFRGKQVPG 247

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA----------------------- 132
           I++  Y  R+ KY      VLL+ + + D ++    A                       
Sbjct: 248 ITLKQYFQRIQKYCPTTNDVLLSLLVHFDRIAKKCNAIAQEYMVSVVSTPDKTTASLAHQ 307

Query: 133 -----FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKI 187
                F ++S  +HR ++ A TV++K + D F +N+ YA+VGG+   ELN LE +FL   
Sbjct: 308 SSPQLFVMDSHNIHRLIIAAITVSTKFISDFFYSNSRYARVGGISLQELNHLELQFLILC 367

Query: 188 NYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHT 227
           ++R++   + +   +Y    ++F    K    +VS+PT++
Sbjct: 368 DFRLIISVEELQ--RYADLLYKFWDKEKHLYQSVSQPTNS 405

>TDEL0H02020 Chr8 complement(346307..347398) [1092 bp, 363 aa] {ON}
           Anc_7.240 YIL050W
          Length = 363

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/186 (24%), Positives = 77/186 (41%), Gaps = 36/186 (19%)

Query: 38  LIALISRMLVFLIQINDDAAQKKTGLADSGKGEATDAADTDGSSETKLTRFHSSVPPPIS 97
           L+ +++ +L  +I+ ND  A     L      +  +  + +      +  F     P IS
Sbjct: 151 LLEMLTALLDKIIKSNDRLASSNPTL-----NQERELMNNNNVYLNSVLSFRGKHIPQIS 205

Query: 98  VYNYLIRLTKYSALEPSVLLTSIYYIDLLS------------------------------ 127
           + +Y  R+ KY      V L+ + Y D +S                              
Sbjct: 206 LEHYFQRIQKYCPTTNDVFLSLLVYFDRISKRCNSNNNDTTNDNDLQYDMPAKQQQQTQQ 265

Query: 128 -SVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKK 186
                AF ++S  +HR L+   TV++K   D F +N+ YA+VGG+   ELN LE +FL  
Sbjct: 266 TQQQQAFVMDSHNIHRLLIAGVTVSTKFFSDFFYSNSRYARVGGISLQELNHLELQFLVL 325

Query: 187 INYRVL 192
            ++ +L
Sbjct: 326 CDFELL 331

>TBLA0D04070 Chr4 complement(1012284..1014269) [1986 bp, 661 aa]
           {ON} Anc_7.240 YIL050W
          Length = 661

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 28/67 (41%), Positives = 41/67 (61%)

Query: 126 LSSVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLK 185
           LS     F ++S  +HR ++   TVA+K   D F +NA YAKVGG+   ELN LE +FL 
Sbjct: 571 LSPNSQVFVMDSYNIHRLIIAGVTVATKFFSDYFYSNARYAKVGGITLQELNHLELQFLL 630

Query: 186 KINYRVL 192
             ++++L
Sbjct: 631 LCDFKLL 637

>ZYRO0C08118g Chr3 (621320..622537) [1218 bp, 405 aa] {ON} similar
           to uniprot|P40186 Saccharomyces cerevisiae YIL050W PCL7
           Pho85p cyclin of the Pho80p subfamily forms a functional
           kinase complex with Pho85p which phosphorylates Mmr1p
           and is regulated by Pho81p involved in glycogen
           metabolism expression is cell-cycle regulated
          Length = 405

 Score = 55.8 bits (133), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/194 (23%), Positives = 76/194 (39%), Gaps = 46/194 (23%)

Query: 44  RMLVFLIQINDDAAQKKTGLADSG----KGEATDAADTDGSSETKLTRFHSSVPPPISVY 99
           ++L  L  + D   +    L D+     + E  D    D    + L+ F     P IS+ 
Sbjct: 187 KLLEMLTALLDKIVKSNDKLIDTSFYHQQQEEHDGITNDSCLRSVLS-FRGKHIPQISLE 245

Query: 100 NYLIRLTKYSALEPSVLLTSIYYIDLLS-------------------------------- 127
           +Y  R+ KY      V L+ + Y D +S                                
Sbjct: 246 HYFQRIQKYCPTSNDVFLSLLVYFDRISRKCNSSSRLHHENTSANDAGNNNNGHDNVKQQ 305

Query: 128 ---------SVYPAFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNI 178
                    +    F ++S  +HR ++  TTV++K   D F +N+ YA+VGG+   ELN 
Sbjct: 306 VHNNQQPIPAPQQQFVMDSHNIHRLIIAGTTVSTKFFSDFFYSNSRYARVGGISLQELNY 365

Query: 179 LESEFLKKINYRVL 192
           LE +FL   ++ +L
Sbjct: 366 LELQFLILCDFELL 379

>Kpol_2000.14 s2000 (24019..24951) [933 bp, 310 aa] {ON}
           (24019..24951) [933 nt, 311 aa]
          Length = 310

 Score = 55.1 bits (131), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 70/132 (53%), Gaps = 8/132 (6%)

Query: 74  AADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA- 132
           A+ TD   + K +   +++P   S++ ++  L K+S ++ S L+ S  Y+  L S+ PA 
Sbjct: 24  ASTTDSIIQLKPSSNEANIP---SIFEFIKGLIKHSNVQTSTLMASTVYLTKLRSILPAN 80

Query: 133 -FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
            + I S T HR  L    +A+K L DS   N H+ K   G +  +++N +E E L  +N+
Sbjct: 81  VYGIES-TKHRIFLGCLILAAKSLNDSSPLNKHWTKYTNGLLNLADVNTIERELLAYLNW 139

Query: 190 RVLPRDDNITWC 201
             + + +++  C
Sbjct: 140 DTIIKQEDLIGC 151

>Kpol_1033.13 s1033 (30454..31206) [753 bp, 250 aa] {ON}
           (30454..31206) [753 nt, 251 aa]
          Length = 250

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 38/60 (63%)

Query: 133 FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           F ++S  +HR ++   TV++K   D F +N+ YA+VGG+   ELN LE +FL   ++ +L
Sbjct: 163 FVMDSYNIHRLIIAGVTVSTKFFSDLFYSNSRYARVGGISLQELNNLELQFLLMCDFHLL 222

