Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0I009108.318ON56956926410.0
NCAS0B035608.318ON58651111771e-155
NDAI0J010308.318ON65251311461e-149
CAGL0M04191g8.318ON60150111321e-148
Suva_10.2118.318ON56650211271e-147
YLR120C (YPS1)8.318ON56950111201e-146
Kwal_26.7254singletonON57050311181e-146
Smik_12.1868.318ON57250211131e-145
KAFR0B057108.318ON57550711091e-145
Suva_2.3058.318ON59750510581e-137
Kwal_56.239028.318ON62951110401e-134
Skud_4.4038.318ON59051210301e-133
KLTH0G12386g8.318ON58050210291e-133
SAKL0H15664g8.318ON55650010221e-132
Smik_4.3888.318ON59750610171e-131
YDR144C (MKC7)8.318ON59651010061e-129
NCAS0C033008.318ON5593579871e-126
ZYRO0F10230g8.318ON5805009771e-125
TPHA0A015808.318ON6003559741e-124
Kpol_543.618.318ON5883569671e-123
KNAG0E03220singletonON5405759571e-122
Skud_12.1928.318ON5693549381e-119
YLR121C (YPS3)8.319ON5083509121e-116
TBLA0D00140singletonON6075219171e-116
ZYRO0G02904gsingletonON5315009051e-115
Skud_12.1938.319ON4973499021e-115
KAFR0I01700singletonON5525049041e-114
ZYRO0F10274gsingletonON5725099041e-114
TBLA0H012908.318ON6673519081e-113
Smik_12.1878.319ON5073508901e-113
TBLA0E02630singletonON6893489041e-113
NDAI0G026208.318ON5903528961e-112
KNAG0G024108.318ON5303568611e-108
KAFR0B06530singletonON5383488581e-108
TDEL0F044508.318ON5243478571e-108
TBLA0A039108.318ON5965658611e-107
Ecym_42518.318ON5023488501e-107
KLLA0E04049g8.318ON5893508491e-106
Suva_10.2128.319ON7453508581e-105
ZYRO0F10318g8.319ON4863668161e-102
KAFR0H023008.318ON5213518181e-102
AGL192W8.318ON4993408051e-100
SAKL0C02970gsingletonON5925097766e-95
CAGL0E01419g8.318ON5913647556e-92
ZYRO0F10252gsingletonON5513407465e-91
CAGL0E01793gsingletonON5163527366e-90
KNAG0I009008.319ON5314237246e-88
CAGL0E01749gsingletonON4823517092e-86
Kwal_33.14239singletonON6513507213e-86
CAGL0E01881gsingletonON5084947078e-86
ZYRO0E02266gsingletonON5064907034e-85
KNAG0I01200singletonON6773527111e-84
CAGL0E01771gsingletonON5193546871e-82
KLTH0F06754gsingletonON7673537031e-82
KAFR0E03940singletonON6383526924e-82
CAGL0E01815gsingletonON5193546773e-81
CAGL0E01859gsingletonON5053526763e-81
Suva_9.13singletonON4644856715e-81
SAKL0F07172g7.182ON5423326777e-81
CAGL0E01837gsingletonON5213546679e-80
ZYRO0F10296gsingletonON5283326644e-79
Suva_16.14singletonON5403426305e-74
CAGL0E01727gsingletonON5393276262e-73
YIR039C (YPS6)singletonON5373466183e-72
Smik_65.1singletonON3423145911e-70
NCAS0A124607.182ON5403486034e-70
Suva_34.1singletonON3873285898e-70
TPHA0C008408.318ON10003556174e-69
SAKL0E15356gsingletonON5573675661e-64
YIL015W (BAR1)7.182ON5873575427e-61
ZYRO0D15554g7.182ON5213625352e-60
KLLA0D15917g7.182ON5113375342e-60
KAFR0B06700singletonON5313495342e-60
Skud_9.1547.182ON5163575263e-59
Ecym_43947.182ON5183555212e-58
Smik_9.1757.182ON5933565252e-58
TDEL0H026507.182ON5523435222e-58
KNAG0H027607.182ON5633545153e-57
CAGL0J02288g7.182ON5413224731e-51
Smik_5.7singletonON3042284572e-51
NDAI0B017207.182ON5473624713e-51
AGR240W7.182ON4523324419e-48
Suva_79.1singletonON2272354231e-47
SAKL0H00330gsingletonON5783514153e-43
Kpol_1063.227.182ON3362343285e-33
TBLA0D045807.182ON3953273192e-31
Suva_9.1877.182ON3331852677e-25
Suva_9.186singletonOFF5431902731e-24
Ecym_23968.677ON4153152557e-23
KLTH0D11264g8.677ON4173252344e-20
KNAG0J017108.677ON4153142344e-20
Kwal_26.88028.677ON4123242335e-20
TBLA0B038308.677ON4133252273e-19
Smik_6.3518.677ON4053232246e-19
Skud_16.1288.677ON4053232221e-18
ZYRO0F07392g8.677ON4183222221e-18
YPL154C (PEP4)8.677ON4053232212e-18
SAKL0H06512g8.677ON4043192184e-18
NCAS0C013608.677ON4063132132e-17
Suva_16.1568.677ON4063232122e-17
NDAI0E021058.677ON4083202086e-17
ACR144W8.677ON4083172079e-17
Kpol_1072.158.677ON3993201962e-15
TDEL0E022305.401ON5733151983e-15
KLLA0D05929g8.677ON4093201953e-15
Ecym_13245.401ON5763811973e-15
Smik_5.6singletonON1231171804e-15
Kpol_1013.68.677ON4023111944e-15
KAFR0H024208.677ON4163061936e-15
AGR407CsingletonON2683031886e-15
TPHA0D012608.677ON4193231928e-15
KLLA0F22088g5.401ON5583111931e-14
TDEL0A062308.677ON4083171864e-14
YDR349C (YPS7)5.401ON5963101866e-14
Smik_4.6135.401ON5963021813e-13
ZYRO0A06578g5.401ON7202891796e-13
Skud_4.6185.401ON5862841786e-13
KLTH0E02596g5.401ON5962301742e-12
TPHA0E019205.401ON6241931733e-12
SAKL0G07524g5.401ON6322941724e-12
CAGL0M02211g8.677ON4153311695e-12
ACR150W5.401ON5532661698e-12
TBLA0H016805.401ON6092281699e-12
CAGL0A02431g5.401ON5872381672e-11
Kwal_55.200345.401ON5932371662e-11
Suva_2.5205.401ON5981931537e-10
NCAS0F031505.401ON6452291537e-10
ACR143WsingletonON3933181519e-10
Suva_62.1singletonON2521021451e-09
NDAI0C046105.401ON6093291394e-08
KAFR0E040805.401ON5962881368e-08
YGL258W-AsingletonON77521183e-07
KNAG0C051405.401ON5982931313e-07
Kpol_1059.335.401ON6623101305e-07
Smik_67.1singletonON110541177e-07
SAKL0D01408gna 1ON5061381153e-05
YGL259W (YPS5)singletonON165511083e-05
Ecym_4614na 1ON4811871000.002
ABL123Cna 1ON494323980.003
KLLA0D01507gna 1ON515138771.0
Kwal_YGOB_Anc_5.3265.326ON18149677.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0I00910
         (569 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}             1021   0.0  
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   457   e-155
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             446   e-149
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   440   e-148
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   438   e-147
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   436   e-146
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   435   e-146
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   433   e-145
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   431   e-145
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   412   e-137
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   405   e-134
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   401   e-133
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   400   e-133
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   398   e-132
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   396   e-131
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   392   e-129
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              384   e-126
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   380   e-125
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   379   e-124
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   377   e-123
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   373   e-122
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   365   e-119
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   355   e-116
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                357   e-116
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   353   e-115
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   352   e-115
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   352   e-114
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   352   e-114
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   354   e-113
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   347   e-113
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   352   e-113
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   349   e-112
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   336   e-108
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            335   e-108
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   334   e-108
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   336   e-107
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   332   e-107
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   331   e-106
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   335   e-105
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   318   e-102
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   319   e-102
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   314   e-100
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   303   6e-95
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   295   6e-92
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   291   5e-91
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   288   6e-90
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              283   6e-88
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   277   2e-86
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   282   3e-86
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   276   8e-86
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   275   4e-85
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              278   1e-84
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   269   1e-82
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   275   1e-82
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              271   4e-82
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   265   3e-81
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   265   3e-81
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   263   5e-81
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   265   7e-81
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   261   9e-80
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   260   4e-79
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   247   5e-74
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   245   2e-73
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   242   3e-72
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       232   1e-70
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   236   4e-70
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   231   8e-70
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   242   4e-69
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   222   1e-64
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   213   7e-61
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   210   2e-60
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   210   2e-60
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   210   2e-60
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   207   3e-59
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   205   2e-58
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   206   2e-58
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   205   2e-58
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   202   3e-57
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   186   1e-51
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       180   2e-51
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   186   3e-51
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   174   9e-48
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   167   1e-47
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   164   3e-43
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   130   5e-33
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   127   2e-31
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...   107   7e-25
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...   109   1e-24
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...   102   7e-23
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    95   4e-20
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    95   4e-20
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    94   5e-20
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    92   3e-19
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    91   6e-19
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    90   1e-18
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    90   1e-18
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    90   2e-18
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    89   4e-18
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    87   2e-17
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    86   2e-17
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     85   6e-17
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    84   9e-17
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    80   2e-15
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    81   3e-15
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    80   3e-15
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    80   3e-15
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        74   4e-15
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    79   4e-15
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    79   6e-15
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    77   6e-15
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    79   8e-15
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    79   1e-14
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    76   4e-14
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    76   6e-14
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    74   3e-13
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    74   6e-13
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    73   6e-13
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    72   2e-12
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    71   3e-12
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    71   4e-12
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    70   5e-12
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    70   8e-12
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    70   9e-12
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    69   2e-11
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    69   2e-11
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    64   7e-10
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    64   7e-10
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    63   9e-10
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    60   1e-09
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    58   4e-08
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    57   8e-08
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    50   3e-07
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    55   3e-07
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    55   5e-07
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        50   7e-07
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    49   3e-05
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    46   3e-05
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    43   0.002
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    42   0.003
KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly...    34   1.0  
Kwal_YGOB_Anc_5.326 s33 (642310..642363,642439..642930) [546 bp,...    30   7.6  

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 1021 bits (2641), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/569 (89%), Positives = 507/569 (89%)

Query: 1   MREWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           MREWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC
Sbjct: 1   MREWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60

Query: 61  ASGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWX 120
           ASGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGW 
Sbjct: 61  ASGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWT 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAF 180
                                   PARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAF
Sbjct: 121 MMTGAENTMMMTGTGTETAVATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAF 180

Query: 181 AISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNT 240
           AISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNT
Sbjct: 181 AISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNT 240

Query: 241 ASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYT 300
           ASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYT
Sbjct: 241 ASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYT 300

Query: 301 GTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFP 360
           GTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFP
Sbjct: 301 GTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFP 360

Query: 361 AQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTC 420
           AQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTC
Sbjct: 361 AQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTC 420

Query: 421 VLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVK 480
           VLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVK
Sbjct: 421 VLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVK 480

Query: 481 AASYSNPWSSAVMMSTGGNIFTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 540
           AASYSNPWSSAVMMSTGGNIFTVE                                    
Sbjct: 481 AASYSNPWSSAVMMSTGGNIFTVEGASNTTGSSSTRSGSRITSRVGSSSSTRRSEASSSM 540

Query: 541 XTNQRKNAGAIVLPSFSTAIFTFIASFLL 569
            TNQRKNAGAIVLPSFSTAIFTFIASFLL
Sbjct: 541 GTNQRKNAGAIVLPSFSTAIFTFIASFLL 569

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  457 bits (1177), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 243/511 (47%), Positives = 329/511 (64%), Gaps = 54/511 (10%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KRD +  Y  + ++N+ SFYSV+L IGTP QK+TVLVDTGSSDLW+MG+DNP CAS  
Sbjct: 62  LVKRDGS--YENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCASTS 119

Query: 65  RGKKFLGDEG----DARVEIEAQQKDEWVTTGV------VTITLGDLPPGGNIWNSVAGD 114
            GK  +  +     D  +  E    +    TG       + ++  D+P G    N+V G 
Sbjct: 120 NGKNVMRKDDSNLPDGILFTEITVTNLSDLTGFFSDFSFIPMSETDIPTGVTSTNTVGGP 179

Query: 115 LESGWXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSA-AEATVQCSTYGTFDHSKSSTF 173
           +                             P +T + A +E T+ CS YGTFD ++SSTF
Sbjct: 180 V----------------------------FPTQTNNIALSERTIDCSQYGTFDKNQSSTF 211

Query: 174 KSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEV 233
           ++N T+F  SYGD+++ASG+W  D +++  LN++G+SFAVAN SNS++GVLGIGLPGLE 
Sbjct: 212 QTNFTSFLTSYGDSTFASGTWAHDVLNLGGLNITGLSFAVANMSNSTVGVLGIGLPGLET 271

Query: 234 TNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGA 293
           T             + ++S LYQY NFPM+LK  G I   +YSLFL+D   ++GSVLFGA
Sbjct: 272 T------------YSGSTSKLYQYNNFPMLLKQSGAIDSTSYSLFLDDLDAKQGSVLFGA 319

Query: 294 VDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSG 353
           VDH+KY G LYTVP+V+I        P++FD+TL G+G+  D    T+ T   PALLDSG
Sbjct: 320 VDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGIQNDSKNYTVTTNKFPALLDSG 379

Query: 354 TTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV 413
           TTISYFP ++   IAR+  A Y S  GFY MSC+  +S+TN VFDFGGFHIT P+ DF++
Sbjct: 380 TTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSSTNFVFDFGGFHITGPVSDFLL 439

Query: 414 QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDS-SLPESVEVIS 472
             S  TCVLA+ PQ+   ++LGD+FL++AYVVYDL+N E+S+AQAN  + +L  ++++IS
Sbjct: 440 PTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEISLAQANTGTQNLDSNIQIIS 499

Query: 473 STVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
            +VPSA+KA  YS  WS A+ +STGGNIFTV
Sbjct: 500 DSVPSAIKAPLYSETWSKAMPISTGGNIFTV 530

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  446 bits (1146), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 243/513 (47%), Positives = 328/513 (63%), Gaps = 29/513 (5%)

Query: 5   LAKRDNTDGYSLMDVQ--NQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           L KRDN DG    DV+  NQ SFYSV+L IGTPPQ VTVLVDTGS+DLWV G+ NP C S
Sbjct: 83  LLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQS 142

Query: 63  GRRGKKFLGDEGDARVEIEAQ---QKDEWVTTGVVTITLGDLPPGGNI------WNSVAG 113
               +  +    D   + +     Q+   + T ++   L DL   GN+      +  ++ 
Sbjct: 143 SLNSRNVVIKRDDDDDDDDDDDDTQQAAGMFTEILVTNLSDL---GNLSDLLGSFTIIST 199

Query: 114 DLESGWXXXXXXXXXXXXXXXXXXXXXXXXXPARTTD-SAAEATVQCSTYGTFDHSKSST 172
            +  G                          P  T D   +E T+ C  YGTF+ S+SST
Sbjct: 200 GIPGG--IIPTGVTTATTTGGGGGAGGAGGLPTATNDIPRSERTLDCQEYGTFNSSRSST 257

Query: 173 FKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLE 232
           FK+N T+F+ISYGD+++ASG+W  D ++++ LNV+G+SFAVAN +NS++GVLGIGLP LE
Sbjct: 258 FKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVANMTNSTVGVLGIGLPALE 317

Query: 233 VTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFG 292
            T    + ASG     A    +YQY NFPMVLK  G IH   YSLFL+D  E  GSVLFG
Sbjct: 318 ST---YSGASG-----ATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDLDESHGSVLFG 369

Query: 293 AVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDS 352
           A+DHSKYTG LYTVP+++I  +S  S P++FD+TL+G+G+       T+ TT + ALLDS
Sbjct: 370 AIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNLTLTTTKLAALLDS 429

Query: 353 GTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV 412
           GTTISYFP  +   +AR+ NA Y +R GFYT+ C   +SNTNLVFDFGGFHI+ PL DF+
Sbjct: 430 GTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGFHISGPLQDFL 489

Query: 413 VQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPES---VE 469
           +Q S QTC+LA+ PQ+   V+LGD+FL++AYVVYDL+N  +++AQA+  +S   S   +E
Sbjct: 490 IQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQADTSTSNQSSSSDIE 549

Query: 470 VIS-STVPSAVKAASYSNPWSSAVMMSTGGNIF 501
           +I+ ST+P A++A  YS  W++   + +GGNIF
Sbjct: 550 LITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  440 bits (1132), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 237/501 (47%), Positives = 314/501 (62%), Gaps = 28/501 (5%)

Query: 7   KRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC--ASGR 64
           KR N  GY  + + NQ SFYSV LE+GTPPQ V VLVDTGSSDLW+ G+DNP C  ++G 
Sbjct: 56  KRAN--GYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDNPYCRGSTGT 113

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
            GK  L +    R   +A+   +  TT         L P  +  N    D    W     
Sbjct: 114 SGKNMLLEAELKRALEDARDIAKERTT---------LAPRDDEHN----DGLLSWLTGSD 160

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                A T++  A AT+ C+ YGTFD SKSST+ SN+TAF I Y
Sbjct: 161 GLLGGQGGTTITLTDSAQPTAAGTSN-GARATINCAKYGTFDTSKSSTWHSNDTAFMIQY 219

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           GD+++ASG+WG+D + ++ LNV+G+SFAVAN +NS++GVLGIGLP LEVT       SG+
Sbjct: 220 GDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIGLPALEVTYSGRTAVSGQ 279

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304
           +         YQY NFP+VL  +G I   +YSLFLN+   + GSVLFGAVDHSKY G LY
Sbjct: 280 RP--------YQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVDHSKYLGDLY 331

Query: 305 TVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLA 364
           T+P+V+ Y       P++F++TL GLG+      +TI TT IPALLDSGTT++Y P  L 
Sbjct: 332 TIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTTITTTKIPALLDSGTTLTYLPQALV 391

Query: 365 NEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAI 424
             I +K  ATY +R+G+Y  SC   + +T +VFDFGGFHI AP+ +F++  S  +C+L I
Sbjct: 392 TRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGFHINAPITNFIIGSSGDSCILGI 451

Query: 425 GPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASY 484
            PQ    ++LGD FL++AYVVYDLEN E+SMAQAN+     E +EVISS+VP AV+A  +
Sbjct: 452 MPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYAGG-QEDIEVISSSVPGAVRAPGF 510

Query: 485 SNPWSS-AVMMSTGGNIFTVE 504
           S+ WS+ A   +T G+IFTV+
Sbjct: 511 SSTWSTLATSFNTQGDIFTVQ 531

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  438 bits (1127), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 241/502 (48%), Positives = 322/502 (64%), Gaps = 50/502 (9%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L+KR   DGY  + + NQ SFYSVDLE+GTP Q +TVLVDTGSSDLW+MG+ NP C+S  
Sbjct: 65  LSKR--ADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNPYCSSDD 122

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
             K  L            +++D   ++G +   + D+ P G  W +  G +         
Sbjct: 123 SSKYVL------------RKRDTSSSSGDL---VNDINPFG--WLTETGSVTGA------ 159

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                A  +  A+EAT+ C  YGTF  S SSTFKSNNTAF ISY
Sbjct: 160 ------------TATATGSGTATQSVPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISY 207

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           GD ++A+G++G D ++++ LNV+G+SFAVAN +NS+MGVLGIGLP LEVT   S+ ++G 
Sbjct: 208 GDGTFAAGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGG 267

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304
           K         Y+Y NFP+VLKN G I   AYSL+LND   + G++LFG VDH+KY+GTLY
Sbjct: 268 KS--------YKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGGVDHNKYSGTLY 319

Query: 305 TVPLVDIYHDSASSKPVEFDITLYGLG-VDKDGSQSTIATTTIPALLDSGTTISYFPAQL 363
           TV LV+    S  + P++FDITL GLG +D +G + T+ TT IP LLDSGTT++Y P ++
Sbjct: 320 TVALVNTL--SGFTSPIQFDITLNGLGIIDDNGDEKTLTTTKIPVLLDSGTTLTYLPVEM 377

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLA 423
              IA    A Y SR G+Y M C    ++T +VFDFGGFHI A L  F++  S  TC+L 
Sbjct: 378 VELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDFGGFHINASLSSFILSTSGNTCLLG 437

Query: 424 IGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAA 482
           I P  ++   +LGD FL+NAYVVYDLENLE+SMAQA ++ +  E +EVIS++VP+AVKA 
Sbjct: 438 IIPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNVT-SEDIEVISTSVPNAVKAP 496

Query: 483 SYSNPWSSAVMMSTGGNIFTVE 504
            Y+N WS+   ++TGGNIFTV+
Sbjct: 497 GYTNTWSTTASIATGGNIFTVD 518

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  436 bits (1120), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 242/501 (48%), Positives = 318/501 (63%), Gaps = 45/501 (8%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KR   DGY  + + NQ SFYSVDLE+GTPPQ VTVLVDTGSSDLW+MG+DNP C+S  
Sbjct: 64  LLKR--ADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNS 121

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
            G         +R  +  ++ D                 GG++ N +      GW     
Sbjct: 122 MGS--------SRRRVIDKRDDS--------------SSGGSLINDIN---PFGWLTGTG 156

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                A  +  A+EAT+ C  YGTF  S SSTF+SNNT F+ISY
Sbjct: 157 SAIGPTATGLGGGSGT-----ATQSVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISY 211

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           GD ++ASG++G D + ++ LNV+G+SFAVAN +NS+MGVLGIGLP LEVT   S      
Sbjct: 212 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGST----- 266

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304
              A+ S   Y+Y NFP+VLKN G I    YSL+LND     G++LFGAVDHSKYTGTLY
Sbjct: 267 ---ASHSGKAYKYDNFPIVLKNSGAIKSNTYSLYLNDSDAMHGTILFGAVDHSKYTGTLY 323

Query: 305 TVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQS-TIATTTIPALLDSGTTISYFPAQL 363
           T+P+V+    S  S P++FD+T+ G+G+   GS + T+ TT IPALLDSGTT++Y P  +
Sbjct: 324 TIPIVNTLSASGFSSPIQFDVTINGIGISDSGSSNKTLTTTKIPALLDSGTTLTYLPQTV 383

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLA 423
            + IA +  A Y SR G+Y + C  D S   +VFDFGGFHI APL  F++  +  TC+L 
Sbjct: 384 VSMIATELGAQYSSRIGYYVLDCPSDDS-MEIVFDFGGFHINAPLSSFIL-STGTTCLLG 441

Query: 424 IGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAA 482
           I P  ++   +LGD FL+NAYVVYDLENLE+SMAQA ++++  E++E+I+S+VPSAVKA 
Sbjct: 442 IIPTSDDTGTILGDSFLTNAYVVYDLENLEISMAQARYNTT-SENIEIITSSVPSAVKAP 500

Query: 483 SYSNPWSSAVMMSTGGNIFTV 503
            Y+N WS++  + TGGNIFTV
Sbjct: 501 GYTNTWSTSASIVTGGNIFTV 521

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  435 bits (1118), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 235/503 (46%), Positives = 312/503 (62%), Gaps = 48/503 (9%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L KR   DG   + ++NQ +FYSV++ +G+P Q VT+L+DTGSSD+WVMG++NP C 
Sbjct: 57  RAELVKR--ADGSETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCE 114

Query: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVT-TGVVTITLGDLPPGGNIWNSVAGDLESGWX 120
              R  K +    +  +E E  +KD + +   ++T T                       
Sbjct: 115 GSSRSSKHVLLGENIGLEDETVKKDFFSSFRSLLTAT----------------------- 151

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAF 180
                                   P+RT+ +A++AT+ CS+YGTF    SS+FKSNNT F
Sbjct: 152 -------------ATSTVSASAVAPSRTSVAASDATLSCSSYGTFATGSSSSFKSNNTDF 198

Query: 181 AISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNT 240
            I YGD +YA G+WG D +++  + VS +S AVAN SNS+ GVLGIGL GLEVTN  S  
Sbjct: 199 YIQYGDLTYALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLEVTNVGS-- 256

Query: 241 ASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYT 300
                 + ++S S Y Y N P +L + G IH+ AYSLFL+D   + GSVLFGAVDHSKYT
Sbjct: 257 ------LVSSSRSAYTYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYT 310

Query: 301 GTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFP 360
           G LYTVPLV+IY  S    P++ D+TL GLG+  + +  T  TT IPALLDSGTT++Y P
Sbjct: 311 GNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKTNITFTTTPIPALLDSGTTLTYLP 370

Query: 361 AQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTC 420
           + +   IAR+ +A Y    G+Y + CS  + +  LVFDFGGFHI + L +F+++ SS  C
Sbjct: 371 SSMVQSIARRLSAQYSYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNFC 430

Query: 421 VLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVK 480
            L + PQ  +  +LGD FL+ AYVVYDLENLEVSMAQAN+D    E +EVISST+P AVK
Sbjct: 431 ALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSMAQANYDGG-SEDIEVISSTIPGAVK 489

Query: 481 AASYSNPWSSAVMMSTGGNIFTV 503
           A  YS+ WSS + +STGGNIFTV
Sbjct: 490 APGYSSTWSSRIPISTGGNIFTV 512

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  433 bits (1113), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 240/502 (47%), Positives = 326/502 (64%), Gaps = 45/502 (8%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KR   DGY  + + NQ SFYSV+L++G+PPQ VTVLVDTGSSDLW+MG++NP C+S  
Sbjct: 67  LFKR--ADGYEEIIITNQQSFYSVELDVGSPPQNVTVLVDTGSSDLWIMGSNNPYCSSDT 124

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
           R         ++R  +   ++D+  ++G +   + D+ P G  W +  G L         
Sbjct: 125 RS--------NSRRRV-IDKRDDSSSSGAL---VNDINPFG--WLTGTGGL--------- 161

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                A  +  A+EAT+ C  YGTF  S SSTF+SNNT F+ISY
Sbjct: 162 -------IGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISY 214

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           GD ++ASG++G D + ++ LNV+G+SFAVAN +NS+MGVLGIGLP LEVT   S  + G+
Sbjct: 215 GDGTFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGR 274

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304
           +         ++Y NFP+VLKN G I   AYSL+LND   + G++LFGAVDHSKYTGTLY
Sbjct: 275 RP--------FKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLY 326

Query: 305 TVPLVDIYHDSASSKPVEFDITLYGLGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQL 363
           T+P+V+    S  S P++FD+T+ G+GV D    + T+ TT IPALLDSGTT++Y P  +
Sbjct: 327 TIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTKIPALLDSGTTLTYLPETV 386

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLA 423
              IA +  A Y  R G+Y + C  D S T +VFDFGGFHI A L  F++   S TC+L 
Sbjct: 387 VALIADEIGAQYSYRLGYYVLDCPSDDS-TQIVFDFGGFHINASLSSFILSTGS-TCLLG 444

Query: 424 IGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAA 482
           I P  +N   +LGD FL+NAYVVYDL+NLE+SMAQA ++++  E++EVISS++PSAVKA 
Sbjct: 445 IIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT-ENIEVISSSIPSAVKAP 503

Query: 483 SYSNPWSSAVMMSTGGNIFTVE 504
            Y+N WS++  + TGGNIFTV+
Sbjct: 504 GYTNTWSTSATIVTGGNIFTVD 525

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  431 bits (1109), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 244/507 (48%), Positives = 316/507 (62%), Gaps = 52/507 (10%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           ++ L KR     Y++ ++ NQ SFYSV+L IGTP Q VTVLVDTGSSDLWV G+DNPLC+
Sbjct: 57  KDSLQKRAE---YAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPLCS 113

Query: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTIT-----LGDLPPGGNIWNSVAGDLE 116
           +            D     + ++ +  V T   TIT     L  L P G +  S A    
Sbjct: 114 TDSSDDD------DDSYAFKKKRAETIVVTEEATITENGNNLDGLDPFGWLGGSTA---- 163

Query: 117 SGWXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSN 176
                                       P+ ++ S      +  T+ T D   SST+ SN
Sbjct: 164 -------------------TSGSFETSFPSSSSSSGDFDCSEYGTFNTND---SSTWSSN 201

Query: 177 NTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQ 236
           +T+F ISYGD+S A G WG D +SI+ ++VSGVSFAVANY+NS++GVLGIGL GLE T  
Sbjct: 202 HTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNSTVGVLGIGLSGLETTYS 261

Query: 237 LSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDH 296
                        +SS  Y Y N PM+LK+ G+I  +AYSLFLN+  +  G++LFGAVDH
Sbjct: 262 -----------GTSSSESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGNLLFGAVDH 310

Query: 297 SKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTI 356
           SKY+G+LYT+P+V++Y       P+EFD+T+YGLG+    S +TIAT  IPALLDSGTTI
Sbjct: 311 SKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPALLDSGTTI 370

Query: 357 SYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQS 416
            YFP  L   +A +  A+Y    GFY MSC   + +T  VFDFGGFHIT PL DF+++ S
Sbjct: 371 VYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPLSDFLIRVS 430

Query: 417 SQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVP 476
              C+LA+  Q +  ++LGD FL+NAYVVYDLEN E+SMAQAN+DS   E +EVISSTVP
Sbjct: 431 GSECILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSE-DEDIEVISSTVP 489

Query: 477 SAVKAASYSNPWSSAVMMSTGGNIFTV 503
           SAVKAASYSN WSS   +++GG+IFTV
Sbjct: 490 SAVKAASYSNSWSSTGSITSGGDIFTV 516

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  412 bits (1058), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 234/505 (46%), Positives = 312/505 (61%), Gaps = 56/505 (11%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA--S 62
           L KR   D Y ++D+ NQ SFYSVDL+IGTP QKVTVLVDTGSSDLWV G++NP C+  S
Sbjct: 62  LVKRG--DDYEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSNNPYCSTKS 119

Query: 63  GRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXX 122
           G                   ++KDE     +V           ++  SVA ++       
Sbjct: 120 GHTSSS------------SKERKDEDNILSLVQ----------SVVQSVASEIS------ 151

Query: 123 XXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAI 182
                                   + + S+A  T+ C+TYG FD SKSSTF+SN T F+I
Sbjct: 152 -----------YDTTITDTDATATQDSTSSALQTIDCTTYGVFDSSKSSTFQSNKTDFSI 200

Query: 183 SYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTAS 242
           +YGD ++ASG+WG D +++N LNV+G+SFAVAN +NS++GVLGIGL GLE T   +  +S
Sbjct: 201 TYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLAGLESTYSGATLSS 260

Query: 243 GKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGT 302
            ++         Y Y NFPMVLKN G I   AYSLFLN+   + GS+LFGAVDH KY+G 
Sbjct: 261 AQES--------YTYNNFPMVLKNSGAIKSAAYSLFLNETNAKHGSILFGAVDHGKYSGD 312

Query: 303 LYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQS-TIATTTIPALLDSGTTISYFPA 361
           LYT+P+++   D     P++F +TL GLG+ K  S+S TI TT IPALLDSGTTISY P 
Sbjct: 313 LYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSGTTISYMPV 372

Query: 362 QLANEIARKFNATYDSRSGFYTM-SCSYDTSNTNLVFDFGGFHITAPLDDFVV--QQSSQ 418
           +L   +A K  A+Y S+ G+Y M   +    + N+VFDFGGF+I+  L  + +    SS 
Sbjct: 373 ELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQLSADSSSD 432

Query: 419 TCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSA 478
            C+L   PQ ++ V+LGD FLSNAYVVYDL+N+E+SMAQ +  S   E ++VI  +VPSA
Sbjct: 433 VCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQVDL-SGRSEDIDVIEDSVPSA 491

Query: 479 VKAASYSNPWSSAVMMSTGGNIFTV 503
           VKA SYS+ WS+   + +GG+IFTV
Sbjct: 492 VKAPSYSSTWSTDGSIVSGGDIFTV 516

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  405 bits (1040), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 234/511 (45%), Positives = 300/511 (58%), Gaps = 41/511 (8%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R    KRD  DG +  ++ NQ +FYSV + +G+P Q VT+L+DTGSSD+WVMG++NP C 
Sbjct: 57  RVKRVKRD--DGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCE 114

Query: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNS---VAGDLESG 118
                 K +    D+  E +   KD +          G     G+ W +   V  +  S 
Sbjct: 115 GSSGKSKHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETTSY 174

Query: 119 WXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNT 178
           W                         P  T+  + +AT+ CS YGTF    SS+FKSN T
Sbjct: 175 WPDDTDV-------------------PTATSMDSYQATISCSEYGTFATDSSSSFKSNGT 215

Query: 179 AFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLS 238
            F I YGD SYA G WG D +++  + VS +S AVAN SNS+ GVLGIGLPGLEVTN L 
Sbjct: 216 QFLIQYGDLSYALGVWGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNAL- 274

Query: 239 NTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSK 298
                    A + S  Y Y NFP +L + G I K AYSLF+ND     GSVLFGAVDHSK
Sbjct: 275 ---------AESPSDAYTYKNFPAMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSK 325

Query: 299 YTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISY 358
           YTGTL T+PLV+    +   KP++FD+TL+GLG+  + + +TI TT  PALLDSGTT ++
Sbjct: 326 YTGTLQTIPLVNSIKSAQVPKPIQFDVTLHGLGITLNDTNTTITTTPFPALLDSGTTFTH 385

Query: 359 FPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV----- 413
            P  L + IA+K NA Y    GFY   C   + +  LVFDFGGFHI + LD+F +     
Sbjct: 386 LPGYLVSAIAKKLNAEYGDEDGFYRYQCDEISDSDELVFDFGGFHIKSKLDNFALATYDD 445

Query: 414 -QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVIS 472
               +  C LA+ P     ++LGD FL+ AYVVYDLENLE+SMAQAN D    E +E I 
Sbjct: 446 DDNETDVCALALIPYNRGEIILGDNFLTAAYVVYDLENLEISMAQANLDGG-SEDIEEIV 504

Query: 473 STVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           STVPSAVKA  YS+ W+SA+ +STGGNIFT+
Sbjct: 505 STVPSAVKAPGYSSTWTSAIPISTGGNIFTI 535

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  401 bits (1030), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 226/512 (44%), Positives = 307/512 (59%), Gaps = 74/512 (14%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L +R+  D Y L+ + N+ SFYSV+L+IGTPPQK+TVLVDTGSSDLWV G++NP C++  
Sbjct: 62  LVRRE--DDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKG 119

Query: 65  RG------KKFLGDEGDARVE--IEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLE 116
           +       K+   D   + VE  I     D  ++    T TL + P              
Sbjct: 120 KDTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTP-------------- 165

Query: 117 SGWXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSN 176
                                               A   + C TYGTFD SKSSTF+SN
Sbjct: 166 -----------------------------------LASQKINCGTYGTFDSSKSSTFESN 190

Query: 177 NTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQ 236
            T F+I+YGD+++ASG+WG D +++N LNV+G+SFAVAN +NS++GVLGIGLPGLE T  
Sbjct: 191 KTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYS 250

Query: 237 LSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDH 296
             + +S +K         Y Y NFPMVLKN G I   AYSLF N    + G++LFGAVDH
Sbjct: 251 GVSLSSVQKS--------YTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDH 302

Query: 297 SKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTIATTTIPALLDSG 353
            KYTG LYT+P+++I  ++    P++F +TL G+ V   D   + +T+ TT IPALLDSG
Sbjct: 303 GKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSG 362

Query: 354 TTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT-SNTNLVFDFGGFHITAPLDDF- 411
           TTISY P +L   +A K  A+Y S  G+Y M+C ++   +  +VFDFGGFHI++ L +F 
Sbjct: 363 TTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQ 422

Query: 412 -VVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEV 470
                SS  C+L   PQ +  V+LGD FL + Y+VYDL+N+E+SMA A+F S   E ++V
Sbjct: 423 LFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADF-SDNDEYIDV 481

Query: 471 ISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           I S VPSA+KA +YSN WS+   +  GGNIF+
Sbjct: 482 IESAVPSALKAPNYSNTWSTYESIVPGGNIFS 513

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  400 bits (1029), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/502 (45%), Positives = 316/502 (62%), Gaps = 42/502 (8%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           LAKR   DG   + ++NQ +FYSV+L +G+P Q VT+L+DTGSSD+WVMG++NP C  G 
Sbjct: 60  LAKR--ADGSETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGS 117

Query: 65  RGKK---FLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXX 121
            G      LGD  D+R E   +   +W +T + +              +  G  +SG   
Sbjct: 118 SGNSKHVLLGDHVDSRDE---EVNRDWFST-LRSFLTATATATATATATATGSADSG--- 170

Query: 122 XXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFA 181
                                  P+RT+ ++  AT+ CS+YGTF    SS+F+SNNTAF 
Sbjct: 171 --------------------GNAPSRTSVNSQYATLTCSSYGTFATDSSSSFQSNNTAFY 210

Query: 182 ISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTA 241
           I YGD++YA G+WG D +++  + +SG+S AVAN SNS+ GVLGIGL  LEVTN  +   
Sbjct: 211 IEYGDSTYALGTWGRDNVTLQDITLSGISMAVANESNSTFGVLGIGLAALEVTNVGTLAT 270

Query: 242 SGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTG 301
            G           Y Y N P  + ++GIIHK AYSLFL+    +EGSVLFGAVDHSKYTG
Sbjct: 271 RGNS---------YTYENLPAKMVSEGIIHKNAYSLFLDSLDAKEGSVLFGAVDHSKYTG 321

Query: 302 TLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPA 361
           +LYT+PL + Y     S P++ ++TL G G+  + + ST  TT + ALLDSGTT++Y P 
Sbjct: 322 SLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNSTFTTTPLTALLDSGTTLTYLPT 381

Query: 362 QLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCV 421
            L  ++A K+ A YDS  G+Y +SCS       LVFDFGGFHI + +++F+++ +S  C 
Sbjct: 382 TLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDELVFDFGGFHINSKVENFLIRATSNICA 441

Query: 422 LAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKA 481
           L + PQ  + ++LGD FL+ AYVVYDL+NLE+S+AQAN+D     ++EVISS+VPSAVK 
Sbjct: 442 LGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISLAQANYDGG-SSNIEVISSSVPSAVKG 500

Query: 482 ASYSNPWSSAVMMSTGGNIFTV 503
            SYS+ WS++V +STGGNIFTV
Sbjct: 501 PSYSSTWSTSVPISTGGNIFTV 522

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  398 bits (1022), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 218/500 (43%), Positives = 300/500 (60%), Gaps = 38/500 (7%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L+KRD  DG+  ++++NQVSF+SV+LEIGTP Q VTVLVDTGSSDLWV G++NP C +G 
Sbjct: 54  LSKRD--DGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGS 111

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
            G +                +++  +         +     NI       + S W     
Sbjct: 112 VGNR----------------RNDASSGSGSGSGSSNNKKRVNIKRDEISSVRS-WLTASG 154

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                  T D +   T   S   TF         SN+T F I Y
Sbjct: 155 TNTRTQSGSASATRANSLSSALATIDCSQYGTFNTSASSTF--------SSNDTLFVIFY 206