>Smik_5.189 Chr5 (276775..278022) [1248 bp, 415 aa] {ON} YER059W
           (REAL)
          Length = 415

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 133 FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 325 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 384

>Suva_5.167 Chr5 (248778..250052) [1275 bp, 424 aa] {ON} YER059W
           (REAL)
          Length = 424

 Score = 52.8 bits (125), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 133 FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 334 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 393

>YER059W Chr5 (272624..273886) [1263 bp, 420 aa] {ON}  PCL6Pho85p
           cyclin of the Pho80p subfamily; forms the major Glc8p
           kinase together with Pcl7p and Pho85p; involved in the
           control of glycogen storage by Pho85p; stabilized by
           Elongin C binding
          Length = 420

 Score = 52.4 bits (124), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 133 FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>Skud_5.173 Chr5 (268792..270054) [1263 bp, 420 aa] {ON} YER059W
           (REAL)
          Length = 420

 Score = 52.0 bits (123), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 39/60 (65%)

Query: 133 FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
           F ++S  +HR ++   TV++K L D F +N+ Y++VGG+   ELN LE +FL   ++ +L
Sbjct: 330 FVMDSHNIHRLIIAGITVSTKFLSDFFYSNSRYSRVGGISLQELNHLELQFLVLCDFELL 389

>NDAI0E04770 Chr5 (1073112..1074023) [912 bp, 303 aa] {ON} Anc_7.240
           YER059W
          Length = 303

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 35/57 (61%)

Query: 135 INSLTVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRV 191
           +NS TVHR +L   TV+SK L D   +N  YA+  G+   ELN LE +FL+  N+ +
Sbjct: 227 VNSCTVHRLILAGITVSSKFLSDFTYSNKRYAQASGLTLEELNYLEFQFLRLTNFNL 283

>TBLA0C04850 Chr3 complement(1175677..1176783) [1107 bp, 368 aa]
           {ON} Anc_7.289 YDL179W
          Length = 368

 Score = 51.2 bits (121), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 61/118 (51%), Gaps = 7/118 (5%)

Query: 71  ATDAADTDGSSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVY 130
           A  A     +S++ LT    S  PP+  Y ++  L  +S ++   L+T++ Y+  L ++ 
Sbjct: 28  AASAIQIRPTSDSNLTNESISNIPPL--YTFIKNLVAHSNVQTPTLMTTVVYLKKLKAII 85

Query: 131 PA--FTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFL 184
           P+  + I + T HR  L    +A+K L DS   N H+AK   G +Q  E+N +E E L
Sbjct: 86  PSNVYGIET-TRHRMFLGCLIIAAKTLNDSSPLNKHWAKYTNGLLQLREVNTIEREIL 142

>NCAS0A13770 Chr1 complement(2704299..2705237) [939 bp, 312 aa] {ON}
           Anc_7.289
          Length = 312

 Score = 46.6 bits (109), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 57/109 (52%), Gaps = 5/109 (4%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           ++ N++  L K+S ++   L+ +  Y+  L S+ P   + I + T HR  L    +A+K 
Sbjct: 49  TLSNFIKALIKHSNVQTPTLMATTVYLSKLKSIIPCNVYGIET-TRHRIFLGCLILAAKT 107

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           L DS   N H+A+   G +Q  E+N +E E L+  ++ V  +  ++  C
Sbjct: 108 LNDSSPMNKHWAQYTDGLLQIREVNTIERELLEYFDWDVTIKTKDLIIC 156

>Suva_14.50 Chr14 (84601..85440) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 45.4 bits (106), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT++ Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAVCYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   N H+AK   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWAKYTDGLFTLEDINLMERQLLQLLNW 149

>YDL127W Chr4 (234927..235853) [927 bp, 308 aa] {ON}  PCL2Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 308

 Score = 45.4 bits (106), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 59/112 (52%), Gaps = 7/112 (6%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVA 151
           PP++   ++ RL K+S ++   L+ +  Y+  L S+ P+  + I + T HR  L    +A
Sbjct: 47  PPLT--KFINRLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 152 SKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           +K L DS   N H+A+   G +   E+N +E E L+  ++ V    D++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLILREVNTIERELLEYFDWDVTISTDDLITC 155

>TBLA0A07890 Chr1 (1943543..1944628) [1086 bp, 361 aa] {ON} Anc_3.70
           YNL289W
          Length = 361

 Score = 45.8 bits (107), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 55/104 (52%), Gaps = 3/104 (2%)

Query: 91  SVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATT 149
           S+P   S+  ++ R+ +Y+ ++ S LL ++ Y++ L  + PA  +    T+HR  L    
Sbjct: 54  SIPKLPSLMTFITRIVRYTNVQVSTLLMTVCYLNKLKKLLPADAVGIPSTIHRLFLACLI 113

Query: 150 VASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
           +++K   DS   N H+A    G     ++N++E + L  +++ +
Sbjct: 114 LSAKFHNDSSPLNVHWANYTNGLFSVKDVNLMERQLLSLLDWNL 157

>CAGL0E02233g Chr5 (215934..216734) [801 bp, 266 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289w PCL1
           cyclin
          Length = 266

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 57/106 (53%), Gaps = 5/106 (4%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LL ++ Y++ L  + P  A  + S T+HR  L    ++SK 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLATVCYLNKLKRILPKDATGLPS-TIHRLFLACLILSSKC 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNI 198
             DS   N H+A+   G     ++N++E + L+ +N+ +   +D++
Sbjct: 113 HNDSSPKNVHWARYTDGLFSLEDINLMERQLLQLLNWDINVSEDDL 158

>ZYRO0C09284g Chr3 complement(706160..707095) [936 bp, 311 aa] {ON}
           some similarities with uniprot|P25693 Saccharomyces
           cerevisiae YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 55/116 (47%), Gaps = 8/116 (6%)

Query: 90  SSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTA 147
           S  PP   +  ++  L  YS ++   L+ +  Y+  L S+ PA  F I + T HR  L  
Sbjct: 42  SPAPP---LMRFIKTLISYSNVQTPTLMATTVYLTKLRSIIPANVFGIET-TRHRIFLGC 97