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           GD+SYA G+WG D + ++ +++ G+SFAVAN +NS++GVLGIGLPGLEVT          
Sbjct: 207 GDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIGLPGLEVT---------Y 257

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLY 304
              A+++ + YQY NFP++LK + +I   AYSLFLN      GS+LFGAVDHSKY+G LY
Sbjct: 258 SGYASSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAVDHSKYSGQLY 317

Query: 305 TVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLA 364
           TVPL++    S  + P++F++ + G+GV   GS +T+ TT IPALLDSG T+SYFP Q+A
Sbjct: 318 TVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIPALLDSGATLSYFPVQVA 377

Query: 365 NEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQT-CVLA 423
             IA   +ATY S  G+Y + C     +T +++DFGGFHI + L D+++  +  + CVL 
Sbjct: 378 EMIADALDATYSSSYGYYIVDCPSSDDDTEIIYDFGGFHIASKLTDYILTTNRPSICVLG 437

Query: 424 IGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAAS 483
           I PQ  N  +LGDVFL++AYVVYDL+N E+S+AQAN++    E +EVIS +VPSA+KA S
Sbjct: 438 IVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGG-DEQIEVISESVPSAIKAPS 496

Query: 484 YSNPWSSAVMMSTGGNIFTV 503
           YS+   S+   STGG+IFTV
Sbjct: 497 YSSTRFSSASASTGGDIFTV 516

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  396 bits (1017), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/506 (44%), Positives = 303/506 (59%), Gaps = 58/506 (11%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L  R   D Y L+++ NQ SFYSV+L+IGTPPQKVTVLVDTGSSDLWV G+DNP C 
Sbjct: 59  RARLVTRG--DDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC- 115

Query: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXX 121
                  F   E  +    +   KD  V+  VV     ++     +  SVA         
Sbjct: 116 -------FTEGEDTSGSSFKHVNKDNLVS--VVESVFTEISYDTTMVTSVA--------- 157

Query: 122 XXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFA 181
                                      T S ++A + C+TYGTFD SKSSTF+SN T F+
Sbjct: 158 ---------------------TATIGNTASTSQA-MNCTTYGTFDTSKSSTFESNKTEFS 195

Query: 182 ISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTA 241
           I+YGD+++ASG+WG D +S+N LNV+G+SFAVAN +NS++GVLGIGLPGLE T    + +
Sbjct: 196 ITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS 255

Query: 242 SGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTG 301
           S +K         Y Y NFPM+LKN G I   AYSLF N    + G++LFGAVDH KY G
Sbjct: 256 SAQKS--------YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAG 307

Query: 302 TLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTIATTTIPALLDSGTTISY 358
            LYT+P+++   +     P++F +TL G+GV   ++D + +T+ TT IP LLDSGTTISY
Sbjct: 308 DLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISY 367

Query: 359 FPAQLANEIARKFNATYDSRSGFYTMSCSYDT-SNTNLVFDFGGFHITAPLDDF--VVQQ 415
            PA L   IA +  ATY    G+Y M C  +    ++L+FDFGGF+I   L +F  +   
Sbjct: 368 MPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDS 427

Query: 416 SSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTV 475
            S  C+L I PQ +  ++LGD FL + YVVYDL+N+E+SMA A+F S   E ++ I  +V
Sbjct: 428 RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSV 486

Query: 476 PSAVKAASYSNPWSSAVMMSTGGNIF 501
           PSA+KA  YS+ WS+   +  GGN+F
Sbjct: 487 PSALKAPGYSSTWSTYESIVPGGNMF 512

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  392 bits (1006), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 223/510 (43%), Positives = 301/510 (59%), Gaps = 64/510 (12%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L  RD  D Y L+++ NQ SFYSV+L+IGTPPQKVTVLVDTGSSDLWV G+DNP C+
Sbjct: 59  RTRLMTRD--DDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCS 116

Query: 62  SGRR---GKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESG 118
           + ++   G  F             +Q ++     VV     ++     I  S A      
Sbjct: 117 TKKKDTTGSSF-------------KQVNKDALASVVESVFTEISYDTTIVTSEA------ 157

Query: 119 WXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNT 178
                                      ++  D A   T   S   TF+        SNNT
Sbjct: 158 -----------------TATFDSTASTSQLIDCATYGTFNTSKSSTFN--------SNNT 192

Query: 179 AFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLS 238
            F+I+YGDT++ASG+WG D +S+N LN++G+SFAVAN +NS++GVLGIGLPGLE T    
Sbjct: 193 EFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLPGLESTYSGV 252

Query: 239 NTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSK 298
           + +S +K         Y Y NFPMVLKN G+I   AYSLF ND   + G++LFGAVDH K
Sbjct: 253 SLSSVQKS--------YTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHGK 304

Query: 299 YTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTIATTTIPALLDSGTT 355
           Y G LYT+P+++         P++F +TL GLG    DK+ + +T+ TT IP LLDSGTT
Sbjct: 305 YAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGTT 364

Query: 356 ISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT-SNTNLVFDFGGFHITAPLDDF--V 412
           ISY P +L   +A +  ATY S  G+Y M C  +    ++++FDFGGF+++  L DF  V
Sbjct: 365 ISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQLV 424

Query: 413 VQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVIS 472
               S  C+L I PQ +  ++LGD FL+N YVVYDL+N+E+SMAQANF S   E +E+I 
Sbjct: 425 TDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANF-SDDGEYIEIIE 483

Query: 473 STVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           S VPSA+KA  YS+ WS+   + +GGN+F+
Sbjct: 484 SAVPSALKAPGYSSTWSTYESIVSGGNMFS 513

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  384 bits (987), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 201/357 (56%), Positives = 255/357 (71%), Gaps = 10/357 (2%)

Query: 149 TDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSG 208
           +D  +   + CS +GTFD S SSTF +N TAF I YGD S+A G+WG DT+SI+ + +  
Sbjct: 115 SDDTSTTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDA 174

Query: 209 VSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDG 268
           +S AVAN SNSSMGV+G+GL GLE T   S+        A  S   YQYANFP+ LKN G
Sbjct: 175 LSLAVANSSNSSMGVIGLGLAGLETTYSSSH--------AVKSGQTYQYANFPLALKNAG 226

Query: 269 IIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLY 328
           I+   AYSL+LNDP+E  G++LFGAVDHS Y+G LYT+PLV+IY  S     VEFD+TL 
Sbjct: 227 IVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFDVTLN 286

Query: 329 GLG-VDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSC- 386
           G+G VD  GS +T++TT I ALLDSGTT++YFP Q  + +A +  A Y S +G+YT+SC 
Sbjct: 287 GIGIVDSSGSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCD 346

Query: 387 SYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVY 446
           +   + T LVFDFGGFHI A L DFVVQ  + TC L+I PQ  +  +LGD FL+NAYVVY
Sbjct: 347 AMQDTTTKLVFDFGGFHINATLADFVVQSGTSTCFLSIIPQNSSSAILGDTFLNNAYVVY 406

Query: 447 DLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           DL+NLE+SMAQA +D S  E +EVISS+VPSAVKA  YSN WS+ + +++GGNIFTV
Sbjct: 407 DLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSITSGGNIFTV 463

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 47/57 (82%), Gaps = 1/57 (1%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           L KRD +D Y  +++ NQ SFYSV++++GTP Q+VTVL+DTGSSD WVMG+DNP C+
Sbjct: 60  LVKRDGSD-YEEVELTNQQSFYSVEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCS 115

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  380 bits (977), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 219/500 (43%), Positives = 303/500 (60%), Gaps = 24/500 (4%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
             KRD  DG   + ++N+ +FYSVDLE+G+P QK+TVL+DTGSSDLW+ G+DNP C S  
Sbjct: 58  FVKRD--DGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNS 115

Query: 65  RG--KKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXX 122
               K+ +GD     +  +            +T+T G +P     + S+  D+ +G    
Sbjct: 116 HSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTGGSMPSSFGSFGSI--DVSTGGIEP 173

Query: 123 XXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAI 182
                                     + S+   ++ CS YGTFD ++SST+KSNNTAF I
Sbjct: 174 TETISGGGGGSGGS---------PTGSSSSGGQSIDCSRYGTFDKNQSSTYKSNNTAFEI 224

Query: 183 SYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTAS 242
           SYGD S+ASG WG D + +  LN+S VS AVAN +NS++GVLGIGLPGLE T        
Sbjct: 225 SYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYS------ 278

Query: 243 GKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGT 302
              D +  S   + Y+NFPMVLK  GI  K  YSL+LN P    GS+LFGAVD SK+ G+
Sbjct: 279 --SDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGS 336

Query: 303 LYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQ 362
           LYT+P++++Y     S+P++FD+TL GLG+    S +T++TT IPALLDSG+T++Y P  
Sbjct: 337 LYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQTSTTTLSTTKIPALLDSGSTLAYLPED 396

Query: 363 LANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVL 422
           L   +A    A +     +Y M C      T +VF+FGGF+I   L  +    SS TCVL
Sbjct: 397 LLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVL 456

Query: 423 AIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAA 482
            I P  ++  +LGD FL +AYVVYDLE+ E+SMAQANFD +  E +EV+SS++P A  AA
Sbjct: 457 RILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN-HEDIEVVSSSIPQATAAA 515

Query: 483 SYSNPWSSAVMMSTGGNIFT 502
            YS+ +SS+  +++GGNIF+
Sbjct: 516 GYSSTYSSSKSITSGGNIFS 535

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  379 bits (974), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 191/355 (53%), Positives = 252/355 (70%), Gaps = 11/355 (3%)

Query: 149 TDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSG 208
           +D ++++++ CS YGTFD   SS+F SN+T+FAI+YGD SYA G+WG D +S+  ++V+G
Sbjct: 132 SDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVTG 191

Query: 209 VSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDG 268
           +SFAVANY+NS++GVLGIGLP LE T       SG    + A S+ YQY N P+VL+N G
Sbjct: 192 LSFAVANYTNSTVGVLGIGLPSLEAT------YSG----SLAGSNPYQYDNLPLVLRNSG 241

Query: 269 IIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLY 328
            +   AYSLFLND    EGS+LFG VDHSKY GTL T+PLV+    S    P EFDITL 
Sbjct: 242 AVKSYAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQ 301

Query: 329 GLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSY 388
           GLG+      +T++ T I ALLDSGTT++Y P  L + +A + NA+Y +R G+YTMSC  
Sbjct: 302 GLGISTSSKNTTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPS 361

Query: 389 DTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDL 448
            + +T +VFDFGGFHI  PL  F+V  S   C+L I P+  +  +LGD FL +AYVVYDL
Sbjct: 362 SSDSTEIVFDFGGFHINVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDL 421

Query: 449 ENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           ENLE+S+AQA + SS  E +E I S+VPSAV+AASYSN WS+A  +++GG+IFTV
Sbjct: 422 ENLEISLAQAKYGSS-SEDIEAIVSSVPSAVRAASYSNTWSTAATINSGGDIFTV 475

 Score = 83.2 bits (204), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 5/78 (6%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           + KRD   GY  ++++N+ SFYS+ L IGTP Q VTVL+DTGSSDLWV G+DNPLC+S  
Sbjct: 70  IVKRD---GYEEIELKNESSFYSIKLSIGTPAQNVTVLIDTGSSDLWVTGSDNPLCSS-- 124

Query: 65  RGKKFLGDEGDARVEIEA 82
               F G +G ++  I+ 
Sbjct: 125 DDATFTGSDGSSQSSIDC 142

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  377 bits (967), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 191/356 (53%), Positives = 258/356 (72%), Gaps = 12/356 (3%)

Query: 150 DSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGV 209
           DS ++A V C+ +GTF+ S S T+ SN T+F+ISY D+SYASG+WG DT+ +  L+V+G+
Sbjct: 147 DSNSDA-VDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGL 205

Query: 210 SFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGI 269
           SFAVANY+NS++GVLGIGLP LEVT   SN  +G +         YQY NFP++LKN G 
Sbjct: 206 SFAVANYTNSTVGVLGIGLPSLEVTYSGSNNVAGTR---------YQYENFPLLLKNSGA 256

Query: 270 IHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYG 329
               AYSL+LND   + GSVLFG VDH+KY+GTLYT+PLV+    +  S+PVEFD+TL G
Sbjct: 257 TKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQG 316

Query: 330 LGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSY 388
           +G+ D +    T+ TT IPALLDSGTT+ Y P+ L + IA +++A Y+SR+G+Y M+C  
Sbjct: 317 MGISDDEHGNVTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPD 376

Query: 389 DTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDL 448
              ++ +VFDFGGFHI+  L  +++Q     CVL I PQ     +LGD FL +AYVVYDL
Sbjct: 377 SDEDSQIVFDFGGFHISTNLTTYIIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDL 436

Query: 449 ENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTVE 504
           +NLE+SMAQA+F++   E+VEVISS++PSAVKA  YS+ WS+   +S+GGNIFTV+
Sbjct: 437 DNLEISMAQASFETD-DENVEVISSSIPSAVKAPGYSSTWSTFSSISSGGNIFTVD 491

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 44/59 (74%), Gaps = 2/59 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASG 63
           + KRDN  G   +++ NQ +FYSV L IG+  Q VTVL+DTGSSDLWV G++NPLC+ G
Sbjct: 90  IVKRDN--GVEEVEIMNQSNFYSVSLSIGSNAQNVTVLLDTGSSDLWVTGSNNPLCSRG 146

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  373 bits (957), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 234/575 (40%), Positives = 306/575 (53%), Gaps = 89/575 (15%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           LA+R   D Y  +DV+NQ  +YSV+L +GTPPQ V+VL+DTGSSDLW+   DNP C   +
Sbjct: 45  LARR--ADDYLSVDVENQQLYYSVELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCIGFK 102

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
           +        G A+  +E +   E     V+T                A + E        
Sbjct: 103 Q-------PGSAKFALEEK---EAANATVLT----------------AQNAEG------- 129

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEAT------VQCSTYGTFDHSKSSTFKSNNT 178
                               P R++  AA+AT        C+  GTF++S+SS+FKSNNT
Sbjct: 130 --------------------PTRSS-KAAKATGGHLDQFDCALLGTFNNSESSSFKSNNT 168

Query: 179 AFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLS 238
            F   Y D ++ASG WG D + I  ++VS VS AV N +NS+  VLGIG+P LE +N   
Sbjct: 169 DFLTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSN--- 225

Query: 239 NTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSK 298
              +G+  +AA ++S Y+Y NFP+ LKN G+I K+AYSLFLND    EGSVLFGAVDHSK
Sbjct: 226 ---AGR--LAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSK 280

Query: 299 YTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISY 358
           Y   L+TVP+V+ Y D     P+EF +T+YGLG  KDG  +TI TT  P LLDSG+T SY
Sbjct: 281 YENGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTITTTNFPVLLDSGSTTSY 340

Query: 359 FPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ 418
            P  L + +A   NAT+  +   YT+ C  +   T L FD GGF I  PL D V ++   
Sbjct: 341 LPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLIDVPLSDLVAKRHKN 400

Query: 419 TCVLAIGPQ--QENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVP 476
            CVL +  Q   E   +LGD FLS+AYVVYDLE+ E+S+ QA+   +  E +EVI STVP
Sbjct: 401 QCVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQASTGDA-AEDIEVIKSTVP 459

Query: 477 SAVKAASYSNPWSSAVMMSTGGNIFTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 536
            AV+A  Y  PW+   ++S  GNI T                                  
Sbjct: 460 GAVRAPFYDRPWTGGTVISMSGNIST--------------GPINGSYNGMGATKPRNSSS 505

Query: 537 XXXXXTNQRKNAGAIV--LPSFSTAIFTFIASFLL 569
                 N RKN G     +PS  TAI   I SFLL
Sbjct: 506 STTLSGNVRKNIGVASAGMPSLVTAILALIMSFLL 540

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  365 bits (938), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 186/354 (52%), Positives = 255/354 (72%), Gaps = 12/354 (3%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           A+EAT+ C  +GTF  S SSTF+SNNT F+ISYGD ++ASG++G D + ++ LNV+G+SF
Sbjct: 179 ASEATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSF 238

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           AVAN +NS+MGVLGIGLP LEVT   S  +S ++         Y Y NFPMVLKN G I 
Sbjct: 239 AVANETNSTMGVLGIGLPELEVTYSGSTASSSRRP--------YTYDNFPMVLKNSGAIK 290

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
             AYSL+LND   + G++LFGAVDHSKY GTLYTVP+V+    S  S P++FD+T+ G+G
Sbjct: 291 TNAYSLYLNDSDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIG 350

Query: 332 VD-KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390
           +   D SQ T+ TT IPALLDSGTT++Y P  +   IA + +A Y SR G+Y + C  ++
Sbjct: 351 ISYPDNSQKTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNS 410

Query: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
           ++T +VFDFGGFHI A L  F++  +   C+L I    ++  +LGD FL+NAYVVYDL+N
Sbjct: 411 NSTQIVFDFGGFHINASLSSFIL-NAGNICLLGI-IATDDTTILGDSFLTNAYVVYDLDN 468

Query: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTVE 504
           LE+SMAQA ++ +  E++EVI+S++PSA+KA  Y++ WS++  + TGGNIFTV+
Sbjct: 469 LEISMAQAQYNIT-NENIEVITSSIPSAIKAPGYTSTWSTSASIVTGGNIFTVD 521

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/56 (69%), Positives = 45/56 (80%), Gaps = 2/56 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           L KR   DGY  + + NQ SFYSVDLE+GTPPQ VTVLVDTGSSDLW+MG++NP C
Sbjct: 64  LLKR--ADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYC 117

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  355 bits (912), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 184/350 (52%), Positives = 238/350 (68%), Gaps = 11/350 (3%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAV 213
           + + C  YG FD +KSSTFK+N ++ F  +YGD +YA G++G D +  N+L++SG+SFAV
Sbjct: 99  SVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAV 158

Query: 214 ANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
           AN SNS+ GVLGIGL  LEVT       SGK  +A      Y+Y NFP+ LK+ G I   
Sbjct: 159 ANESNSTFGVLGIGLSTLEVT------YSGK--VAIMDKRSYEYDNFPLFLKHSGAIDAT 210

Query: 274 AYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD 333
           AYSLFLND  +  GS+LFGAVDHSKY G LYT+PLV++Y       PV FD+TL GLG+ 
Sbjct: 211 AYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQ 270

Query: 334 KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNT 393
            D    T+ TT +PALLDSGTT++Y P+Q    +A+  NA+Y    G+Y  +C    + T
Sbjct: 271 TDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKT 330

Query: 394 NLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENLE 452
           ++ FDFGGF I APL DF +Q S  TCVLAI PQ  N   +LGD FL NAYVVYDL+N E
Sbjct: 331 SVAFDFGGFRINAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYE 390

Query: 453 VSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           +S+AQA + +   E+VEVI STVPSA++A SY+N WS+    ++GGNIFT
Sbjct: 391 ISLAQAKYGTG-KENVEVIKSTVPSAIRAPSYNNTWSNYASATSGGNIFT 439

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/58 (56%), Positives = 41/58 (70%), Gaps = 2/58 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
          L+KR N  G+    + N+ SFYSV+L IGTP Q +TVL+DTGS+DLWV G  NP C S
Sbjct: 44 LSKRSN--GHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  357 bits (917), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/521 (40%), Positives = 294/521 (56%), Gaps = 72/521 (13%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KR+  DG+ ++++QNQ +FYSVDL +GTPPQKVTVLVDTGSSDLWV G +NP C  G 
Sbjct: 60  LVKRE--DGHEIIEIQNQQAFYSVDLMLGTPPQKVTVLVDTGSSDLWVTGNNNPYCIDGT 117

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLG--------DLPPGGNIWNSVAGDLE 116
             K        + +E ++Q K+    + VV  T+         +LP    + +S +G   
Sbjct: 118 SSKAV-----SSNIEDDSQTKNP--ISKVVGTTINKIRKYFSHNLPDLSFLEDSGSGKYN 170

Query: 117 SGWXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSN 176
           S                                 +  +A + CSTYGTFD SKSSTF SN
Sbjct: 171 SSQLKDV---------------------------TPQDAHIDCSTYGTFDPSKSSTFVSN 203

Query: 177 NTAFAISYGDTSYASGSWGIDTMSI-NKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTN 235
           +T F I YGD ++ASG+WG D++   + LN++  SF VA+ +NS++ VLG+GLP LEVT 
Sbjct: 204 DTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTISVLGMGLPRLEVT- 262

Query: 236 QLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVD 295
                 SG     +   S Y YANFPM LK  G+I ++ YSL+LN      GSVLFGAVD
Sbjct: 263 -----YSG----LSLDRSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFGAVD 313

Query: 296 HSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV--DKDGSQSTIATTTIPALLDSG 353
           HSKY G+L T+PL+ +   S S  P+ F++ L GLG+  D  G+Q T  +T +PALLDSG
Sbjct: 314 HSKYHGSLNTIPLISL---SGSGIPIAFNVALQGLGMSSDSQGTQ-TFLSTPLPALLDSG 369

Query: 354 TTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV 413
           TT++Y P  L   +A    A++D   G Y + C   + +    FDFGGF I+ PL +F++
Sbjct: 370 TTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFGGFQISVPLSNFIL 429

Query: 414 QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESV----- 468
           +     CVL +        +LGD FL+ AYVVYDLENLE+SMAQA +D      +     
Sbjct: 430 EALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEKYNA 489

Query: 469 ------EVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
                 EV++S +PSA +A  YS+   +   +   GN++ V
Sbjct: 490 DNKVLLEVVTSNIPSANQAPGYSSTLINRSTIQPSGNMYAV 530

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  353 bits (905), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 198/500 (39%), Positives = 295/500 (59%), Gaps = 68/500 (13%)

Query: 3   EWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           E L+KRD    +   D++N+ +FYS+ L +GTP Q+V VL+DTGSSDLW+ G+DNP C  
Sbjct: 54  EELSKRDKDVTF---DLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKE 110

Query: 63  GRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXX 122
                        +   I  Q K+        T+      PGG    +++G         
Sbjct: 111 ------------SSSFSISNQGKENGAEGPFQTL------PGGVTATNMSGG-------- 144

Query: 123 XXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAI 182
                                       S A AT+ C  +GTF+   S TF SN+T F++
Sbjct: 145 ----------------------------STASATLDCKEFGTFNREDSKTFHSNDTEFSV 176

Query: 183 SYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTAS 242
           SYGDTSYA G+WG D+++IN +N++ VS  VAN +NSS+G++GIGL  LE      NT +
Sbjct: 177 SYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLE------NTYT 230

Query: 243 GKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGT 302
           G +++   ++  ++Y NFPM+LK  G I K  YSLFLN  +  EGS+LFGAVDHSKY+G 
Sbjct: 231 GVENVKNRNT--HKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQ 288

Query: 303 LYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQ 362
           LYTVP++++Y       P++  +TL G+G++ +   +T +TT +PALLDSGTT+ Y P +
Sbjct: 289 LYTVPMLNLYQQQGLKDPLQLQVTLQGVGIEANNMTNTTSTTPVPALLDSGTTLVYLPDK 348

Query: 363 LANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ-TCV 421
           +   +A + NA +D   G+Y   CS    NTNL F+FGGF+I + +  +VV +S++ +CV
Sbjct: 349 MLAMLAEQLNAHWDRGIGYYVTDCS-RVDNTNLYFNFGGFNIVSNMSTYVVSRSNENSCV 407

Query: 422 LAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKA 481
           L + P      +LGD+F+ +AY+V+DL++ E+SMAQAN+       +E ++  VPSA+KA
Sbjct: 408 LGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGG-KNQLEAVTQQVPSAMKA 466

Query: 482 ASYSNPWSSAVMMSTGGNIF 501
             YS+ +S +  ++ GGNIF
Sbjct: 467 PGYSHTFSGSQGITGGGNIF 486

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  352 bits (902), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/349 (51%), Positives = 236/349 (67%), Gaps = 12/349 (3%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           + C  YG FD +KSSTFK+N ++ F  +YGD ++A G++G D +  N L++SG+SFAVAN
Sbjct: 101 MDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVAN 160

Query: 216 YSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAY 275
            SNS+ GVLGIGLP LEVT       SGK  +A      Y+Y NFP+ LK  G I   AY
Sbjct: 161 ESNSTFGVLGIGLPALEVT------YSGK--VAVVDKKSYEYDNFPLFLKRSGAIDATAY 212

Query: 276 SLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKD 335
           SLFLND  +  GS+LFGAVDHSKY G LYTVPLV++Y       PV FD+TL+G+G+  D
Sbjct: 213 SLFLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTD 272

Query: 336 GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNL 395
              +T+  T IPALLDSGTT++Y P+Q    +A+  NATY    G+Y  +C    ++T++
Sbjct: 273 RHNTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSV 332

Query: 396 VFDFGGFHITAPLDDFVVQQS-SQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENLEV 453
            FDFGGFHI AP+ DF +Q S   TCVLA+ PQ  N   +LGD FL NAYVVYDL+N EV
Sbjct: 333 AFDFGGFHINAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEV 392

Query: 454 SMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           S+AQA + +   E +E I STVPSA +A  Y++ WS+   +++GGNIFT
Sbjct: 393 SLAQAKYGTG-AEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGNIFT 440

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 2/58 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
          L KR N  G+    + N+ SFYSV+L IGTP Q +TVL+DTGS+DLWV    NP C S
Sbjct: 44 LGKRSN--GHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGS 99

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  352 bits (904), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 214/504 (42%), Positives = 280/504 (55%), Gaps = 65/504 (12%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L KRD    Y+ +++  +  +Y V L +GTP Q VT+LVDT SSD+WV   DNPLC 
Sbjct: 53  RLPLQKRDT---YATVNISAEF-YYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLC- 107

Query: 62  SGRRGKKFLGD-EGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWX 120
               G  F  + E  A+  + A  ++  V+ G     L   P     + S          
Sbjct: 108 ---DGDIFYDNVEKTAKHVVVAAAEESTVSDGDSNGLLDGEPVSTTPFES---------- 154

Query: 121 XXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAF 180
                                   PA       E  V C  +GTF+ + SST+ +N+T F
Sbjct: 155 --------------------SVIYPA-------EGLVDCGFFGTFNPNDSSTWSTNHTDF 187

Query: 181 AISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNT 240
            I+Y D S A G WG D +SI  L++SGV FAVANY+NSS+GVLGIGLPG E T  L+N+
Sbjct: 188 VITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNSSLGVLGIGLPGSETT-YLTNS 246

Query: 241 ASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYT 300
                         Y Y N PMVLK  G+I   AYSL L         +LFGAVDHSKY+
Sbjct: 247 --------------YMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGLLFGAVDHSKYS 292

Query: 301 GTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFP 360
           G+LYT+P+++IY       PVEFD+T+YGLG+    S +TIAT   PALLDSG+T  +FP
Sbjct: 293 GSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTTIATMKTPALLDSGSTAIFFP 352

Query: 361 AQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV-VQQSSQT 419
             L N  A + NATY    G YT+   Y  +N + VFDFGGFHI  P+ +   V      
Sbjct: 353 TTLLNLAAEQLNATYSEEKGLYTI--PYSPANISFVFDFGGFHINLPIRELCSVSYGEPE 410

Query: 420 CVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAV 479
            +L I    EN +VLG+ FL+ AYVV+D EN E+SM Q+++D +  E +E I STVP AV
Sbjct: 411 YILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYDYA-EEDIEAIISTVPGAV 469

Query: 480 KAASYSNPWSSAVMMSTGGNIFTV 503
           K ASYSN WSS   +++GG+IFT+
Sbjct: 470 KVASYSNSWSSFGSITSGGDIFTI 493

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  352 bits (904), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 297/509 (58%), Gaps = 49/509 (9%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L  R+N + ++ + V+NQ +FYSVDL +GTP Q +TVL+DTGSSDLW+   +NP C 
Sbjct: 49  RRSLETRNNKE-FNFI-VENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWLTAKNNPYCK 106

Query: 62  S--GRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGN-IWNSVAGDLESG 118
           S  G   KK      D R+E    Q    + + +     G  P GG+ I  +++G  +  
Sbjct: 107 SNAGSNDKK-----EDYRLEDGDNQS---IVSMLTASGTGTNPIGGSGIPTAISGSAQ-- 156

Query: 119 WXXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNT 178
                                         + S+ E T+ CS YGTFD +KS +F+SN T
Sbjct: 157 -----------------LTGTYTSGTGTGPSGSSPEPTMDCSQYGTFDVNKSKSFRSNKT 199

Query: 179 AFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLS 238
            F ISYGD S+ASG WG D+++   +N+ GVSFAVAN +NS++GV GIGLP         
Sbjct: 200 EFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNSTVGVFGIGLP--------E 251

Query: 239 NTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSK 298
           N A+   D +      Y+Y NFP VLK+ G I+K AYSLFLN      G +LFGAVD SK
Sbjct: 252 NEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGDILFGAVDRSK 311

Query: 299 YTGTLYTVPLVDIYHDSASSK-PVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTIS 357
           Y G LYT+PL++   D    K P+EFD+TL G+G     S++T  TT IPALLDSGT++ 
Sbjct: 312 YKGDLYTLPLLN--SDPTKYKNPMEFDVTLQGVGFTNGSSKTTFTTTKIPALLDSGTSLI 369

Query: 358 YFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV---- 413
           Y P  LA  IA K   +Y+   G+Y + C  +  ++ LVFDFGGF I   L ++++    
Sbjct: 370 YLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSNYLLGSPD 429

Query: 414 QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISS 473
                 CVL I P  +   +LGDVFL++AYVVYDL++ EVS+AQA+FD+S  E +++IS 
Sbjct: 430 DGDDSQCVLGILP-SDVQAILGDVFLADAYVVYDLDDYEVSLAQASFDNS-KEDIQIISD 487

Query: 474 TVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           ++P A +A  YS  WS+   + +GGNIFT
Sbjct: 488 SIPGAKRAPGYSKTWSTPASIKSGGNIFT 516

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  354 bits (908), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 193/351 (54%), Positives = 249/351 (70%), Gaps = 13/351 (3%)

Query: 153 AEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSI-NKLNVSGVSF 211
           ++AT+ C TYGTFD   SSTF+SN T+FAI Y DTSYA+G WG D ++  + LNV+G+SF
Sbjct: 257 SQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSF 316

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           AVAN +NS++GVLGIGLP LEVT       SG       S+  Y Y NFP+VLKN G IH
Sbjct: 317 AVANQTNSTVGVLGIGLPQLEVT------YSG----VYQSTKPYIYDNFPLVLKNSGAIH 366

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFDITLYGL 330
           K  YSL+LN    + G+VLFGAVDHS+Y G TLYTVPLV+    S  S P+EFDITL GL
Sbjct: 367 KSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGL 426

Query: 331 GVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390
           GV  + +  T+ TT I ALLDSGTT++YFP  + N +A+  NA+Y    G+Y M+C    
Sbjct: 427 GVTDNTNNYTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSD 486

Query: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
            NT +VFDFGGFHI A L +FV+  +S  CVL + P   N  +LGD+FL++AYVVY+L++
Sbjct: 487 DNTQIVFDFGGFHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDD 546

Query: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIF 501
           LE+SMAQAN+D+S  E +EVI+STVP+AVKA  YS  +S++  + +GGNIF
Sbjct: 547 LEISMAQANYDNS-NEDIEVITSTVPNAVKAPGYSYTYSTSKSIVSGGNIF 596

 Score = 79.3 bits (194), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/58 (65%), Positives = 44/58 (75%), Gaps = 2/58 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           L KR+  DGY  + + NQ SFYSV+L IGTP Q +TVLVDTGSSDLWV G+DNP C S
Sbjct: 88  LIKRN--DGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYCKS 143

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  347 bits (890), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/350 (50%), Positives = 233/350 (66%), Gaps = 11/350 (3%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAV 213
           + + C  YG FD SKSSTFK+N ++ F  +YGD ++A G++G D +  N L++SG+ FAV
Sbjct: 99  SVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSGLPFAV 158

Query: 214 ANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
           AN SNS+ GVLGIGL  LEVT       SGK  +A      Y+Y NFP+ LK+ G I   
Sbjct: 159 ANESNSTFGVLGIGLSTLEVT------YSGK--VAVMDKRSYEYDNFPLFLKHSGAIDAT 210

Query: 274 AYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD 333
           AYSLFLND  +  GS+LFGAVDHSKY G LYT+PLV++Y       PV FD+TL GLG+ 
Sbjct: 211 AYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQ 270

Query: 334 KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNT 393
            D   +T+ TT  PALLDSGTT++Y P+Q    +A+  NA+Y    G+Y  +C    + T
Sbjct: 271 TDKRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKT 330

Query: 394 NLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENLE 452
           ++ FDFGGF I APL DF +Q S  TC LA+ PQ  N   +LGD FL NAYVVYDL+N E
Sbjct: 331 SIAFDFGGFRINAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYE 390

Query: 453 VSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           +S+AQA +  +  E++E I STVP A +A SY+N WS+   +++GGNIFT
Sbjct: 391 ISLAQAKYGKA-KENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIFT 439

 Score = 66.2 bits (160), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 2/58 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
          L+KR  + G+    + N+ SFYSV+L IGTP Q +TVL+DTGS+DLWV G  NP C S
Sbjct: 44 LSKR--SSGHENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  352 bits (904), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 241/348 (69%), Gaps = 13/348 (3%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSI-NKLNVSGVSFAVAN 215
           + C  YGTFD   SST++SN T FAI Y DTS+ASG WG D ++  + LNV+G+SFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 216 YSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAY 275
            +NS++GVLGIGLP LEVT       +G       ++  Y Y NFP+VLKN G IHK AY
Sbjct: 342 QTNSTVGVLGIGLPQLEVT------YAG----VYQTTKPYTYDNFPLVLKNSGAIHKSAY 391

Query: 276 SLFLNDPQEQEGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFDITLYGLGV-D 333
           SL+LN    + G+VLFGA+DHS+Y G TLYT+PLV+    S  SKP+EFD+TL GLGV D
Sbjct: 392 SLYLNKQSAKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSD 451

Query: 334 KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNT 393
                 T+ TT I ALLDSGTT++YFP  + N +A++ NA+Y    G+Y M+C     NT
Sbjct: 452 NRNGNFTVTTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNT 511

Query: 394 NLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEV 453
            LVFDFGGFHI   L +FV+  +S  CVL + P   N  +LGD+FL++AYVVY+L++LE+
Sbjct: 512 QLVFDFGGFHIKTNLTNFVLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEI 571

Query: 454 SMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIF 501
           SMAQANF++   E +EVISST+P+AVKA  YS  +S +  +  GG+IF
Sbjct: 572 SMAQANFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIF 619

 Score = 78.2 bits (191), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/63 (61%), Positives = 46/63 (73%), Gaps = 3/63 (4%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KR   DGY  + + NQ SFYSV+L+IGTP Q +TVLVDTGSSDLWV G++NP C  G 
Sbjct: 81  LIKRH--DGYEKIQIINQQSFYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCK-GN 137

Query: 65  RGK 67
            GK
Sbjct: 138 SGK 140

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  349 bits (896), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 183/352 (51%), Positives = 248/352 (70%), Gaps = 14/352 (3%)

Query: 154 EATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSIN-KLNVSGVSFA 212
           + T+ CSTYGTFD SKSSTF+SN+T F ISYGD S+A G+WG D + ++  L+++ VS A
Sbjct: 127 QDTIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSVA 186

Query: 213 VANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
           VA+ +NSSMGVLGIGL  LE T       S  K +   +S  Y Y NFP+ LK  G+I  
Sbjct: 187 VASSTNSSMGVLGIGLRPLETT------YSSTKSVNEKTS--YMYDNFPISLKKSGLIES 238

Query: 273 VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
            AYSL+LNDP  + G++LFG VDHSKYTG LYTVP++     ++   PVEFD+TL G+G+
Sbjct: 239 TAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLS--STTSYKTPVEFDVTLNGIGI 296

Query: 333 -DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS-YDT 390
            D  G++ T+  T    LLDSGTT SY P+ L   I  +  A+YDS  G+YT+ CS  D+
Sbjct: 297 IDSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDS 356

Query: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
            +T +VFD GGFHI   L DFV+Q S+ TC+L+I PQ +  VVLGD FL+NAY+VYDL+N
Sbjct: 357 DDTKIVFDMGGFHINTTLSDFVIQISTSTCILSIVPQ-DGKVVLGDSFLNNAYIVYDLDN 415

Query: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
            E++MAQA +DS+   +++VIS+T+PSA++A  YS+ WS++  +S+GG+IFT
Sbjct: 416 YEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRSISSGGDIFT 467

 Score = 77.0 bits (188), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 37/69 (53%), Positives = 46/69 (66%), Gaps = 2/69 (2%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           L KRD  DGY  + + NQ SFYSV++E+GTP QK+TVL+DTGSSD WV  +DNP C +  
Sbjct: 59  LIKRD--DGYEQVTLTNQQSFYSVEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTS 116

Query: 65  RGKKFLGDE 73
                 G E
Sbjct: 117 TEGSLYGGE 125

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  336 bits (861), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 172/356 (48%), Positives = 243/356 (68%), Gaps = 23/356 (6%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTA--FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
           V CS YGTF    SST+  N++A  F I+YGDT++ASG WG D + +  +NV+GVSFAVA
Sbjct: 117 VDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVA 176

Query: 215 NYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
           N +NS++GV+GIGLPGLE TN      SG +         Y YANFP VLKN G      
Sbjct: 177 NRTNSTVGVMGIGLPGLETTN------SGSRP--------YTYANFPQVLKNSGATQSAL 222

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV-- 332
           YSL+LND +E+ GS+LFGAVDHSKYTG++YT+P+++       + P++FDITL G+G+  
Sbjct: 223 YSLYLNDLEEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSS 282

Query: 333 -DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
            + +G + TI +T +PALLDSGTT++Y P+ + ++IA++  A+  +R G Y + CS    
Sbjct: 283 SESNGDEVTITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPE 342

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           N +LV+DFGGFHI + L +++VQ S   C+L + P+  N  +LGD FL++AYVVYDLENL
Sbjct: 343 NMHLVYDFGGFHINSNLTNYIVQASQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLENL 402

Query: 452 EVSMAQANF---DSSLPESVEVISSTVPSAVKAASYSNPWSSAV-MMSTGGNIFTV 503
           ++ +AQA F   DS     +   S+ +PSA +A  YS+ WS++V  ++TGGNIFT+
Sbjct: 403 QIGLAQAKFGVSDSDAKIDIVTGSAGIPSAQRAPDYSSTWSTSVGTVTTGGNIFTL 458

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 45/60 (75%), Gaps = 4/60 (6%)

Query: 1   MREWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           MR  LAKR+   GY  + + NQ SF+SV+L++GTP Q VTVLVDTGSSDLW+ G DNP C
Sbjct: 45  MR--LAKRNT--GYEEITLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGADNPYC 100

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  335 bits (858), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 179/348 (51%), Positives = 237/348 (68%), Gaps = 16/348 (4%)

Query: 158 QCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYS 217
            CS YGTF+ +KSST+ SNN+ F I YGDT++ASG+WG D MSIN LNV+G++FAVAN S
Sbjct: 142 NCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANAS 201