Query: 148 TTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
             +A+K L DS   N H+A    G +   E+N +E E L+  ++ V    + +  C
Sbjct: 98  LILAAKTLNDSSPLNKHWASYTDGLLHIREVNTIERELLEYFDWNVCITTEELVAC 153

>KNAG0A01490 Chr1 (62182..62970) [789 bp, 262 aa] {ON} Anc_3.70
           YNL289W
          Length = 262

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 60/114 (52%), Gaps = 8/114 (7%)

Query: 80  SSETKLTRFHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINS 137
           SS T+L+     +P   S+  ++ +L +Y+ +    LLT++ Y++ L  + P  A  + S
Sbjct: 45  SSPTELSGKEPRLP---SLRTFITKLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS 101

Query: 138 LTVHRFLLTATTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
            T+HR  L    +++K   DS   N H+AK   G     ++N++E + L  +N+
Sbjct: 102 -TIHRLFLACLILSAKYHNDSSPLNKHWAKYTDGLFSLEDINLMERQLLNLLNW 154

>Kpol_1020.8 s1020 (18215..19105) [891 bp, 296 aa] {ON}
           (18215..19105) [891 nt, 297 aa]
          Length = 296

 Score = 45.1 bits (105), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 54/105 (51%), Gaps = 6/105 (5%)

Query: 91  SVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTAT 148
           ++PPP  +  ++  L   S ++   L+ +  Y+  L ++ P   + I S T HR  L   
Sbjct: 43  ALPPP-PLVKFITNLCLKSNVQTPTLMATTVYLKKLKNIIPPNVYGIES-TRHRIFLGCL 100

Query: 149 TVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
            +ASK L DS   N H+A+   G +Q  E+N +E E L+  ++ +
Sbjct: 101 ILASKTLNDSSPLNKHWARYTSGILQLREVNTIERELLEYFDWNI 145

>AFR159C Chr6 complement(723082..724008) [927 bp, 308 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL127W
           (PCL2) and YDL179W (PCL9)
          Length = 308

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 58/110 (52%), Gaps = 5/110 (4%)

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVASK 153
           +S+ +++  L K S ++   L++++ Y+  L S+ PA  + I + + HR  L    +A+K
Sbjct: 43  LSLVDFIKGLVKRSNVQTPTLMSTVVYLARLRSIIPANVYGIET-SRHRMFLGCLILAAK 101

Query: 154 GLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
            L DS   N H+ +   G +   E+N +E E L+  N+ +   + ++  C
Sbjct: 102 NLNDSSPMNKHWCRYTDGLLSLREVNTIERELLEYFNWNLRITNQDLISC 151

>SAKL0F09856g Chr6 complement(756909..757916) [1008 bp, 335 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 335

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 59/110 (53%), Gaps = 5/110 (4%)

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVASK 153
           +S+ +++  L  +S ++   L++++ Y+  L S+ PA  + I + T HR  L    +A+K
Sbjct: 42  VSLVDFIKGLITHSNVQTPTLMSTVVYLTRLRSIIPATVYGIET-TRHRIFLGCLILAAK 100

Query: 154 GLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
            L DS   N H+++   G +   E+N +E E L+  ++++     ++  C
Sbjct: 101 NLNDSSPLNKHWSRYTNGLLDIREVNTIERELLEYFDWKLRIDTQDLITC 150

>Kwal_23.6006 s23 complement(1411337..1412251) [915 bp, 304 aa] {ON}
           YDL127W (PCL2) - G1 cyclin [contig 12] FULL
          Length = 304

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATTVASKG 154
           +S+ N++  L   S ++   L+++  Y+  L S+ PA  +    T HR  L    +A+K 
Sbjct: 45  VSLENFIKGLVVQSNVQTPTLMSTAVYLAKLRSIIPANVLGIETTRHRMFLGCLIIAAKN 104

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
           L DS   N H+A    G +   E+N +E E L+  ++
Sbjct: 105 LNDSSPMNKHWASYTNGLLDTREVNTIERELLEYFDW 141

>Suva_4.118 Chr4 (223497..224426) [930 bp, 309 aa] {ON} YDL127W
           (REAL)
          Length = 309

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 62/112 (55%), Gaps = 10/112 (8%)

Query: 94  PPISVYNYLIRLTKYSALE-PSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTV 150
           PP+    ++ RL K+S ++ P+++ TS+Y + L  S+ P+  + I + T HR  L    +
Sbjct: 47  PPL--VKFINRLIKHSNVQTPTLMATSVYLVKL-RSIIPSNVYGIET-TRHRIFLGCLIL 102

Query: 151 ASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV-LPRDDNIT 199
           A+K L DS   N H+A+   G +   E+N +E E L   ++ V +  DD IT
Sbjct: 103 AAKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLGYFDWDVTISTDDLIT 154

>TPHA0P00810 Chr16 complement(165632..166375) [744 bp, 247 aa] {ON}
           Anc_7.289 YDL179W
          Length = 247

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 50/98 (51%), Gaps = 3/98 (3%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTV-HRFLLTATTVASKGL 155
           S+ +++  + KYS ++   L+ S  +++ L  + P +     T  HR  L    +ASK L
Sbjct: 44  SLTSFICDVVKYSKVKTPTLMASTVFLNRLRCIIPGYVEGIATATHRLFLGCLILASKTL 103

Query: 156 CDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
            DS   N H+ K   G +   E+N +E E L+ +++ V
Sbjct: 104 NDSSPFNKHWEKYCRGLLSLMEINTIERELLEYMSWNV 141

>YDL179W Chr4 (138291..139205) [915 bp, 304 aa] {ON}  PCL9Cyclin,
           forms a functional kinase complex with Pho85p
           cyclin-dependent kinase (Cdk), expressed in late M/early
           G1 phase, activated by Swi5p
          Length = 304

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 11/105 (10%)

Query: 93  PPPISVY--NYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTAT 148
           PP +S++  N +I   + +   P+++ TS+Y ++ L SV P   + IN+ T HR  L   
Sbjct: 46  PPDLSIFIKNVVI---QSNVQTPTLMATSVY-LNKLKSVIPKNVYGINT-TRHRIFLGCL 100

Query: 149 TVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
            +A+K L DS   N H+     G ++  E+N +E E L+ +N+ V
Sbjct: 101 ILAAKTLNDSSPWNKHWTTYTEGLLRIREVNTIERELLEYLNWDV 145

>Smik_4.110 Chr4 (211556..212482) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 59/112 (52%), Gaps = 7/112 (6%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVA 151
           PP++   ++ RL K+S ++   L+ +  Y+  L S+ P+  + I + T HR  L    +A
Sbjct: 47  PPLT--EFINRLIKHSNVQTPTLMATSVYLAKLRSLIPSKVYGIET-TRHRIFLGCLILA 103

Query: 152 SKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           +K L DS   N H+A+   G +   E+N +E E L+  ++ V    +++  C
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLLLREVNTIERELLEYFDWDVTISTEDLITC 155

>Ecym_8038 Chr8 complement(87401..88345) [945 bp, 314 aa] {ON}
           similar to Ashbya gossypii AFR159C
          Length = 314

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 90  SSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSL--TVHRFLLTA 147
           SS  P +S+ +++  L   S ++   L++++ Y+  L S+ P   ++ +  T HR  L  
Sbjct: 37  SSSEPILSLVDFIKGLINKSNVQTPTLMSTVVYLTRLRSIIPP-NVHGIETTRHRIFLGC 95

Query: 148 TTVASKGLCDSFCTNAHYAKVGG--VQGSELNILESEFLKKINYRVLPRDDNITWC 201
             +ASK L DS   N H+ +     +   E+N +E E L+  N+ +L  + ++  C
Sbjct: 96  LILASKNLNDSSPMNKHWCQYTNSLLSLREVNTVERELLEYFNWDLLITNKDLITC 151

>YNL289W Chr14 (87897..88736) [840 bp, 279 aa] {ON}  PCL1Cyclin,
           interacts with cyclin-dependent kinase Pho85p; member of
           the Pcl1,2-like subfamily, involved in the regulation of
           polarized growth and morphogenesis and progression
           through the cell cycle; localizes to sites of polarized
           cell growth
          Length = 279

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT+  Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPRDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>KLLA0E13223g Chr5 (1170139..1170987) [849 bp, 282 aa] {ON} similar
           to uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 282

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 6/104 (5%)

Query: 89  HSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTA 147
           H+ VP   S+  ++ RL +Y+ +  S LLT++ Y++ L  + P+       T HR  L  
Sbjct: 53  HNGVP---SLMTFISRLVRYTNVYTSTLLTTVVYLNRLRELLPSDAAGLPTTCHRIFLAC 109

Query: 148 TTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             +++K   DS   N H+ K   G     ++N++E + L+   +
Sbjct: 110 LILSAKYHNDSSPLNKHWTKYTDGMFTLRDVNLMERQLLQLFEW 153

>Skud_14.48 Chr14 (81435..82274) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.7 bits (99), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT+  Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Smik_14.42 Chr14 (72224..73063) [840 bp, 279 aa] {ON} YNL289W
           (REAL)
          Length = 279

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT+  Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTAACYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   N H+A+   G     ++N++E + L+ +N+
Sbjct: 113 HNDSSPLNKHWARYTDGLFTLEDINLMERQLLQLLNW 149

>Suva_4.68 Chr4 (125518..126435) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 89  HSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLT 146
           H   PP +S++  + ++   S ++   L+ +  Y++ L S+ P   + I + T HR  L 
Sbjct: 41  HGCPPPELSIF--IKKVVVQSNVQTPTLMATTVYLNKLKSIIPKNVYGIET-TRHRIFLG 97

Query: 147 ATTVASKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
              +A+K L DS   N H+     G ++  E+N +E E L+  N+ V
Sbjct: 98  CLILAAKTLNDSSPWNKHWTTYTEGLLKVREVNTIERELLEYFNWDV 144

>KNAG0B02930 Chr2 (563319..564257) [939 bp, 312 aa] {ON} Anc_7.289
           YDL179W
          Length = 312

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 53/107 (49%), Gaps = 4/107 (3%)

Query: 89  HSSVPPPI-SVYNYLIRLTKYSAL-EPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLT 146
            SS  PPI ++  ++  L   S +  P+++ +++Y + L   + P       T HR  L 
Sbjct: 39  RSSDKPPIPTLVEFIAGLVTNSKVGTPTLMASTVYLVRLKDILPPNIIGIETTRHRLFLG 98

Query: 147 ATTVASKGLCDSFCTNAHYAKVGG--VQGSELNILESEFLKKINYRV 191
              +A+K L D+   N H++K     +   E+NI+E E L  + +RV
Sbjct: 99  CLIIAAKTLNDNSPLNKHWSKHTNNLLPNREINIIERELLSYLRWRV 145

>CAGL0J09328g Chr10 (920703..921596) [894 bp, 297 aa] {ON} similar
           to uniprot|P25693 Saccharomyces cerevisiae YDL127w PCL2
           and similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9
          Length = 297

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 51/95 (53%), Gaps = 5/95 (5%)

Query: 101 YLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVASKGLCDS 158
           ++ +L KYS ++   L+ +  ++  L S+ PA  + I + T HR  L    +++K L DS
Sbjct: 52  FIKKLVKYSNVQTPTLMATTVFLTKLRSIIPANVYGIET-TRHRIFLGCLILSAKTLNDS 110

Query: 159 FCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
              N H+A+   G +   E+N +E E L+  ++ +
Sbjct: 111 SPLNKHWAQYTDGLLHLKEVNTIERELLEYFDWNL 145

>KLTH0A05346g Chr1 complement(445174..446079) [906 bp, 301 aa] {ON}
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p cyclin-
           dependent kinase (Cdk) to contribute to entry into the
           mitotic cell cycle essential for cell morphogenesis
           localizes to sites of polarized cell growth
          Length = 301

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSL--TVHRFLLTATTVASK 153
           +S+ +++  L   S ++   L+++  Y+  L S+ PA  ++ +  T HR  L    +A+K
Sbjct: 43  VSLVDFIKGLVVQSNVQTPTLMSTAVYLSKLRSIIPA-NVHGMETTRHRVFLGCLIIAAK 101