Query: 218 NSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSL 277
           NSS  VLGIGL  LE T   SN           SS  Y YANFP+VLKN G+   ++YSL
Sbjct: 202 NSSNSVLGIGLTQLETTYNGSN-----------SSHSYTYANFPVVLKNAGLTESISYSL 250

Query: 278 FLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGS 337
           FLN+   + GS+LFGAVDHSKY+G LYT+PLV+ Y D     P+EF +TL G+G+     
Sbjct: 251 FLNELDAESGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSK 310

Query: 338 QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSY-DTSNTNLV 396
           ++TI  T + A+LDSGT+++  P  + + IA   N  Y      Y +SCS  +++NTNLV
Sbjct: 311 KTTITQTKLAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLV 370

Query: 397 FDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMA 456
           FDFGGF I   L +F+++     C+L +    EN V+LGD FL++AYVVYDLENL++SMA
Sbjct: 371 FDFGGFTIKGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMA 430

Query: 457 QANFDSSLPESVEVI--SSTVPSAVKAASYSNPWSSA-VMMSTGGNIF 501
           QA FD+S  + ++VI  +S VPSA+KA  YS+ W++    +STGGNIF
Sbjct: 431 QAKFDNSTSD-IDVIRGNSGVPSAIKAPGYSSTWTATPSSISTGGNIF 477

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 44/56 (78%), Gaps = 1/56 (1%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           L KR ++D Y  ++++NQ SFYS+DL IGTP Q VTV +DTGSSDLWV G++NP C
Sbjct: 72  LYKRASSD-YQELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC 126

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  334 bits (857), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 176/347 (50%), Positives = 232/347 (66%), Gaps = 12/347 (3%)

Query: 146 ARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLN 205
           A ++ ++  ATV CS YGTFD SKS++F+SNNTAF+ISYGDT++ASG+WG D   +  LN
Sbjct: 134 ATSSGNSGIATVDCSEYGTFDPSKSTSFRSNNTAFSISYGDTTFASGTWGTDNFDLGDLN 193

Query: 206 VSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLK 265
           V+ +SFAVAN SNS++GV+GIGL GL+ T            + +ASS  YQY NFPM LK
Sbjct: 194 VTNLSFAVANQSNSTVGVMGIGLAGLQST---------YVGVNSASSGAYQYENFPMALK 244

Query: 266 NDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDI 325
           + GII + AYSLFLN+P   +GSVLFGAVDHSKY+G LYTVP++++Y +     P+EFD+
Sbjct: 245 SQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDV 304

Query: 326 TLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMS 385
           T+ G+ V    +   +  T  PALLDSGTT+SY P  L   IA    A Y   +G+Y+M 
Sbjct: 305 TVQGVSVTSGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMR 364

Query: 386 CSYDTSNTNLVFDFGGFHI--TAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAY 443
           C  + ++T L FDFGGF I           + SS TC L + P   N  + GD FL +AY
Sbjct: 365 CPSENNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAY 424

Query: 444 VVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS 490
           VVYDLEN E+SMAQA F++S    +EVIS ++PSAV+A  YS+ WS+
Sbjct: 425 VVYDLENYEISMAQAAFNNS-DSQIEVISDSIPSAVRAQGYSSTWST 470

 Score = 75.5 bits (184), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/56 (60%), Positives = 43/56 (76%), Gaps = 2/56 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           L KRD  DGY  +++ N+ +FYS++LEIGTP Q VTVL+DTGSSDLWV   +NP C
Sbjct: 57  LRKRD--DGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC 110

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 213/565 (37%), Positives = 296/565 (52%), Gaps = 62/565 (10%)

Query: 14  YSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKK----- 68
           Y  + + NQ++FYSV+L+IGTP QKVTV+VDTGSSDLW+  T NP C++G    +     
Sbjct: 85  YEDVILTNQLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWS 144

Query: 69  --FLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXXXX 126
              L D+ D RV    + K +  T+  VT T       G+I  +++ DL S +       
Sbjct: 145 PFLLKDKIDPRV---LKHKGKRTTSIDVTAT----ATTGSI--NISIDLGSNFTL----- 190

Query: 127 XXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGD 186
                                      E  + C+ +GTF+  KSSTFK+N+T F ISYGD
Sbjct: 191 -------------------------PPEFLINCTEFGTFNTKKSSTFKNNHTDFFISYGD 225

Query: 187 TSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKD 246
            ++ASG WG D +S   +NV+G+SF VAN +NS++GVLGIGLP LE      +T  G   
Sbjct: 226 NTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELE------STYFGT-- 277

Query: 247 IAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTV 306
           + + + S Y Y NFP VLKN GII+K AYSLFLN     +GS+L GAVD SK+   LYTV
Sbjct: 278 VNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTV 337

Query: 307 PLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANE 366
           P+++I      + P  F + +  +   K G    + ++ IP LLDSGTT+ Y P  +  +
Sbjct: 338 PMLNINPSKGYTDPSAFLVLMQKMTRYKYGQGHLVPSSRIPVLLDSGTTMVYLPRSIVEQ 397

Query: 367 IARKFNATYDSRSGFYTMSCSY--DTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAI 424
           I R   A Y      Y + C      + T+  FDFGGF I A L DF+V   +  C+  +
Sbjct: 398 IMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDNGQCIFGM 457

Query: 425 GPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASY 484
            PQ  N  +LGD FL++AYVVYDLE+ E+SMAQA +D   P  + ++ STVPSAV+A  Y
Sbjct: 458 IPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDGGEPNYIPIV-STVPSAVRAKYY 516

Query: 485 SNPWSSAVMMSTGGNIFTVEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNQ 544
                SA  + +G  I +                                         +
Sbjct: 517 -----SATDLPSGFAIDSYNNTSKRPKDKTTFSVQADLRNTISGDITTTIEEDSAKTETK 571

Query: 545 RKNAGAIVLPSFSTAIFTFIASFLL 569
             NAG   +P++S+ IFTF+ S L+
Sbjct: 572 HSNAGVATVPTYSSIIFTFLLSILI 596

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  332 bits (850), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 233/348 (66%), Gaps = 16/348 (4%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C  YG FD SKSS++K+N+T F ISYGDTS+ASG WG D + +  LN  G++FAVA  
Sbjct: 120 LDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVATA 179

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           SNSS+ VLGIGL G+EVT      ASG           Y+Y N P+VLK +G+I K AYS
Sbjct: 180 SNSSVAVLGIGLTGIEVTR-----ASGDNG--------YEYDNLPIVLKRNGVIDKTAYS 226

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDG 336
           L+LND     GSVLFGAVDHSKYTGTL TVPLV++       KP+E  ITL GLG     
Sbjct: 227 LYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGK 286

Query: 337 SQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSY-DTSNTNL 395
            + TI+ T +PALLDSGTT+SYFP +LA  IA    A +++R   + + CS    +N +L
Sbjct: 287 KRGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDL 346

Query: 396 VFDFGGFHITAPLDDFVVQQSSQ-TCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVS 454
           +++FGG  IT+PL +++ + + +  C+L I P   N ++LGDVFL++ Y VYDLE LEVS
Sbjct: 347 IYNFGGVEITSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVS 406

Query: 455 MAQANFDSSL-PESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIF 501
           +AQA + +S   E++EVI STVP A KA  YSN WS+   +STGGN+F
Sbjct: 407 IAQAAYGASAEKENIEVIKSTVPGATKAPGYSNTWSTYAPISTGGNMF 454

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/52 (61%), Positives = 40/52 (76%), Gaps = 2/52 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD 56
           L KRD  D Y  + + N+ +FYSV+L IGTP Q+VTVLVDTGSSDLW++G D
Sbjct: 57  LKKRD--DEYVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGAD 106

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  331 bits (849), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/350 (52%), Positives = 244/350 (69%), Gaps = 13/350 (3%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
           AT+ CS +GTFD SKSS+++SN+T F ISY D ++A G WG+D + ++ +NV+G+SFAV+
Sbjct: 187 ATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTGLSFAVS 246

Query: 215 NYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
           NY++S  GVLGIGL G E      +T SG+     ++ + YQY NFP+VL+ +G+I K A
Sbjct: 247 NYTDSQFGVLGIGLTGSE------STYSGQ----LSTYNRYQYDNFPIVLQRNGVIEKNA 296

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK 334
           YS+FLND     GS+LFGAVDHSKYTGTLYTVP+V+       ++ +   ITL G+GV  
Sbjct: 297 YSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTS 356

Query: 335 DGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTN 394
                T+  T  PALLD+G T  YFP+ LA  IA   +ATY S SG+Y + C    S+ +
Sbjct: 357 SYGNETVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCD-SGSDYD 415

Query: 395 LVFDFGGFHITAPLDDFVVQQSSQT-CVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEV 453
           LVFDFGGFHI +PL D++V  SS + CVL I PQ +N + LGD FL++AYVVYDLE LE+
Sbjct: 416 LVFDFGGFHIISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEI 475

Query: 454 SMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           S+AQA++ S   E +EVI  +VPSAV A  YS+ WS+A  +STGGNIFTV
Sbjct: 476 SLAQASYTSG-DEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIFTV 524

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 43/56 (76%), Gaps = 2/56 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           L KR   DGY  +++ NQ +FYSVDLEIGTP QKV VL+DTGSSDLWV G+ NP C
Sbjct: 62  LKKR--ADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFC 115

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  335 bits (858), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 181/350 (51%), Positives = 232/350 (66%), Gaps = 13/350 (3%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINK-LNVSGVSFAVA 214
           + C  YG FD + SSTF +N++A F  SYGD ++A G +G D +  +  L++SG+SFAVA
Sbjct: 102 MNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAVA 161

Query: 215 NYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
           N SNS++GVLGIGLP LEVT       SGK  +A A    YQY NFP+ LK  G I   A
Sbjct: 162 NKSNSTVGVLGIGLPMLEVT------YSGK--VAVADKRSYQYDNFPLFLKRSGAIDATA 213

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK 334
           YSLFLND  +  GSVLFGAVDHSKY G LYT+PLV++Y      +PV FD+TL GLG+  
Sbjct: 214 YSLFLNDETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQT 273

Query: 335 DGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN-T 393
               +T+ TT IPALLDSGTT++Y PA     +A+  NAT+    G+Y  +C     N T
Sbjct: 274 RAHNTTLTTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNAT 333

Query: 394 NLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENLE 452
           ++VFD GGFHI APL DF +Q +  TCVLAI PQ  N   +LGD FL +AYVVYDL+N E
Sbjct: 334 SVVFDLGGFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYE 393

Query: 453 VSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           VS+AQA + S   E +E I S+VP A +A  Y++ W +   +++GGNIFT
Sbjct: 394 VSLAQAKYGSG-KEDIEAIRSSVPGATRAPGYNSTWVNYASVTSGGNIFT 442

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/71 (47%), Positives = 41/71 (57%), Gaps = 9/71 (12%)

Query: 1   MREWLAKRDNTDGYSLMD---------VQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLW 51
           +R   AKR N  G  L           + N+ SFYSV+L +GTP Q VTVL+DTGS+DLW
Sbjct: 30  VRIPFAKRQNGPGSELGKRAGGDENFVLSNEQSFYSVELALGTPSQNVTVLLDTGSADLW 89

Query: 52  VMGTDNPLCAS 62
           V    NP C S
Sbjct: 90  VPSNANPYCGS 100

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  318 bits (816), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 165/366 (45%), Positives = 230/366 (62%), Gaps = 26/366 (7%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           + + T+ C+ YGTFD+SKSS+FK+N+++  I YGD SYA G +G DT+ +N L++  VS 
Sbjct: 126 SPQPTIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSL 185

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQ-LSNTASGKKDIAAASSSLYQYANFPMVLKNDGII 270
            VA+ +N + GVLGIGL GLE TN   S+T + K          Y Y NFP VLK+ GII
Sbjct: 186 GVAHQANVTQGVLGIGLAGLETTNTGFSSTLNSKS---------YTYENFPQVLKSQGII 236

Query: 271 HKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGL 330
              AYSLFLN P   +G +LFG VDHSKYTG LYTVP+++     A   P++F +TL G+
Sbjct: 237 DANAYSLFLNSPGASQGGILFGGVDHSKYTGPLYTVPIINT---GAPGNPIQFQVTLQGV 293

Query: 331 GVDKDGSQST------------IATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSR 378
           G+  D S  T            +  +  P LLDSGTT+   P  + +++A++  ATY+S 
Sbjct: 294 GISLDKSNGTNTNAADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSE 353

Query: 379 SGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVF 438
           + +Y + C     NT L+ DFGGF + A + + + +  +  C+L I P   +   LGDVF
Sbjct: 354 TSYYQLKCPSQNDNTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGTLGDVF 413

Query: 439 LSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGG 498
           L +AYVVYDL+N E+S+AQA+F  S  +S+E ISS+VPSA KA  YSN W+ +  + TGG
Sbjct: 414 LVDAYVVYDLDNYEISLAQADFSDSA-QSIEPISSSVPSATKAPGYSNTWTGSESIKTGG 472

Query: 499 NIFTVE 504
           NIFT +
Sbjct: 473 NIFTAQ 478

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 34/44 (77%)

Query: 17  MDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           ++  N+  FYSV+L +GTP QK++VL+DTGSSDLWV G DN  C
Sbjct: 61  VNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFC 104

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 174/351 (49%), Positives = 237/351 (67%), Gaps = 18/351 (5%)

Query: 159 CSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSN 218
           C+TYGTFD ++SST+ SN+T F+I+YGDTS+A G+WG D + ++ L+VSG+SFAVAN +N
Sbjct: 125 CNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHLDDLDVSGLSFAVANVTN 184

Query: 219 SSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLF 278
           S++GVLGIGLPGLEVT               A  + YQY NFPM+LKN G  H   YSL 
Sbjct: 185 STVGVLGIGLPGLEVT------------YINAPRNRYQYDNFPMILKNSGATHSNLYSLH 232

Query: 279 LNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQ 338
           L+ P+ + G+VLFGAVDHSKYTG+LYT+PLV+       S P +F++TL G+G+  + +Q
Sbjct: 233 LDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANNTQ 292

Query: 339 STIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSC-SYDTSNTNLVF 397
           +T+  T I ALLDSGTT++Y P  L   IA    A + SR G+Y +SC + + S+T LVF
Sbjct: 293 TTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVF 352

Query: 398 DFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-ENWVVLGDVFLSNAYVVYDLENLEVSMA 456
           DFGGFHI   L DF+V+     C+L I  +   N  +LGD FL NAYVV+DLEN E+SMA
Sbjct: 353 DFGGFHINGKLTDFIVETFGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMA 412

Query: 457 QANFDSSLPESVEVISST--VPSAVKAASYSNPWSS--AVMMSTGGNIFTV 503
           QA  +    + +E+++S   V SAV A  YS+ W++  + + +  G+IFTV
Sbjct: 413 QALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAGDIFTV 463

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 40/58 (68%), Positives = 47/58 (81%), Gaps = 2/58 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           LAKR  T GY L+D+ N+ +FYSVDL+IGTP Q +TVLVDTGSSDLWV G+DNP C S
Sbjct: 56  LAKR--TRGYELVDLVNRQNFYSVDLDIGTPSQTITVLVDTGSSDLWVTGSDNPYCVS 111

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 163/340 (47%), Positives = 223/340 (65%), Gaps = 21/340 (6%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C  +G+FD S+SST+K NNT F I YGD++YA G+WG D + + + NV G++FAVA+ 
Sbjct: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHA 177

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           SNSS+ VLGIGLP +E T  +S+   G           YQY N PMVLK + +I K  YS
Sbjct: 178 SNSSVAVLGIGLPAMETT--MSSQQFG-----------YQYDNLPMVLKRNNVIKKTVYS 224

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV---- 332
           +F+N+   + GSVLFGAVDHSKY GTL TVPLV+  +    +KPVE  +TL  +G+    
Sbjct: 225 MFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGR 284

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSC-SYDTS 391
           D+D  Q T+  + +PALLDSGTT++YFP QLA+ +AR   A + S    Y + C S    
Sbjct: 285 DEDKVQ-TLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLH 343

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQ-TCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
            T  ++DFGGF I +PL D+ +  + + TC   I P   ++V+LGDVFL+ AYVV+DLE 
Sbjct: 344 QTAYIYDFGGFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEA 403

Query: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS 490
           LEVSMAQAN++    E +EVI+  VP AV+A  Y++PW +
Sbjct: 404 LEVSMAQANYEGG-KEQIEVIAGAVPRAVRAPGYNDPWKA 442

 Score = 62.8 bits (151), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 3/50 (6%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMG 54
           LAKR++   +  +++ NQ  FYSV+L IGTPPQ+V VL+DTGSSDLWV+G
Sbjct: 56  LAKRND---WVDIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVG 102

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  303 bits (776), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 192/509 (37%), Positives = 269/509 (52%), Gaps = 68/509 (13%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
           R  L+KR   D Y  + ++     Y V+L +GTP QK  V +DTGSSDLWV  + NP C 
Sbjct: 51  RNRLSKRG--DDYENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYCM 108

Query: 62  SGR--RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGW 119
                  +K  G+        +    D++ T  + + T  D                   
Sbjct: 109 PSETTHNEKVYGEAAYGETAFDQTALDQFETL-LASATEDD------------------- 148

Query: 120 XXXXXXXXXXXXXXXXXXXXXXXXXPARTTDSA---AEATVQCSTYGTFDHSKSSTFKSN 176
                                    P+ T   A   +EAT+ C+++GTF+++ SS+F +N
Sbjct: 149 -------------------------PSYTQTEAVPSSEATIDCASFGTFNYTLSSSFSAN 183

Query: 177 NTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQ 236
           +T F ISY D++ A G W  D + +  L +S + FAVA   +    V G+G PG E    
Sbjct: 184 DTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTPVFGVGFPGTE---- 239

Query: 237 LSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDH 296
            S   S  K+        Y+YANFP++LK+ G + KV YSLFL+      GS L GAVDH
Sbjct: 240 -STAGSSVKEP-------YEYANFPVLLKSQGYVKKVVYSLFLDAQDSSSGSFLLGAVDH 291

Query: 297 SKYTGTLYTVPLVDIYH--DSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGT 354
           SKY+G LYT+P+       D+ SS P  F ITL GLG+   G   T+ATT     LDSG+
Sbjct: 292 SKYSGGLYTLPMYSGTDGDDTLSSTPSRFIITLQGLGISDKGENKTVATTRSLVYLDSGS 351

Query: 355 TISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQ 414
           T + FP++ A  IA    A+Y      Y M C     +TN V+DFGGF I++PL +++  
Sbjct: 352 TGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSKDDDTNFVYDFGGFTISSPLSNYMEA 411

Query: 415 QSSQT-CVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISS 473
               + CVL I      ++VLGD FL +AYVVYDLE+ E+S+AQAN+D    E++EV+S 
Sbjct: 412 TGDDSVCVLDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGG-SENIEVVSD 470

Query: 474 TVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           ++PSAVKA  YS+ WS+ V  ++GGNIFT
Sbjct: 471 SIPSAVKAPFYSSTWSTYVTATSGGNIFT 499

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  295 bits (755), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 167/364 (45%), Positives = 222/364 (60%), Gaps = 17/364 (4%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           AA  T+ C +   FD  KSS+FKSN+T F  SYGD SYASG WG D + +  L+++ V F
Sbjct: 162 AAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIADVFF 221

Query: 212 AVANYSNSSMGVLGIGLPGLE-----------VTNQLSNTASGKKDIAAASSSLYQYANF 260
           AVAN+SNSS GVLG+GLP LE           V++ L   AS   DI   S     YANF
Sbjct: 222 AVANFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNAS-DADIDNISKP--TYANF 278

Query: 261 PMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
           P +LK   +I KVAYSLFLND     G +LFGAVDHSKYTG+L T+PLV+  +    +  
Sbjct: 279 PQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDT 338

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
            + +ITL G+G+     Q TI    +PALLDSGTT+SY P  L + +A++     D ++G
Sbjct: 339 TQLEITLDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTG 398

Query: 381 FYTM-SCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFL 439
           F  + +C     NT LVF+FGG  I+    +F+ +     C +   PQ E  ++LGD FL
Sbjct: 399 FIELKNCPAKNDNTQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNFL 458

Query: 440 SNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS-AVMMSTGG 498
            NAY+VYDLE++E+S+AQANF+    E++E I   VPSAVKA  YS  ++      +T G
Sbjct: 459 RNAYIVYDLEDMEISIAQANFNGG-AENIEAIVKNVPSAVKAPGYSASFTEFPSSYATTG 517

Query: 499 NIFT 502
           NIF+
Sbjct: 518 NIFS 521

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 1/75 (1%)

Query: 3   EWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
             L KR + D  +   V  Q ++YS++LE+GTPPQ V++L+DTGSSD+WV+G++N  C +
Sbjct: 45  RQLRKRASDDSVAFPLVA-QENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKN 103

Query: 63  GRRGKKFLGDEGDAR 77
                + L   G  R
Sbjct: 104 SDNKSRNLDALGSNR 118

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  291 bits (746), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 220/340 (64%), Gaps = 15/340 (4%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           ++ AT+ CS YGTF+   S TFKSN++ F ++YGD S+A G WG+D + ++ LNVS VSF
Sbjct: 124 SSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSF 183

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           AVAN SNS++GV G+GLPG E T                + + YQY NFP VLK++G++ 
Sbjct: 184 AVANESNSTVGVFGVGLPGEEAT-----------VTPGVNGNHYQYKNFPQVLKDNGVVQ 232

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
           K AYSL+LN P    G++LFGAVDHSKY+G LYT+P+V+ Y D   + P EFD+T+ G+ 
Sbjct: 233 KNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-PREFDVTVQGIT 291

Query: 332 VDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
           V    S ST+++    ALLDSGTT+ Y P  LA+E+A+     +   +G+Y +    +  
Sbjct: 292 VGNSSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSEND 351

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQS--SQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLE 449
           +T + FDFGGFHI   L ++++Q S      +L I   + +  + GDVFL +AYVVYDLE
Sbjct: 352 DTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVYDLE 411

Query: 450 NLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWS 489
           + E+S+AQANF+S   + +E IS +VP A +A  YS  ++
Sbjct: 412 DYEISLAQANFNSGSSD-IEAISGSVPGASRAPGYSQTYT 450

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 47/65 (72%), Gaps = 1/65 (1%)

Query: 10  NTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKKF 69
           N++G++  D++NQ +FYSV+L++GTP Q V VL+DTGSSDLW+ G+ NP C+   R    
Sbjct: 44  NSNGHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITGSGNPYCSPSTR-NSH 102

Query: 70  LGDEG 74
           LG  G
Sbjct: 103 LGSAG 107

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  288 bits (736), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 162/352 (46%), Positives = 221/352 (62%), Gaps = 13/352 (3%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C  YG F+ S SSTFK+N+T   + Y D S+  G+WG D +S+  LN+SGV+FAVA  
Sbjct: 118 LDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVAEI 177

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           SNSS GVLG+ LP  E T  +++  +        +++ YQY+N P+ LK  GII KV YS
Sbjct: 178 SNSSSGVLGVSLPSEESTYSINSNGT-------TNATNYQYSNLPLQLKEQGIIDKVTYS 230

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDG 336
           ++LND + + GS+LFGAVDHSKYTGTLYT+PLV+  +D   +KP E DITL G+G     
Sbjct: 231 IYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVNSEYD-VVNKPYELDITLNGIGYQSMS 289

Query: 337 SQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSR-SGFYTMSCSYDTSNTNL 395
           S  T+    + AL+DSGTTIS FP ++   +A++ NAT D   +G     C     N  L
Sbjct: 290 SNMTLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKL 349

Query: 396 VFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQ--QENWVVLGDVFLSNAYVVYDLENLEV 453
           +F+ GG  I   + +F  +   + C L I P   + + V+LGD F+ + Y V+DLE  EV
Sbjct: 350 LFNLGGALIYVDIKEFTTKVKGK-CYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEV 408

Query: 454 SMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS-AVMMSTGGNIFTVE 504
           S+AQANF+SSLP  +E I STVPSAVKA  Y N +S+ A + S  G+IF  E
Sbjct: 409 SIAQANFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASISSVTGDIFGPE 460

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%), Gaps = 2/61 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          L KR   D  S + ++N V  Y V L +GTPPQ V+V +DTGS+DLW  G DNP C + +
Sbjct: 30 LEKR--ADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNK 87

Query: 65 R 65
          +
Sbjct: 88 K 88

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  283 bits (724), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 164/423 (38%), Positives = 217/423 (51%), Gaps = 38/423 (8%)

Query: 148 TTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS 207
           T+ S  +  + C+ YGTF+HS SS+FK+N T F + Y D + AS  WG D + +  L + 
Sbjct: 144 TSSSMVQPIIDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEIL 203

Query: 208 GVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKND 267
            +SF VAN  N++ GV GIG P LE TN  +        I   SS  Y+YANFP  L N 
Sbjct: 204 DMSFGVANVFNATEGVFGIGFPSLETTNMFN------ARIDPYSS--YEYANFPQALNNQ 255

Query: 268 GIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITL 327
           G + KVAYSLFLND    +GSVLFGAVDHSKY   L+TVPLV+ + D     P  F++  
Sbjct: 256 GSVDKVAYSLFLNDSHAMKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNVFN 315

Query: 328 YGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS 387
              G                 +LDSG T+S  P +L +++ +  NAT+D     YT+ C 
Sbjct: 316 ARRGCPNKRRPQNRRHDEFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCP 375

Query: 388 YDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYD 447
                +   FD G FHI  PL +FV +     C+L + P      +L D FLS AYVV+D
Sbjct: 376 SKKDTSVASFDIGRFHIDGPLSNFVRKYEKNKCILRLDPADNQPYILCDNFLSRAYVVHD 435

Query: 448 LENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTVEXXX 507
           LE+ E+SM QAN + + PE +E I S VP  V+A SY   W +   +S  GNI+TV    
Sbjct: 436 LESYEISMGQANTEYA-PEQIEAIKSKVPGTVRAPSYDKTWGNGTDVSPSGNIYTVS--- 491

Query: 508 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNQRKNAGAI--VLPSFSTAIFTFIA 565
                                             +N R+N GA+  V  S +TAI T IA
Sbjct: 492 ------------------------TNGTSTTTQSSNARENLGAVNAVFTSVATAILTLIA 527

Query: 566 SFL 568
           S L
Sbjct: 528 SLL 530

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 2/56 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
            AKRD    Y L+D+ N+   Y+V L +GTPPQ +TV ++ GS+D W+   DNP C
Sbjct: 52  FAKRDG--DYVLVDLINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYC 105

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  277 bits (709), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 221/351 (62%), Gaps = 12/351 (3%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C  +G F+ SKSST+K+N T F +SY DT++ASG WG+DT+S N + V  V+F +A +
Sbjct: 119 IDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVDNVTFGLAAF 178

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           SNS+  V GI LP  E TNQL+  A+G + I   S   Y+Y+NFPM+LK  GI+ K+AYS
Sbjct: 179 SNSTTPVFGISLPARETTNQLA--ANGSR-IGPNS---YEYSNFPMLLKEQGIVKKIAYS 232

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDG 336
           ++LND + + GS+LFGAVD SKY GTLYT+PLV+  +    SKP +F+ITL G+G+    
Sbjct: 233 VYLNDTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQV-SKPFQFEITLNGIGLQTAD 291

Query: 337 SQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSYDTSNTNL 395
              T+    +  LLD+G T S  PA++A  +A K N T D  +GF  +  C        +
Sbjct: 292 KNYTLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTV 351

Query: 396 VFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVVYDLENLEVS 454
           VF+FGG  I+  + D + ++    C L +  + +  +  LGD+FL + YVVY+LE+ E+S
Sbjct: 352 VFNFGGAEISIDIRD-LTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEIS 410

Query: 455 MAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS-AVMMSTGGNIFTVE 504
           +A ANF+ S P+  E++ STVP AVKA  Y N +S      +  G++FT E
Sbjct: 411 IANANFNYSTPDIQEIV-STVPGAVKAPQYYNTYSVYPTATAVTGDVFTPE 460

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          L KRD  D    ++++N    Y+V L +GTPPQ +TV +DTGSSDLW     NP C + R
Sbjct: 31 LNKRD--DKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNR 88

Query: 65 R 65
          +
Sbjct: 89 K 89

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  282 bits (721), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/350 (46%), Positives = 220/350 (62%), Gaps = 20/350 (5%)

Query: 145 PARTTDSAAEA-TVQCSTYGTFDHSKSSTFK-SNNTAFAISYGDTSYASGSWGIDTMSIN 202
           P+ T D    A TV C+ +GTF+ +KSSTF+   N  F I YGD ++A+G W  DT+S++
Sbjct: 130 PSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFANGLWAKDTLSLD 189

Query: 203 KLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPM 262
             ++S + FAVAN S+S +GVLG+GL GLE      ++A    D  +      QY NFP+
Sbjct: 190 GHDISNLQFAVANMSDSDVGVLGVGLTGLE------SSADPFDDEPS------QYPNFPV 237

Query: 263 VLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVE 322
           VLK + +I K+AYSL++N    + GSVLFGAVDHSKYTG LYT+PLV+        + +E
Sbjct: 238 VLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILE 297

Query: 323 FDITLYGLGVD--KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
           FD+T+ GLG++  K+  Q T+ T   PAL+DSGTT+ Y    LA+ IA    AT      
Sbjct: 298 FDVTVQGLGIESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYE 357

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQ-QSSQTCVLAIGPQQENWVVLGDVFL 439
            YT  C     +T LVFDFGGF IT PL ++V++    + C L + P   N  +LGD FL
Sbjct: 358 LYTFECPAKDDDTQLVFDFGGFQITNPLSNYVLETDDEKVCGLGVVPSYSN--ILGDEFL 415

Query: 440 SNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWS 489
           ++AYVV+DLENLE+S+ QAN +   PE +E I STVP A KA  YS+ W+
Sbjct: 416 ASAYVVFDLENLELSIGQANLNPG-PEDIEPIISTVPGAQKAPGYSSTWT 464

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 41/65 (63%), Gaps = 1/65 (1%)

Query: 5   LAKRDNTDGYSLMDV-QNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASG 63
           L +RD+    S + V +N+  FYSV L IGTPPQ +TVL DTGSSDLWV    NP C + 
Sbjct: 53  LHRRDSGSSDSALSVLKNEEVFYSVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEAD 112

Query: 64  RRGKK 68
              ++
Sbjct: 113 GVNRR 117

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  276 bits (707), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 180/494 (36%), Positives = 268/494 (54%), Gaps = 79/494 (15%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           LAKR + D Y  + + N+  FY V++ IG+  Q +T+LVDTGSSD WV+G  NP C S  
Sbjct: 28  LAKRAD-DDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSN- 85

Query: 65  RGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXX 124
           RGKK              ++KD+  +          + PG N + + A  +         
Sbjct: 86  RGKK-------------PKKKDQPSS----------VDPGRNGYPTKAEAIPYA------ 116

Query: 125 XXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISY 184
                                 RT D +   T   S+        S+TFKSN+T F I+Y
Sbjct: 117 ---------------------ERTFDCSDFKTFNSSS--------SNTFKSNDTDFFITY 147

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEV-----TNQLSN 239
           GD SY  G+WG D +++    +  V+FAVA  +N+S G+LGIGLP LE      T QL+N
Sbjct: 148 GDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELESSITIDTAQLTN 207

Query: 240 TASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKY 299
           T+S KK+          Y NFP  LK + +I+KV YS++LN   ++ GS+LFGAVDH++Y
Sbjct: 208 TSSVKKN---------PYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGAVDHNRY 258

Query: 300 TGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK-DGSQSTI--ATTTIPALLDSGTTI 356
            G L TVPLV    D  + +P E  +TL G+  +  DG+ + I  AT+  PALLD+G+T 
Sbjct: 259 DGNLTTVPLVFSNRDFGTPRPNELMVTLNGMSFEATDGNVTQILNATSKFPALLDTGSTD 318

Query: 357 SYFPAQLANEIARKFNATYD-SRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQ 415
           ++ P  + N +A   N TYD +++      C      T L F  GG +I  P  + +V++
Sbjct: 319 THLPVDVYNALAESTNGTYDQTQNKIRIPKCLSKKDKTILNFSLGGVNIGVPYKE-MVKK 377

Query: 416 SSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTV 475
               C + + P   ++ +LGD  +  AY+V+DLE+ E+S+AQA+F+ +LPE +EV+ ST+
Sbjct: 378 IKGKCYINVAPTGSDFAILGDDVIRYAYMVFDLEDREISLAQASFNDTLPEDIEVVVSTI 437

Query: 476 PSAVKAASYSNPWS 489
           P A +A++YS  +S
Sbjct: 438 PGATRASAYSETYS 451

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  275 bits (703), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 176/490 (35%), Positives = 262/490 (53%), Gaps = 50/490 (10%)

Query: 17  MDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKKFLGDEGDA 76
           +D+ NQ  +YS  + +GTP Q++T+L+DTGSSDLW+       C S         D  DA
Sbjct: 62  IDISNQNVYYSASIYLGTPGQELTLLLDTGSSDLWIPQKGGYHCQS---------DSDDA 112

Query: 77  RVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXXXXXXXXXXXXXXX 136
                 + K   + + + +I   +  P  ++  ++ G                       
Sbjct: 113 -----TKGKSSGIASQLFSIASAEGGPSPSLTTTLIG------------SSGGSHPDPLE 155

Query: 137 XXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNT--AFAISYGDTSYASGSW 194
                   PA  T SA E + Q S+ G FD + SS+F  N+T   F I YGD SYASG W
Sbjct: 156 PTNRNVQPPAAITASALEESCQSSS-GNFDPNSSSSFNKNDTVDGFFIEYGDNSYASGYW 214

Query: 195 GIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSL 254
             D +++  ++V  ++ AVA+ +NSS+ V GI   GLE +    N               
Sbjct: 215 ATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSVFGDNL-----------QDP 263

Query: 255 YQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHD 314
           ++Y NFP +LK+ GI+ + AYSL+LN     +G++LFG VDH+KY+G LYT+P++    D
Sbjct: 264 HEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDLYTLPVLKGQED 323

Query: 315 SASSKPVE-FDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNA 373
           S    P E F +T+ G+G+    +Q+T+ TT    LLDSGTT  Y P  +A+ +A  +  
Sbjct: 324 S---DPWERFVVTVQGIGIKGSETQNTLTTTPFIGLLDSGTTAVYLPEPVADMVANAYGG 380

Query: 374 TYDSRSGF--YTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENW 431
           ++D       Y +SC  D  +  +VF+FGGF+I   L +++    +  C+L I P  +  
Sbjct: 381 SFDDDPEVQSYVISCPSD--DEKIVFNFGGFNIETSLSNYITDNGNGQCILNISPTSDYM 438

Query: 432 VVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSA 491
            +LGD FL ++YVVYD++N E+S+AQANFDS+  E VE I+  VP A KA  YS+ +S  
Sbjct: 439 GILGDSFLRDSYVVYDMDNNEISLAQANFDST--EDVEAITGPVPGATKAPGYSSTYSGP 496

Query: 492 VMMSTGGNIF 501
               TGGNIF
Sbjct: 497 QTFQTGGNIF 506

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  278 bits (711), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 149/352 (42%), Positives = 217/352 (61%), Gaps = 22/352 (6%)

Query: 158 QCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINK--LNVSGVSFAVAN 215
           +C  YGTFD+ +SSTF+  N+A  I+Y D +   G WG+DT+ +N   + +      VA+
Sbjct: 92  ECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVAD 151

Query: 216 YSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAY 275
            S+S  GV+G+G PGLE TN +   A+G+          Y YANFPM LK  G+     +
Sbjct: 152 SSDSVAGVIGLGFPGLETTNNVQ--ANGES---------YTYANFPMQLKQQGVTDATVF 200

Query: 276 SLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKD 335
           ++ L++     G +LFGAVD  KY G LYT+P+V+      ++ P+  ++TL G+GVD D
Sbjct: 201 AIALDN--SYGGDILFGAVDEGKYIGGLYTLPVVN---SRGTATPIRMEVTLQGIGVDSD 255

Query: 336 GS-QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTN 394
           G  Q T ++T + AL+DSG+T+ Y P  +A  I  K  A YD  S  YT+ C  +  N N
Sbjct: 256 GGDQETFSSTPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDN 315

Query: 395 LVFDFGGFHITAPLDDFVV--QQSSQ-TCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           L+FDFGGFHI+ P+ ++++  Q+SS   C+  I  Q  N VVLGD FLS+AYVV+DL++ 
Sbjct: 316 LIFDFGGFHISTPVSNYIITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHY 375

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           E+SMAQ N ++      +V S T+P+A KA  YS  WS+   +++GGNIFT+
Sbjct: 376 EISMAQGNSNNGDGNVKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIFTL 427

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          L +R++ D   L     Q  FYS+DL IGTP QKVTVL+DTGSSDLWV G +NP C
Sbjct: 33 LVRREDGDSVHL---GKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYC 85

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  269 bits (687), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 151/354 (42%), Positives = 224/354 (63%), Gaps = 18/354 (5%)

Query: 153 AEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212
           A   + C+ YG F+ S SST+  N+T F++SYGD ++ASG WG DT+S+N + V  V+F 
Sbjct: 117 ALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVENVTFG 176

Query: 213 VANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
           +A++SNS+  V GIGLPG E     S  A   +D    +++  QY+NFP+ LK  G I K
Sbjct: 177 LASFSNSTNPVFGIGLPGDE-----STYAMFSEDTNGTTNT--QYSNFPLQLKQQGKIDK 229

Query: 273 VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
           VAYS++LN  + ++GS+LFGAVDHSKY+G LYT+P+V+ +     + P E ++TL GLG+
Sbjct: 230 VAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRFGHLVEN-PYELEVTLSGLGL 288

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMS-CSYDTS 391
            +  S  T+    +PALLD+GTT +Y P+ +A  +A + N   D ++    ++ C    S
Sbjct: 289 QRATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKS 348

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           N  +VF+F G  I   + DFV +   + C L    Q+ ++ +LGD F+ + Y V+DL++ 
Sbjct: 349 NDTIVFNFSGAQIKIKMVDFVEKHKGK-CYLPCVSQESSFFLLGDSFMRHVYTVFDLDDK 407

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAV----MMSTGGNIF 501
           E+S+AQANF+S+  E +E ISSTVPSAVKA  Y   +SS V     +S  G+IF
Sbjct: 408 EISIAQANFNST-KEDIEEISSTVPSAVKAPQY---YSSYVDFPTEISVTGDIF 457

 Score = 58.2 bits (139), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 43/75 (57%), Gaps = 4/75 (5%)

Query: 1  MREWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          + + L KR + D + +  + N    Y+V + +GTPPQ +TV +DTGSSDLW +   NP C
Sbjct: 27 ISDELTKRADNDSF-IAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYC 85

Query: 61 ASGRRGKKFLGDEGD 75
             +  KKF   + D
Sbjct: 86 ---KNNKKFAPKKQD 97

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  275 bits (703), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 153/353 (43%), Positives = 217/353 (61%), Gaps = 19/353 (5%)