Query: 154 GLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
            L DS   N H+A    G +   E+N +E E L+  ++ +     ++  C
Sbjct: 102 NLNDSSPMNKHWASYTNGLLNTREVNTIERELLEYFDWNLRISTQDLVTC 151

>TBLA0J00650 Chr10 complement(152884..153975) [1092 bp, 363 aa] {ON}
           Anc_7.289 YDL179W
          Length = 363

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/94 (26%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 101 YLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATTVASKGLCDSF 159
           ++ RL  +S ++   L++++ Y+  L  + P+  +    T HR  +    +A+K L DS 
Sbjct: 50  FIKRLIVHSNVQTPTLMSTLVYLTKLREIIPSDVVGIETTRHRIFIGCLILAAKSLNDSS 109

Query: 160 CTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
             N H+ +   G  +  E+N +E E L+  N+ V
Sbjct: 110 PLNRHWTQYTNGLFKIQEINTIERELLEYFNWDV 143

>Skud_4.128 Chr4 (230632..231558) [927 bp, 308 aa] {ON} YDL127W
           (REAL)
          Length = 308

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 8/111 (7%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVA 151
           PP++   ++  L K+S ++   L+ +  Y+  L S+ P+  + I + T HR  L    +A
Sbjct: 47  PPLT--KFINGLIKHSNVQTPTLMATSVYLAKLRSIIPSNVYGIET-TRHRIFLGCLILA 103

Query: 152 SKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV-LPRDDNIT 199
           +K L DS   N H+A+   G +   E+N +E E L+  ++ V +  DD IT
Sbjct: 104 AKTLNDSSPLNKHWAEYTDGLLVLREVNTIERELLEYFDWDVTISTDDLIT 154

>Kpol_1020.16 s1020 complement(33477..34325) [849 bp, 282 aa] {ON}
           complement(33477..34325) [849 nt, 283 aa]
          Length = 282

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 51/97 (52%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ +L +Y+ +  S LLT+  Y+  L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITKLVRYTNVYTSTLLTTTCYLKKLQRILPKDATGLPS-TIHRMFLACLIISAKY 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   N H+A+   G     ++N++E + L  +N+
Sbjct: 113 HNDSSPLNKHWAEYTDGLFSLEDVNLMEMQLLALLNW 149

>TPHA0A00580 Chr1 (101866..102735) [870 bp, 289 aa] {ON} Anc_3.70
           YNL289W
          Length = 289

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 5/106 (4%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSL--TVHRFLLTATTVASKG 154
           S+  ++ +L +Y+ +  S LLT+  Y+  L  + P    N L  T+HR  L    +++K 
Sbjct: 57  SLKTFITKLVRYTNVYTSTLLTTACYLKKLQRILPK-DANGLPSTIHRIFLACLILSAKF 115

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNI 198
             DS   N H+A+   G     ++N++E + L  +N+ +  +++++
Sbjct: 116 HNDSSPLNKHWAEYTDGLFSLEDVNLMEVQLLALLNWDIRIKEEDL 161

>ZYRO0C02068g Chr3 complement(163475..164467) [993 bp, 330 aa] {ON}
           similar to uniprot|P24867 Saccharomyces cerevisiae
           YNL289W PCL1 Pho85 cyclin of the Pcl1 2-like subfamily
           involved in entry into the mitotic cell cycle and
           regulation of morphogenesis localizes to sites of
           polarized cell growth
          Length = 330

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 58/106 (54%), Gaps = 5/106 (4%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+ +++ RL +++ +  S LL +  Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 87  SLMSFISRLVRHTNVYTSTLLVTACYLNRLKCILPKDASGLPS-TIHRMFLACLILSAKF 145

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNI 198
             DS   N H+AK   G     ++N++E + ++ +N+ +   +D++
Sbjct: 146 HNDSSPLNKHWAKYTDGLFSVEDVNLMERQLVQLLNWDLRVTNDDL 191

>SAKL0C12100g Chr3 complement(1083684..1084628) [945 bp, 314 aa]
           {ON} similar to gnl|GLV|CAGL0E02233g Candida glabrata
           CAGL0E02233g and some similarites with YNL289W
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 314

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 54/97 (55%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ +L +Y+ +  S LLT++ Y+  L ++ P  A  + S T HR  L    +++K 
Sbjct: 55  SLMTFITKLVRYTNVYTSTLLTTVCYLSKLKTILPRDATGLPS-TTHRIFLACLILSAKF 113

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINY 189
             DS   NAH+++   G     ++N++E + L+ +++
Sbjct: 114 HNDSSPLNAHWSRYTDGLFSLEDVNLMERQLLQLLHW 150

>TDEL0E00790 Chr5 (163333..164097) [765 bp, 254 aa] {ON} Anc_3.70
           YNL289W
          Length = 254

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 53/97 (54%), Gaps = 5/97 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+ +++ RL +++ +  S LLT+  Y++ L  + P  A  + S TVHR  L    +++K 
Sbjct: 51  SLMSFISRLVRHTNVYTSTLLTTACYLNKLKCILPKDASGLPS-TVHRIFLACLILSAKF 109

Query: 155 LCDSFCTNAHYAKVGG--VQGSELNILESEFLKKINY 189
             DS   N H+AK         ++N++E + ++ +N+
Sbjct: 110 HNDSSPLNRHWAKYTDELFTLEDINLMERQLIQLLNW 146

>TDEL0H01550 Chr8 (266510..267439) [930 bp, 309 aa] {ON} Anc_7.289
           YDL179W
          Length = 309

 Score = 40.0 bits (92), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTVA 151
           P  S+ N++  L  +S ++   L+ +  Y+  L S+ P   + I + T HR  L    +A
Sbjct: 45  PAPSLTNFIKGLVLHSNVQTPTLMATAVYLAKLRSIIPGNVYGIET-TRHRIFLGCLILA 103

Query: 152 SKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRVLPRDDNITWC 201
           +K L DS   N H+A    G +   E+N +E E L+  ++ V     ++  C
Sbjct: 104 AKTLNDSSPLNKHWALYTDGLLHIHEVNTIERELLEYFDWNVTVTTKDLITC 155

>NDAI0C01980 Chr3 complement(445212..445892) [681 bp, 226 aa] {ON}
           Anc_5.347 YHR071W
          Length = 226

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 22/183 (12%)

Query: 61  TGLADSGKGEATDAADTDGSSETKLTRFHSSVPPP---ISVYNYLIRLTKYS-ALEPSVL 116
           T L++S         DT     ++  ++ S+   P    S+  YL+ + K S +   +V+
Sbjct: 48  TILSNSKLEYNMSLVDTIAEFLSETVKYLSTKKVPNEKSSIKTYLMEILKRSQSSRNNVI 107

Query: 117 LTSIYYIDLLSSVYPAFTINSLTVH---RFLLTATTVASKGLCDSFCTNAHYAKVGGVQG 173
           + S Y+  L +SV      N   VH   R  L+   ++ K L D   +   ++ + G+  
Sbjct: 108 VASFYFQKLYNSVQLNQDPNPEFVHCSKRIFLSCLILSHKFLNDKTFSMKAWSLISGISK 167

Query: 174 SELNILESEFLKKINYRVLPRDDNITWCKYEHRAHEFTIYNKAALTNVSKPTHTQRNSGY 233
            +L+ILE   L ++NY               H   + T  NK + TN+ K  + +  S Y
Sbjct: 168 RDLSILERWCLMRLNY---------------HLVVDVTEINKWSFTNLKKWDNKKMVSNY 212

Query: 234 NVL 236
           ++L
Sbjct: 213 SIL 215

>KAFR0A08280 Chr1 complement(1661106..1661831) [726 bp, 241 aa] {ON}
           Anc_3.70 YNL289W
          Length = 241

 Score = 38.9 bits (89), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 50/99 (50%), Gaps = 5/99 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           ++  ++ +L +Y+ +    LL +I Y++ L  + P  A  I S T+HR  L    +++K 
Sbjct: 55  TLREFICKLVEYTHVYTPTLLMTISYLNRLRRILPKGAAGIPS-TLHRIFLACLIISAKN 113

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
             DS   N H+ K   G     ++N++E   L  +N+ +
Sbjct: 114 HNDSSPLNRHWTKYTDGLFTLEDVNLMERHLLDLLNWNL 152

>NDAI0A02270 Chr1 (511135..512127) [993 bp, 330 aa] {ON} Anc_7.289
          Length = 330

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 5/101 (4%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATTVAS 152
           PP+S  N++  L  +S ++   L+ +  Y+  L  + P        T HR  L    +A+
Sbjct: 51  PPLS--NFIKNLVMHSNVQTPTLMATSVYLSKLRLIIPKNVYGMETTRHRIFLGCLILAA 108

Query: 153 KGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
           K L DS   N H+ K   G +   E+N +E E L+   + V
Sbjct: 109 KTLNDSSPLNKHWTKYTDGLLHIREVNTIERELLEYFEWNV 149

>KLTH0H03674g Chr8 (333755..335209) [1455 bp, 484 aa] {ON} weakly
           similar to uniprot|P53124 Saccharomyces cerevisiae
           YGL134W PCL10 Pho85p cyclin recruits activates and
           targets Pho85p cyclin-dependent protein kinase to its
           substrate
          Length = 484

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 53/105 (50%), Gaps = 6/105 (5%)

Query: 94  PPISVYNYLIRLTKYSALEPSVLLTSIYYIDLL------SSVYPAFTINSLTVHRFLLTA 147
           P ++  +YL RL    +  P V LT+ + +  L        ++    ++   VHR ++ +
Sbjct: 358 PTLAYEDYLKRLHCKFSFAPIVYLTAAHLLQTLFLTRVDEELHCKHHLDPRQVHRLVIAS 417

Query: 148 TTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVL 192
             +A+K L D   ++++++++ G+    L  LE  FL+ +N+  L
Sbjct: 418 IRLATKLLEDCVHSHSYFSRICGISKKLLTKLEVAFLECLNFEGL 462

>Skud_4.79 Chr4 (134241..135170) [930 bp, 309 aa] {ON} YDL179W
           (REAL)
          Length = 309

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 51/98 (52%), Gaps = 5/98 (5%)

Query: 98  VYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKGL 155
           ++ ++ ++   S ++   L+ +  Y++ L ++ P   + I + T HR  L    +A+K L
Sbjct: 48  LFTFIKKVVIQSNVQTPTLMATTVYLNKLKNIIPTNVYGIET-TRHRIFLGCLILAAKTL 106

Query: 156 CDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
            DS   N H++    G ++  E+N +E E L+  N+ V
Sbjct: 107 NDSSPWNKHWSTYTEGLLKVREVNTIERELLEYFNWDV 144

>Smik_4.60 Chr4 (115068..115985) [918 bp, 305 aa] {ON} YDL179W
           (REAL)
          Length = 305

 Score = 37.4 bits (85), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 45/83 (54%), Gaps = 6/83 (7%)

Query: 113 PSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKGLCDSFCTNAHYAKV-- 168
           P+++ TS+Y ++ L ++ P   + I + T HR  L    +A+K L DS   N H+     
Sbjct: 66  PTLMATSVY-LNKLRNIIPRNVYGIET-TRHRIFLGCLILAAKTLNDSSPWNKHWTTYTE 123

Query: 169 GGVQGSELNILESEFLKKINYRV 191
           G ++  E+N +E E L+  N+ V
Sbjct: 124 GLLRVREVNTIERELLEYFNWDV 146

>NCAS0A09870 Chr1 complement(1974028..1974912) [885 bp, 294 aa] {ON}
           Anc_3.70
          Length = 294

 Score = 36.6 bits (83), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT++ Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILE 180
             DS   N H+ K   G     ++N++E
Sbjct: 113 HNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>KAFR0C01560 Chr3 complement(320148..320951) [804 bp, 267 aa] {ON}
           Anc_3.70 YNL289W
          Length = 267

 Score = 36.2 bits (82), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 46/88 (52%), Gaps = 5/88 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +    LLT++ Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 59  SLRTFITRLVRYTNVYTPTLLTTVCYLNKLKRILPKDAKGLPS-TIHRLFLACLIISAKF 117

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILE 180
             DS   N H+ +   G     ++N++E
Sbjct: 118 HNDSSPLNKHWTRYTDGLFSLEDINLME 145