Query: 156 TVQCSTYGTFDHSKSSTFKSN-NTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
           T+ C+ YGTF+  +S++  +N +  F +SY D SYA G W  D + ++  ++S + FAVA
Sbjct: 154 TIDCAQYGTFNADRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVA 213

Query: 215 NYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
             SNS++GVLG+GL GLE T    +      +I++       Y NFPMVLK +G I K+A
Sbjct: 214 EISNSTVGVLGVGLQGLESTVHYRS-----PNISSI------YPNFPMVLKENGAIDKIA 262

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV-- 332
           YSL+LN      GSVLFG VDHSKYTG LYT+PLV+ Y D     PV+FD+T+ G+G+  
Sbjct: 263 YSLYLNSLDAPSGSVLFGGVDHSKYTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIES 322

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN 392
           +K   Q T  TT I AL+DSGTT+ Y   ++ N+IA   NA++    G +   C  D  +
Sbjct: 323 EKACRQETFTTTKIAALMDSGTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDD 382

Query: 393 TNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENW-VVLGDVFLSNAYVVYDLENL 451
           T  +FDFGGF I +PL +++++   +  +  +G    N   + GD FL++AYVVYDLENL
Sbjct: 383 TQFIFDFGGFQIKSPLSNYILRTDDEN-ICGLGLISSNQGTIFGDEFLASAYVVYDLENL 441

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS--AVMMSTGGNIFT 502
           E+S+AQAN++   PE +E I S +P A +A+ Y N W S    M     +IFT
Sbjct: 442 ELSLAQANWNPGSPE-IEKIVSEIPRAQRASQYWNTWVSDEENMAQVTRDIFT 493

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 47/74 (63%), Gaps = 1/74 (1%)

Query: 5   LAKRDNTDGYSL-MDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASG 63
           L KR  + G +L  ++ N   FYSV L+IGTPPQ+VTVL DTGSSDLWV   DNP C++G
Sbjct: 60  LQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYCSNG 119

Query: 64  RRGKKFLGDEGDAR 77
              + +     D +
Sbjct: 120 DSTESYANYRADLK 133

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  271 bits (692), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 158/352 (44%), Positives = 223/352 (63%), Gaps = 8/352 (2%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           A+   + C+TYGTF  S SS+F  NNT F   Y D S A+G WG D +      +S +S 
Sbjct: 113 ASSDLIDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISI 172

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           AVA+ ++SS GVLGIGL GLE T   S  A       ++S+  YQY NFP+ L  + +I 
Sbjct: 173 AVADQTDSSFGVLGIGLTGLESTYSGSAAA-------SSSTGRYQYDNFPIRLVQENVIQ 225

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
             AYSL+L+      G++LFG VDH+KY+G L T+PL++    +  + P++  +TL GLG
Sbjct: 226 ANAYSLYLDPATGSSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLG 285

Query: 332 VDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
           V    S ST+ TT IPALLDSGTT++Y P  + + +A +  ATY S S  Y +SC+    
Sbjct: 286 VSDGSSTSTVTTTQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDE 345

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           ++ +V+DFGGF I  PL   + Q S   C LAIG    ++  LGD+FL++AYVVYDL+N 
Sbjct: 346 DSMIVYDFGGFQIQTPLAGSLYQLSDDQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNK 405

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTV 503
           E+SMAQ N++++  E +E+IS +VP A KAA Y N W+++  ++ GGNIFT+
Sbjct: 406 EISMAQINYNAT-TEDIEIISDSVPGATKAAGYYNTWTTSESITAGGNIFTL 456

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 2/58 (3%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           L KR  + G   +++ N+  FY++D+EIGTP Q VTVLVDTGSSD WV  + NP C S
Sbjct: 50  LVKR--SSGTDEVELINESVFYAIDMEIGTPKQSVTVLVDTGSSDFWVPSSTNPYCES 105

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  265 bits (677), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 144/354 (40%), Positives = 220/354 (62%), Gaps = 12/354 (3%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           T+ C  YG F+ S+SSTFK N++ F +SY D S+A+G+WG D +S N+LN+S V+FA+ +
Sbjct: 118 TLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNISNVNFALGS 177

Query: 216 YSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAY 275
           ++NSS GVLG+GLP +E T      A  +K+I    S  +QYANFP+ LK +G+I K+AY
Sbjct: 178 FANSSNGVLGVGLPDVESTYD-GPYAGSRKNI----SDSHQYANFPITLKQNGVIDKIAY 232

Query: 276 SLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKD 335
           SL+LN  + + GSVLFGAVDH++Y G LYT+PL +    + +  P + +IT+ GLG+  +
Sbjct: 233 SLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSLFQNFTD-PFQLEITMNGLGLQGN 291

Query: 336 GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSYDTSNTN 394
            +  T+      ALLDSGTT++     + + IA + N T   +     +  C     N  
Sbjct: 292 DANITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKKENKK 351

Query: 395 LVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQE---NWVVLGDVFLSNAYVVYDLENL 451
           L+F+F G  +   ++  + +   + C L     ++   + ++ GD FL + Y+VY+LE+ 
Sbjct: 352 LIFNFSGAEVAVDINQMMNKHKGK-CYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNLEDK 410

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS-AVMMSTGGNIFTVE 504
           E+S+A ANF+SSLPE++E I STVPSA++A  Y N +S  A   +  G+IF  E
Sbjct: 411 EISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEHATATAVTGDIFAPE 464

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 2/61 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          L KRD  D Y  + ++N    Y V L +GTPPQ +TV +DTGSSDLW    DNP C   +
Sbjct: 31 LVKRD--DEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNPFCKENK 88

Query: 65 R 65
          +
Sbjct: 89 K 89

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  265 bits (676), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 206/352 (58%), Gaps = 16/352 (4%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C+ +G F+ S S+TF SN T F ISY D+SYA G W  D + +N LN+SG++F +A +
Sbjct: 113 LDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLAYF 172

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           SNSS  VLG+GL  LE        AS   DI    S  +QY NFP +LK  G I KV YS
Sbjct: 173 SNSSNSVLGVGLTPLE--------ASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYS 224

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD--K 334
           L+LND + + G +LFG VDHSKY G LYT+PLV+  +  +     + ++TL GLG+    
Sbjct: 225 LYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGIRDNT 284

Query: 335 DGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSYDTSNT 393
             + +T+ T  +PAL DSGT+ SY P  +A  IA + N T D+++    +  C       
Sbjct: 285 TNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTR 344

Query: 394 NLVFDFGGFHITAPLDDFVVQQSSQTCVLAI---GPQQENWVVLGDVFLSNAYVVYDLEN 450
            +VF+F G  I  PL  F  Q+ S  C L +    P     ++LGD FL   Y V+DLE 
Sbjct: 345 EVVFNFNGVEIAIPLKQF-YQKKSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEA 403

Query: 451 LEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSA-VMMSTGGNIF 501
            E+S+A+ANF+SSLP  VE I STVPSA+KA  Y N +S+        GNIF
Sbjct: 404 QELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQVVGNIF 455

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 5  LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          L KRD  D   L++ Q +   Y++ L +GTPPQ +T  +DTGSSDLW   + NP C + +
Sbjct: 27 LVKRDVQD-VKLINSQ-KAMLYNIQLSVGTPPQNITAQLDTGSSDLWFPDSTNPYCKANK 84

Query: 65 R 65
          +
Sbjct: 85 K 85

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  263 bits (671), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 247/485 (50%), Gaps = 74/485 (15%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
           ++KR      +L+++ +    Y V++EIGTPPQ     +DTGSSD+         CA   
Sbjct: 45  ISKRSEAFNSTLINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDM---------CA--- 92

Query: 65  RGKKFLGDEGDAR-VEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWXXXX 123
                  +E D+   E    + + W +   +T T  ++                      
Sbjct: 93  -------NEADSSYCESFTDESNIWTSNYELTATASEI---------------------- 123

Query: 124 XXXXXXXXXXXXXXXXXXXXXPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAIS 183
                                 + T  S+      CS +GTF  + SSTFK N T F IS
Sbjct: 124 ----------------------SSTATSSKAYNTPCSYWGTFSPNVSSTFKYNETIFNIS 161

Query: 184 YGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASG 243
           Y D  Y +G++G D +S+  + +S  +F V+N +  S G+LG+ LP +E T+ +      
Sbjct: 162 YADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEETDDI------ 215

Query: 244 KKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTL 303
            +D  +++++ + Y NFPM LK+ G I K+AYSLFLN+P  + GS+LFGAVD SKY+G L
Sbjct: 216 -EDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYSGQL 274

Query: 304 YTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQL 363
           YT+P++  Y+   +     F        +D      T++    P L DSGT+ S  P ++
Sbjct: 275 YTLPMLQAYNTLDALYSGMFVTAQSAAIIDSKSGNKTVSEVQFPVLFDSGTSTSVLPTEI 334

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLA 423
           A+ I R F+  Y S    Y   CS   +NT L  DFGGF+I+A + +FV   +   CVL 
Sbjct: 335 ADAIGRSFDGKYSSDDEGYIFDCS-KVNNTQLSIDFGGFNISANISNFVTPLTKDHCVLQ 393

Query: 424 IGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAAS 483
           I P  +   VLGD FL + YVVYDLEN EVS+AQA+F++   E +E+IS +VP A  A  
Sbjct: 394 ILP-SDTVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNE-EEDIEIISDSVPGATPAPG 451

Query: 484 YSNPW 488
           YS+ W
Sbjct: 452 YSSTW 456

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  265 bits (677), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 146/332 (43%), Positives = 207/332 (62%), Gaps = 17/332 (5%)

Query: 154 EATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAV 213
           ++ V CS YGTF+   S TF  +++ F I+Y D ++A+G W  D +S     ++ + FAV
Sbjct: 109 KSVVDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAV 168

Query: 214 ANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
           AN +NS++GVLGIG   LE            K    A ++ YQ  NFP+ LKN+G+I K 
Sbjct: 169 ANETNSTVGVLGIGFERLESV----------KGYEGAPNTYYQ--NFPLALKNNGVIDKT 216

Query: 274 AYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD 333
           AYSL+LN      GS+LFG +D +KYTG LYT PLV+I H S  +KP +F +T+ G+GV 
Sbjct: 217 AYSLYLNSLDSSSGSILFGGIDSNKYTGDLYTFPLVNI-HPSVVNKPAKFHVTVQGIGVQ 275

Query: 334 KDGS-QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN 392
             GS QS + +T  PALLDSGTT+   P + A+ +A   NATY+   G YTM+C  +  +
Sbjct: 276 SSGSEQSILMSTKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDD 335

Query: 393 TNLVFDFGGFHITAPLDDFVVQ-QSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           T  +FDFG   I  PL +F++  + ++ C   + P  +  ++LGD+FLS AYVVYDLE+ 
Sbjct: 336 TEFLFDFGDLKIKVPLKNFILAPEDNEYCGFGVLPTVDT-MILGDMFLSAAYVVYDLESY 394

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAAS 483
           EVS+AQAN++S   E ++ I  TVP A KA +
Sbjct: 395 EVSLAQANWNSDESE-IQAIRHTVPGATKATA 425

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%)

Query: 17 MDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          ++++N+  FY+ DL +GTPPQ +TVL+DTGSSDLWV G+DNP C S  
Sbjct: 51 LNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNE 98

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  261 bits (667), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 139/354 (39%), Positives = 213/354 (60%), Gaps = 11/354 (3%)

Query: 153 AEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212
           ++ T+ C  YG ++ ++SSTF SN T   I+YGD  +  G+WG D++S+  LN+S +S  
Sbjct: 114 SDRTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIG 173

Query: 213 VANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
           V+  +N+S G+LG+GLPG E T   S+  +G  +        YQY+NFP+ LK +G+I K
Sbjct: 174 VSPMTNTSTGILGVGLPGEESTFNYSSNVTGPSN--------YQYSNFPIRLKEEGLIEK 225

Query: 273 VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
           +AYS++LN+   + GS+LFGAVDHSKY G LYT PLV+  +   S  P +F+IT+ G+G+
Sbjct: 226 IAYSIYLNETGSKYGSILFGAVDHSKYQGPLYTFPLVNSKYKEGSD-PFQFEITMNGVGL 284

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM-SCSYDTS 391
                  T+    +P LLDSG+TIS  P  +A+ +A++ N T D +     +  C     
Sbjct: 285 VGKTDNITLYDQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKD 344

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENL 451
           N  L+F+F G   +  + DF+ +   +  +        N+ +LGD F++N Y V++L++ 
Sbjct: 345 NQKLIFNFSGAEFSVNVTDFMEKHKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDK 404

Query: 452 EVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSS-AVMMSTGGNIFTVE 504
           E+S+AQAN++SSL   +E I  TVPSAV A  Y N +S+     +  GNIF  E
Sbjct: 405 ELSLAQANYNSSLKPDIEEIKDTVPSAVLAPQYYNTFSADPTATAVTGNIFAPE 458

 Score = 51.6 bits (122), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 38/60 (63%), Gaps = 9/60 (15%)

Query: 5  LAKRDNTDGYSLMDVQNQVSF----YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          LAKRD  D  +      Q++F    Y V++ +GTPPQKV + +DTGSSDL+V+   NP C
Sbjct: 30 LAKRDVVDPEAA-----QLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYC 84

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  260 bits (664), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 193/332 (58%), Gaps = 9/332 (2%)

Query: 159 CSTYGTFDHSKSSTFKSNNT-AFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYS 217
           C+    F+   S TF  N T  + I Y D SYASG WG D + +  L V  VSFAVAN +
Sbjct: 192 CNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDT 251

Query: 218 NSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSL 277
           NS+  V GIG PG E     S+ AS   +  AA    ++YANFP  LKN GII +VAYSL
Sbjct: 252 NSTTPVFGIGFPGGE-----SSFASVGPEYRAAHP--HEYANFPQTLKNQGIIQRVAYSL 304

Query: 278 FLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVE-FDITLYGLGVDKDG 336
           +LN P    G+VLFG VDHS+Y G LYT+P++ + + ++   P     ITL G+ V + G
Sbjct: 305 YLNSPNSTYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRG 364

Query: 337 SQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLV 396
           S+  + T  IP +LDSGTT  Y P +LA  IA +++         Y + C     N  + 
Sbjct: 365 SKHKVKTKPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYIT 424

Query: 397 FDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMA 456
           FDFGG  I   + +++ +QS   C+L I P  +   V GDVFL++AYVVYDLE  E+S+A
Sbjct: 425 FDFGGVTIKTDIRNYIFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLA 484

Query: 457 QANFDSSLPESVEVISSTVPSAVKAASYSNPW 488
           QA+F+SS  +   + SS VP A +A  YS  W
Sbjct: 485 QASFNSSSEQIEAITSSGVPGAKRAPGYSKTW 516

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 2/52 (3%)

Query: 9   DNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           D+ D  +L +  N  ++YSV++ +GTP Q +T+ +DTGSSDLWV+      C
Sbjct: 64  DDNDEVALQNNAN--TYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQC 113

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  247 bits (630), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 140/342 (40%), Positives = 206/342 (60%), Gaps = 13/342 (3%)

Query: 148 TTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS 207
           T   +A     CS +GTF  + SSTFK N T F ++YGD SY +G++G D +S+  + +S
Sbjct: 130 TAAPSAAYNAPCSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLS 189

Query: 208 GVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKND 267
             +F V+N + ++ G+LG+ LP  EVT+         +D  +++++ + Y NFPM LK+ 
Sbjct: 190 NFTFGVSNDTTNNGGILGVSLPSAEVTDD-------TEDALSSNTTPFIYNNFPMALKSQ 242

Query: 268 GIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITL 327
           G I K+AYSLFLN+P  + GS+LFGAVD S+Y+G LYT+P++  Y+   ++    F +T 
Sbjct: 243 GKIKKIAYSLFLNEPSARFGSILFGAVDKSEYSGQLYTLPMLQAYNTLDATDAGMF-VTA 301

Query: 328 YGLGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSC 386
             + + D      T++    P L DSGT+ S  P ++A+ I R F+  Y S    Y   C
Sbjct: 302 QSVAILDSKSGNKTVSEVQFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDC 361

Query: 387 SYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVY 446
           +   +NT L FDFGGF+I+A + +FV       C+L I P  +   VLGD FL + YVVY
Sbjct: 362 A-KVNNTLLSFDFGGFNISANISNFVTPAKDH-CILQILP-SDTIFVLGDAFLVDTYVVY 418

Query: 447 DLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPW 488
           DLEN EVS+AQA+FD+   E + +IS +VP A  A  YS+ W
Sbjct: 419 DLENHEVSVAQASFDNK-EEDIGIISDSVPGATPAPGYSSTW 459

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 33/58 (56%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           ++KR      +L+++ +    Y V +EIGTPPQ   + +DTGSSD+ +   D   C S
Sbjct: 49  ISKRSEAFNSTLINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCES 106

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  245 bits (626), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/327 (42%), Positives = 199/327 (60%), Gaps = 18/327 (5%)

Query: 180 FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSN 239
           F + Y D +YASG WG DT  +N  NVS ++FA+AN +N+SMGVLG+G P  E T+  S 
Sbjct: 144 FFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEETTDDPSP 203

Query: 240 TASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKY 299
            +   K+        YQY NFP+ LK    I KV+YS+FLND   ++G +LFG VDHSKY
Sbjct: 204 GSLIDKE-------HYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKY 256

Query: 300 TGTLYTVPLVD---IYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTI 356
            GTL+TVP+V+     + + +S+P   +ITL GLG   D    T+    IP LLD+GTT+
Sbjct: 257 QGTLWTVPMVNNLLTLNQTTTSRP---EITLNGLGFRDDKKNVTLWGEKIPVLLDTGTTL 313

Query: 357 SYFPAQLANEIARKFNATYDSRSGFYTM-SCSYDTSNTNLVFDFGGFHITAPLDDFVVQQ 415
           +Y P Q+ + IA++ N T DS++G   +  C     N+ L+F+F G  I   L + V ++
Sbjct: 314 AYAPKQVVDVIAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPVSLLNMVEKR 373

Query: 416 SSQTCVLAIGPQQE---NWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVIS 472
             + C L I   +E     ++LGD+F+ + Y V+++E++EVS A AN + S P  +E I 
Sbjct: 374 KGK-CYLEIRYHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAII 432

Query: 473 STVPSAVKAASYSNPWSSAVMMSTGGN 499
           S VPSAVKA  Y N ++S+ + ST  N
Sbjct: 433 SDVPSAVKAPQYYNTFASSNLPSTVTN 459

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 5  LAKRDNTDGYS-LMDVQ-NQVS--FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          LAKR  ++G +  MDV   Q+    Y+V L +GTPPQ VTV +DTGSSDLW     NP C
Sbjct: 28 LAKRHTSNGVANAMDVPIEQIGDLMYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYC 87

Query: 61 ASGRR 65
              +
Sbjct: 88 KRNAK 92

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  242 bits (618), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 147/346 (42%), Positives = 209/346 (60%), Gaps = 16/346 (4%)

Query: 145 PARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKL 204
           P+ T  S A  T+ CS +GTFD S SSTF++N T F  +YGD +Y +G++G D +S   +
Sbjct: 126 PSTTISSEAYNTL-CSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENI 184

Query: 205 NVSGVSFAVANYS-NSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
            ++  +F V+N +  +  G+LGI LP  E T+       G +   A + + + Y NFPM 
Sbjct: 185 TLNDFTFGVSNDTIGNPSGILGISLPIAEFTD-------GIEYALALNRTPFIYDNFPME 237

Query: 264 LKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEF 323
           LKN G I+K+AYSLFLN P    GS+LFGAVD SKYTG LYT+P++  ++   S+  +  
Sbjct: 238 LKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLGSNPGMI- 296