>Skud_7.139 Chr7 (260060..261364) [1305 bp, 434 aa] {ON} YGL134W
           (REAL)
          Length = 434

 Score = 36.6 bits (83), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 50/106 (47%), Gaps = 9/106 (8%)

Query: 88  FHSSVPPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLL---------SSVYPAFTINSL 138
           F+    P +S  ++L R+      EP+V L + + +D L         +++     +   
Sbjct: 300 FYMKSKPSLSSVDFLRRIQDKCEYEPAVYLVATFLMDTLFLTRNERNNNALQLKLKLQEK 359

Query: 139 TVHRFLLTATTVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFL 184
            VHR ++ +  +++K L D   ++ +++KV GV    L+ LE   L
Sbjct: 360 EVHRVIIASVRLSTKLLEDFVHSHEYFSKVCGVSKRLLSKLEISLL 405

>TPHA0A03250 Chr1 (717085..717954) [870 bp, 289 aa] {ON} Anc_7.289
           YDL179W
          Length = 289

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 7/103 (6%)

Query: 93  PPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPA--FTINSLTVHRFLLTATTV 150
           PPP++   ++  +   S ++   L+ +   ++ L  + P+  + I S T HR  L    +
Sbjct: 46  PPPLA--KFIKNICVKSNVQTPTLMATTVLLEKLKKIIPSNVYGIES-TRHRIFLGCLIL 102

Query: 151 ASKGLCDSFCTNAHYAKVGG--VQGSELNILESEFLKKINYRV 191
           ++K L DS   N H+AK     +   E+N +E E L   ++ V
Sbjct: 103 SAKSLNDSSPLNKHWAKYTESYIHLREVNTIERELLNYFDWNV 145

>CAGL0J10846g Chr10 complement(1058824..1059513) [690 bp, 229 aa]
           {ON} similar to uniprot|P38794 Saccharomyces cerevisiae
           YHR071w PCL5 cyclin like protein interacting with PHO85P
          Length = 229

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/159 (23%), Positives = 70/159 (44%), Gaps = 9/159 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLL-TSIYYIDLLSSVYPAFTINSLTV--HRFLLTATTVASK 153
           S+ N+L  +TK + +   +LL  SIY+  L+ S   A  +        R LL    +A K
Sbjct: 72  SIANFLKEVTKRAHISRDILLLASIYFDKLIKSHEGAINVPEFAYCGKRLLLVCIILAHK 131

Query: 154 GLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRDDNIT-W----CKYEHRAH 208
              D   +   + +V G+    + I+E   LK++NY +   ++ +T W      YE R H
Sbjct: 132 FSNDITFSMRVWTQVSGLPTRSIAIMERWCLKQLNYGLTVTNEAMTSWGSKLAGYEQR-H 190

Query: 209 EFTIYNKAALTNVSKPTHTQRNSGYNVLQMYYHKIIQLV 247
             ++    ++ N +     + +    +  +   KII+ V
Sbjct: 191 TTSVCTLTSIANATLKRKMELDDDVTIGDINPRKIIRTV 229

>CAGL0J06336g Chr10 complement(602954..603898) [945 bp, 314 aa] {ON}
           similar to uniprot|Q12477 Saccharomyces cerevisiae
           YDL179w PCL9 or uniprot|P25693 Saccharomyces cerevisiae
           YDL127w
          Length = 314

 Score = 34.3 bits (77), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 3/102 (2%)

Query: 93  PPPISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATTVA 151
           P P+ +  ++  L   S ++ S L+ +  Y+D LS + P+       T HR  L    ++
Sbjct: 50  PKPVELSLFVEELVASSKVQASTLMATAVYLDRLSRIIPSNVCGIETTKHRMFLGCLILS 109

Query: 152 SKGLCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
           SK L DS   N H+ K   G +   E+N +E E L   N+ +
Sbjct: 110 SKSLDDSSLFNKHWTKYCNGLLTLKEVNSIERELLSYFNWDI 151

>KLLA0F05654g Chr6 (552056..552991) [936 bp, 311 aa] {ON} weakly
           similar to uniprot|P25693 Saccharomyces cerevisiae
           YDL127W PCL2 G1 cyclin associates with Pho85p
           cyclin-dependent kinase (Cdk) to contribute to entry
           into the mitotic cell cycle essential for cell
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 311

 Score = 33.9 bits (76), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 23/99 (23%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 96  ISVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTIN-SLTVHRFLLTATTVASKG 154
           +S+ +++  L ++S ++   L+ +  Y+  L S+ P        T HR  +    +A+K 
Sbjct: 44  VSLVDFIKSLIRHSNVQTPTLMATTVYLTKLRSILPHDVCGIETTRHRIFIGCLILAAKN 103

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
           L DS   N H+     G     ++N +E E L   ++ +
Sbjct: 104 LNDSSPLNKHWTNYTDGLFTLEDVNTIERELLSLFSWNL 142

>NDAI0A06050 Chr1 complement(1372672..1373532) [861 bp, 286 aa] {ON}
           Anc_3.70
          Length = 286

 Score = 33.9 bits (76), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++  L +Y+ +    LLT++ Y++ L  + P  A  + S T+HR  L    +++K 
Sbjct: 54  SLMTFITNLVRYTNVYTPTLLTTVCYLNKLKRLLPKDATGLPS-TIHRIFLACLILSAKF 112

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILE 180
             DS   N H+ K   G     ++N++E
Sbjct: 113 HNDSSPLNKHWVKYTDGLFTLEDVNLME 140

>Kpol_1005.17 s1005 (29070..30029) [960 bp, 319 aa] {ON}
           (29070..30029) [960 nt, 320 aa]
          Length = 319

 Score = 33.9 bits (76), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 23/103 (22%), Positives = 47/103 (45%), Gaps = 8/103 (7%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLT--------VHRFLLTAT 148
           ++  +++ +   S    +VLL + YY   + S+ P  T NS +          R  L   
Sbjct: 150 TIVPFIVEIIDRSKCNKNVLLLATYYFKQIYSLNPISTKNSKSPLPTFSHCAKRIFLCCL 209

Query: 149 TVASKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRV 191
            ++ K L D+  T   +  + G+  + L+++E   L ++NY +
Sbjct: 210 IISHKFLNDNTFTMKSWHCISGLPQTHLSLMERWCLTRLNYNL 252

>AEL195W Chr5 (266347..267060) [714 bp, 237 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL289W (PCL1)
          Length = 237

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 52/99 (52%), Gaps = 5/99 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S++ ++ RL +Y+ +  + LLT+  Y++ L  + P  A  I S T HR  L    +++K 
Sbjct: 53  SIHMFITRLVRYTNVYTATLLTTAVYLERLRLLLPRDATGIPS-TAHRIFLACLILSAKF 111

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILESEFLKKINYRV 191
             DS   N H+ K   G     ++N++E + L+  ++ V
Sbjct: 112 HNDSSPLNKHWTKYTDGLFTTQDVNLMERQLLRLFDWNV 150

>NDAI0C04300 Chr3 (981107..981829) [723 bp, 240 aa] {ON} 
          Length = 240

 Score = 33.1 bits (74), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLS---SVYPAFTIN--SLTVHRFLLTATTVA 151
           S+ +++  +TK S  + ++LL + YY   L    S  P  TI   +    R  LT   +A
Sbjct: 94  SLKSFINEITKRSKSKRNILLLATYYFQKLYTSLSTCPVSTIPEFAFCAKRSFLTCIIIA 153

Query: 152 SKGLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRVLPRD 195
            K L DS  +   ++ + G+    L+ +E   L K++Y +   D
Sbjct: 154 HKYLNDSTFSMESWSLISGLNKKALSTIERWCLGKLDYNLFVDD 197

>NCAS0H01650 Chr8 complement(316598..317230) [633 bp, 210 aa] {ON}
           Anc_5.347 YHR071W
          Length = 210

 Score = 32.7 bits (73), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 11/119 (9%)

Query: 101 YLIRLTKYSALEPSVLLTSIYYIDLLSSVY-------PAFTINSLTVHRFLLTATTVASK 153
           YL  + K S    +V+  +  Y+D + S +       P F   +  V R  L+   +A K
Sbjct: 81  YLKEVCKRSRSTKTVVFLAAIYLDKIYSNWEPMLGDIPKF---ARCVKRVFLSCLIIAHK 137

Query: 154 GLCDSFCTNAHYAKVGGVQGSELNILESEFLKKINYRV-LPRDDNITWCKYEHRAHEFT 211
              D   +   ++ + G+   EL I+E + L +INY + + + + ++W     R  E T
Sbjct: 138 FANDKTFSMRSWSSISGLGRKELTIMEKKCLLEINYELTVDKAELLSWQNSHCRKEETT 196

>Kwal_23.5231 s23 complement(1069167..1069937) [771 bp, 256 aa] {ON}
           YNL289W (PCL1) - G(sub)1 cyclin that associates with
           PHO85 [contig 8] FULL
          Length = 256

 Score = 32.0 bits (71), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +  S LLT+  Y++ L  + P  A  + S T HR  L    +++K 
Sbjct: 59  SLMTFVTRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TSHRIFLACLILSAKF 117

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILE 180
             DS   N H+A    G     ++N++E
Sbjct: 118 HNDSSPQNKHWAAYTDGLFCLEDVNLME 145

>KAFR0C01150 Chr3 complement(231704..233098) [1395 bp, 464 aa] {ON}
           Anc_3.141 YOL072W
          Length = 464

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 42/99 (42%), Gaps = 26/99 (26%)

Query: 128 SVYPAFTINSLTVHRFLLTATTVASK------------GLCDSFCTNAHYAKVGGVQGSE 175
           +V+P+   N+L + R+L+ A  +  K             L  S+   AHY + G ++G  
Sbjct: 262 NVHPSIKKNALKILRYLIPAGLIMGKLPNFKLIEALDLQLASSYIKLAHYIREGNIKGLN 321

Query: 176 LNILESE-----------FLKK---INYRVLPRDDNITW 200
           L +  +E           FL+K   I YR L R   + W
Sbjct: 322 LWLQHNERDLSHRYLLIIFLEKLPMIAYRYLVRKTIMEW 360

>KLTH0A01584g Chr1 (141289..142134) [846 bp, 281 aa] {ON} similar to
           uniprot|P24867 Saccharomyces cerevisiae YNL289W PCL1
           Pho85 cyclin of the Pcl1 2-like subfamily involved in
           entry into the mitotic cell cycle and regulation of
           morphogenesis localizes to sites of polarized cell
           growth
          Length = 281

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 45/88 (51%), Gaps = 5/88 (5%)

Query: 97  SVYNYLIRLTKYSALEPSVLLTSIYYIDLLSSVYP--AFTINSLTVHRFLLTATTVASKG 154
           S+  ++ RL +Y+ +  S LLT+  Y++ L  + P  A  + S T HR  L    +++K 
Sbjct: 87  SLMTFITRLVRYTNVYTSTLLTATCYLEKLRRLLPRDAHGLPS-TGHRIFLACLILSAKY 145

Query: 155 LCDSFCTNAHYAKV--GGVQGSELNILE 180
             DS   N H+A    G     ++N++E
Sbjct: 146 HNDSSPQNKHWAAYTDGLFCLDDVNLME 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score = 29.6 bits (65), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 2/84 (2%)

Query: 100 NYLIRLTKYSALEPSVLLTSIYYIDLLSSVYPAFTINSLTVHRFLLTATTVASKGLCDSF 159
           NY +    Y     S+      + ++L+     FT++ L    F+LTA  V + G+    
Sbjct: 39  NYCMFAAAYGIATDSLYGVFANFFEILAWPLILFTLDFLN-FAFMLTAGCVLAVGIRAHS 97

Query: 160 CTNAHYAKVGG-VQGSELNILESE 182
           C NAHY +    +QGSE    ES+
Sbjct: 98  CNNAHYRENNKIIQGSERRCRESQ 121

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,214,329
Number of extensions: 1435871
Number of successful extensions: 4872
Number of sequences better than 10.0: 123
Number of HSP's gapped: 4963
Number of HSP's successfully gapped: 127
Length of query: 324
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 214
Effective length of database: 40,868,139
Effective search space: 8745781746
Effective search space used: 8745781746
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)