Query: 324 DITLYGLGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFY 382
            IT   + + D +    T++    P +LDSGTT SY P ++A  I + F+  Y S    Y
Sbjct: 297 -ITAQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGY 355

Query: 383 TMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNA 442
              CS   ++T L  DFGGF+I+A + +FV     + CVL +  Q E+  +LGD FL +A
Sbjct: 356 IFDCS-KVNDTLLSVDFGGFNISANISNFVTSAKDR-CVLNV-KQSESTYMLGDAFLVDA 412

Query: 443 YVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPW 488
           YVVYDLEN E+S+AQA+F++   E +EVIS TVP A  A  Y + W
Sbjct: 413 YVVYDLENYEISIAQASFNNQ-EEDIEVISDTVPGATPAPGYFSTW 457

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 19  VQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKKF 69
           V N +  Y V +EIGTPPQ + + +DTGSSD+ V   D   C S   G  +
Sbjct: 60  VINGIGVYVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDY 110

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  232 bits (591), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 188/314 (59%), Gaps = 15/314 (4%)

Query: 176 NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTN 235
           N+T F  +YGD +Y  G++G D +S+  + +   SF VAN + +  G+LGI LP  E T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 236 QLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVD 295
            L           A +++ ++Y NFPM LK+ G I K+AYSLFLN+P+   GS+LFGAVD
Sbjct: 61  SLG---------GAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVD 111

Query: 296 HSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV-DKDGSQSTIATTTIPALLDSGT 354
            SKY+G LYT+P++  Y    S  P  F +T   + V + D    T++    P L DSGT
Sbjct: 112 KSKYSGQLYTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGT 170

Query: 355 TISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQ 414
           T S  P ++A+ I + F+  Y S    YT  CS    +T L  DFGGF+I+A + +FV +
Sbjct: 171 TYSSLPTEVAHAIGKSFDGKYSSGDQGYTFDCS-KVKDTLLSIDFGGFNISANISNFVTR 229

Query: 415 QSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISST 474
                C+L I    ++  VLGD FL +AYVV+DLE+ EVS+AQA+FD    E +EVIS  
Sbjct: 230 TKDH-CLLNI-EAADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDK-KEEIEVISDR 286

Query: 475 VPSAVKAASYSNPW 488
           VP A++A  YS+ W
Sbjct: 287 VPGAIRAPGYSSTW 300

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  236 bits (603), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 141/348 (40%), Positives = 203/348 (58%), Gaps = 27/348 (7%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAV 213
           +T+ CS++ TF+ S SS+FK+  T+ F   Y D ++A GSW  + +++N ++VS + F +
Sbjct: 115 STIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGL 174

Query: 214 ANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
            N   + + GVLGIG P  E      N  +              Y NFP VLKN GII  
Sbjct: 175 GNCVTTPVSGVLGIGFPRRESVKGYDNAPNEF------------YPNFPQVLKNQGIIDV 222

Query: 273 VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
           VAYS+FLN  +   GS+LFGA+D SKYTG L T P+++IY D  + KP    + L GLG 
Sbjct: 223 VAYSMFLNKLESDTGSILFGAIDTSKYTGDLVTFPMLNIYPD-VTDKPATLMVILQGLGA 281

Query: 333 DKDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390
             + +    T  T+ IP LLDSGTT+   P ++A+ +A   NAT+    G Y M C    
Sbjct: 282 QDNANCKAETFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKE 341

Query: 391 S--NTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLGDVFLSNAYVVY 446
           +  NT+ +FDFGG  I  PL +F++   S+   C  A+ P   N +VLGD+FLS+AYVV+
Sbjct: 342 TLANTDYIFDFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVF 401

Query: 447 DLENLEVSMAQANFDS--SLPESVEVISS--TVPSAVKAASYSNPWSS 490
           DL+N ++S+A AN D+  SL +S+  I S   +P+A  A    +PWS+
Sbjct: 402 DLDNYQISLAAANLDNNVSLEDSIINIPSDGNIPNAKMAT--VDPWST 447

 Score = 67.8 bits (164), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 46/68 (67%), Gaps = 1/68 (1%)

Query: 2   REWLAKRDNTDGYSLMDVQN-QVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           +   AKR++  G+  +++Q+ + ++Y+  LEIGTPPQ +TVL D+GSSDLWVM   NP C
Sbjct: 37  KNQYAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYC 96

Query: 61  ASGRRGKK 68
            S   G +
Sbjct: 97  ESQYTGSQ 104

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  231 bits (589), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 192/328 (58%), Gaps = 34/328 (10%)

Query: 173 FKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLE 232
           FK N T F I+Y D SY +G++G D +S+  + +S  +F V+N +  + G+LGI LP  E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 233 VTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFG 292
           +T+      SG+  +++ +++ + Y NFPM LKN G I K+AYSLFLN+P  + GS+LFG
Sbjct: 61  ITD------SGQGALSS-NTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFG 113

Query: 293 AVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG------------VDKDGSQST 340
           AVD SKYTG LYT+P++  Y+            TL  LG            +D      T
Sbjct: 114 AVDKSKYTGQLYTLPMLQAYN------------TLDALGGGMLVTAQSVAILDSISGNKT 161

Query: 341 IATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFG 400
           ++    P L DSGT+ S  P ++A+ I R F+  Y S    Y   CS   +NT L  DFG
Sbjct: 162 VSEVQFPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDCS-KVNNTQLSIDFG 220

Query: 401 GFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANF 460
           GF+I+A + +FV   +   CVL I P  +   VLGD FL + YVVYDLE+ EVS+AQA+F
Sbjct: 221 GFNISANISNFVTPLTKDHCVLQILP-SDTVSVLGDAFLVDTYVVYDLESHEVSVAQASF 279

Query: 461 DSSLPESVEVISSTVPSAVKAASYSNPW 488
           ++   E +E+IS +VP A  A  YS+ W
Sbjct: 280 NNE-EEDIEIISDSVPGATPAPGYSSTW 306

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  242 bits (617), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 197/355 (55%), Gaps = 21/355 (5%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSF 211
           A++ +  C  +G+F  SKSSTF  N+T FAI+Y   +   G WG D + I  +N +G+SF
Sbjct: 110 ASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSF 169

Query: 212 AVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
            V + + SS G+LGIGLP  E T             A      Y+Y NFPMVLKN GII 
Sbjct: 170 GVVHTTTSSAGILGIGLPDTETT-------------AVGQYGHYKYDNFPMVLKNKGIIS 216

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
              YS++L+      G  L G VD SKYTGTLY +PLV+ Y+   SS P +F +TL GLG
Sbjct: 217 HQGYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVNWYNTYFSS-PGDFHVTLQGLG 275

Query: 332 -VDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390
            +   GS  T+  T +  +LD+G+T++  PA L N +       Y S  G Y  +C  +T
Sbjct: 276 LITNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTET 335

Query: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
           S   LVF+FGG +   P+  F+       C L +  + ++  +LGD FL N Y  +DLEN
Sbjct: 336 S--KLVFNFGGINYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLEN 393

Query: 451 LEVSMAQANFDSS----LPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIF 501
            E+ +A A+FDSS      ++V  + S +P AV+A  YS  W +   + TGG++F
Sbjct: 394 KEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMF 448

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 29/56 (51%), Positives = 39/56 (69%), Gaps = 4/56 (7%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           L KRD  D    + + N+ +FYS ++E+GTP Q + V+VDTGSSDLWV+G DN  C
Sbjct: 56  LVKRDGED----IVLTNRNTFYSAEIEVGTPAQTMNVIVDTGSSDLWVIGHDNLTC 107

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  222 bits (566), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 138/367 (37%), Positives = 206/367 (56%), Gaps = 41/367 (11%)

Query: 145 PARTTDSAAEATVQ-------CSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGID 197
           PA  T + +E T         C     F+ + S++  SNNT F   + D ++ASG+W  D
Sbjct: 145 PANHTANFSENTFAFKNHAFPCYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQD 204

Query: 198 TMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQY 257
           T+ +  + +   +F VA  +N+++G LG+GL G E+TN+   T              Y Y
Sbjct: 205 TIEVGSIIIEKFNFGVAQETNATIGSLGLGLEGNEITNEGDYT--------------YTY 250

Query: 258 ANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSA 316
            NFP  LKN G+I +V YS++      ++GS+LFGAV+HS+Y G TLYT+PLV++  ++A
Sbjct: 251 ENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSLLFGAVEHSRYVGDTLYTLPLVNV--NNA 308

Query: 317 SSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYD 376
           SS PVEF +TL  L V  + + +TI +    ALL++G  ++Y P  L ++  +K   +  
Sbjct: 309 SSDPVEFHVTLQNLVVSVNKTNTTIMSDRYAALLNTGAIVTYLPTHLFSDFIKKTGLSES 368

Query: 377 SR-SGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ-----TCVLAIGPQQEN 430
            +  G Y   CS   S  +  +DFGGF I + L+D++ +          C + I    E 
Sbjct: 369 QKYYGMYVTDCS---SEISFSYDFGGFKIESSLNDYLFEIDESEIPGAKCAVTINSHDEK 425

Query: 431 WVVLGDVFLSNAYVVYDLENLEVSMAQA-----NFDSSLPE---SVEVISSTVPSAVKAA 482
           ++VLG  F S+AYVV+DLE LEVS+AQA     NF  S  E    VE++  ++PSA KAA
Sbjct: 426 YLVLGSGFFSSAYVVFDLERLEVSIAQAAHVYDNFTYSNIEDNPDVEIVIDSIPSATKAA 485

Query: 483 SYSNPWS 489
           SYSN W+
Sbjct: 486 SYSNTWT 492

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  213 bits (542), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 128/357 (35%), Positives = 201/357 (56%), Gaps = 23/357 (6%)

Query: 154 EATVQCSTYGTFDHSKSSTFKS-NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212
           + ++ C +  T++  +SST++   N  F I+Y D ++A GSWG +T+SIN +++  + F 
Sbjct: 99  KPSIDCRSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFG 158

Query: 213 VANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           VA Y+ + + GVLGIG P  E            K    A +  Y   NFP +LK++ II 
Sbjct: 159 VAKYATTPVSGVLGIGFPRRE----------SVKGYEGAPNEYY--PNFPQILKSEKIID 206

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
            VAYSLFLN P    GS++FGA+D SK++G L+T P+V+ Y  +    P    +T+ GLG
Sbjct: 207 VVAYSLFLNSPDSGTGSIVFGAIDESKFSGDLFTFPMVNEY-PTIVDAPATLAMTIQGLG 265

Query: 332 VDKDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYD 389
                S    T  TT  P LLDSGT++   P  +A+++A   NA+Y    G Y + C   
Sbjct: 266 AQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVS 325

Query: 390 TSNTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLGDVFLSNAYVVYD 447
             +    FDFG   I+ PL   ++   ++   C  A+ P  ++ +VLGDVFLS+AYVV+D
Sbjct: 326 VGDVEYNFDFGDLQISVPLSSLILSPETEGSYCGFAVQPTNDS-MVLGDVFLSSAYVVFD 384

Query: 448 LENLEVSMAQANFDSSL--PESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           L+N ++S+AQAN+++S    + V + +    S  K A+ + PWS+    +   +I++
Sbjct: 385 LDNYKISLAQANWNASEVSKKLVNIQTDGSISGAKIAT-AEPWSTNEPFTVTSDIYS 440

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%)

Query: 9  DNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          D T     +    +  +Y+  L+IGTP Q +TVL DTGS+D WVM + NP C
Sbjct: 28 DGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFC 79

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  210 bits (535), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 136/362 (37%), Positives = 191/362 (52%), Gaps = 27/362 (7%)

Query: 152 AAEATVQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVS 210
           A   T+ C      D + SS F+  N   F I+Y D S+  G W  D +S    ++SG+ 
Sbjct: 99  AITETIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQ 158

Query: 211 FAVANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGI 269
           F VA Y++  + G+LG+G P  E            +    A +  Y   NFP +LK DGI
Sbjct: 159 FGVAQYASEEIPGILGLGFPRRESV----------RGYPGAPNKFYD--NFPQMLKKDGI 206

Query: 270 IHKVAYSLFLNDPQ-EQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLY 328
           I  VAYS++LNDP     GSVLFG VD SKY+G LYT P+ + Y +  S KP    +TL 
Sbjct: 207 IDVVAYSMYLNDPNGSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNIVS-KPATLAVTLQ 265

Query: 329 GLGVDK--DGSQSTIATTTIPALLDSGTTISYFPAQLANEIAR--KFNATYDSRSGFYTM 384
           G G  K  +G Q T  T     LLDSGT++   P ++ +++A     NA +    G Y M
Sbjct: 266 GFGAQKKSEGRQETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVM 325

Query: 385 SCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQT-CVLAIGPQQENWVVLGDVFLSNAY 443
            C     +T  VFDFG   I  P+   ++  S ++ C L + P+   W  LGDVFLS AY
Sbjct: 326 DCPPKDDDTEFVFDFGDLQIAVPVSTLILPPSGESYCGLGVLPKDGTWT-LGDVFLSYAY 384

Query: 444 VVYDLENLEVSMAQANFDSSLPESVEV---ISSTVPSAVKAASYSNPWSSAVMMSTGGNI 500
           +V+DL+N +VSMA+A F     +S ++      T+P A  A+  + PWSS+   +  G+I
Sbjct: 385 LVFDLDNYKVSMAKAKFSGDGDQSPQIKIQTDGTIPGAKSAS--AKPWSSSEPSTVSGSI 442

Query: 501 FT 502
           FT
Sbjct: 443 FT 444

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 8/69 (11%)

Query: 5  LAKRDNT----DGYS--LMDVQNQVS--FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD 56
          L K+D +    DG S  LM     VS  FYS  LEIG+P QK+ ++VD+GS+D WVM + 
Sbjct: 18 LVKKDGSNNGGDGNSGTLMLSLKHVSDEFYSTTLEIGSPAQKLDLVVDSGSADTWVMAST 77

Query: 57 NPLCASGRR 65
          NP C+S  +
Sbjct: 78 NPFCSSNAK 86

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  210 bits (534), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 125/337 (37%), Positives = 176/337 (52%), Gaps = 21/337 (6%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANY 216
           + C   G FD   S +  +    F+  Y D SY+ G W +D +SI    V  + FAVAN 
Sbjct: 116 LDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANI 175

Query: 217 SNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYS 276
           S++  GVLG+GLP LE         +              Y NFP  LK++ +I++V YS
Sbjct: 176 SSAPSGVLGVGLPRLEAVRGYDGAPNA------------NYDNFPQTLKSNRLINRVLYS 223

Query: 277 LFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV--DK 334
           L+ +    + G+VLFG +D  KY G LYT+PLV+IY      +P  FDITL GLG+  + 
Sbjct: 224 LYFDSGDLESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSES 281

Query: 335 DGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTN 394
           +   + IA    PALLDSG+TI   P +    IA++  A +    G Y + C     +  
Sbjct: 282 NCKDTVIAHKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRT 341

Query: 395 LVFDFGGFHITAPLDDFV-VQQSSQT-CVLAIGPQQENWVVLGDVFLSNAYVVYDLENLE 452
             FDFG   +  P+ D + + +S Q  C LAI    E W +LGD+ L +AYVVYDL+NLE
Sbjct: 342 FYFDFGELKLKVPIHDLLYLPESGQNYCGLAIIASGEEW-ILGDLVLKSAYVVYDLDNLE 400

Query: 453 VSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWS 489
           +S+AQ    S     ++ +S+T        S S PWS
Sbjct: 401 ISIAQVKTTSG--SRIQTVSATGSLPQTRKSNSTPWS 435

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 28/43 (65%)

Query: 22 QVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          Q  FY+V+L +GTP QK+  + DTGSSDLWV    NP C   +
Sbjct: 56 QDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCLGNK 98

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  210 bits (534), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 201/349 (57%), Gaps = 20/349 (5%)

Query: 160 STYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNS 219
           ++YG F    S++ K N T F+  Y D + A G W  DT+++    VS V+FAV N ++S
Sbjct: 107 ASYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDS 166

Query: 220 SMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFL 279
           + GVLG+GL GLE T               A SS YQY NFP+ L   G+I   AYSL+L
Sbjct: 167 NFGVLGLGLTGLEAT------------YTNALSSPYQYDNFPVKLVRQGLIQANAYSLYL 214

Query: 280 NDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQS 339
           N      G+VLFGAVDH+KYTGTL+T+P V+       +  +EF +TL G+ +  +  Q+
Sbjct: 215 NKADASSGNVLFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQT 274

Query: 340 TIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDF 399
           T+ T+  P L+DSG T SY P  L  +IA +  ATY +    Y ++C  +  +T + ++F
Sbjct: 275 TLTTSKFPVLVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDDDTVISYNF 334

Query: 400 GGFHITAPLDDFVVQ--QSSQTCVLAIGPQQENWVVLGDVFLSNAYV--VYDLENLEVSM 455
           GGF+I  PL   V +    S TC+L I P    +  LGD FL N Y    + +E+L  S+
Sbjct: 335 GGFNIDTPLSGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESL--SL 392

Query: 456 AQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMSTGGNIFTVE 504
           AQA +     E +E+ISS++P A+KAA YS+ WS++   ST GN+   E
Sbjct: 393 AQAQYTDE--EEIEIISSSIPGAIKAAGYSDIWSASAKNSTSGNVKRAE 439

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 37/55 (67%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD 56
           +  ++    ++ Y  + ++N+  FYS+DL IG+  Q VTVLVDTGSSDLWV G D
Sbjct: 50  KRSMSHIKRSENYEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDLWVPGPD 104

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  207 bits (526), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 129/357 (36%), Positives = 203/357 (56%), Gaps = 27/357 (7%)

Query: 156 TVQCSTYGTFDHSKSSTFKS-NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
           +V CS+  T++ + SST++  +N  F I Y D +++ GSWG +T+S+N +++  + F +A
Sbjct: 101 SVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLA 160

Query: 215 NYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
            Y+ + + GVLGIG P  E          G  D          Y NFP +LK++ II  V
Sbjct: 161 KYATTPVSGVLGIGFPRRESVKGYE----GAPD--------KYYPNFPQLLKSEQIIDVV 208

Query: 274 AYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV- 332
           AYSLFLN P    GS++FGA+D SK+ G L T P+V+ Y  +    P    +T+ GLG  
Sbjct: 209 AYSLFLNSPDSGMGSIVFGAIDESKFYGDLLTFPMVNEYP-TIVDAPATLAMTIQGLGAQ 267

Query: 333 DKDGSQ-STIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
           +K G +  T  TT  P LLDSGT++   P  +A+++A   NA+Y +  G Y ++C     
Sbjct: 268 NKSGCERETFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSAD 327

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLGDVFLSNAYVVYDLE 449
           +    FDFG   I  PL   ++    +   C  A+ P  ++ +VLGDVFLS+AYVV+DL+
Sbjct: 328 DIEYTFDFGDLQINVPLTSLILSPEVEGGYCGFAVQPTNDS-MVLGDVFLSSAYVVFDLD 386

Query: 450 NLEVSMAQANFDSSLPESVEVIS----STVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           N ++S+AQAN+++S  +S +VI+     ++P    A   + PWS+    +   +I++
Sbjct: 387 NYKISLAQANWNAS-EDSKQVINIPTDGSIPGGKSAT--AEPWSTNEPFTVTSDIYS 440

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 29/37 (78%)

Query: 25 FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
          +Y+  L+IGTP Q++TVL DTGS+D WVM + NP C+
Sbjct: 44 YYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCS 80

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  205 bits (521), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/355 (36%), Positives = 189/355 (53%), Gaps = 24/355 (6%)

Query: 148 TTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS 207
           T D+       CS+  T++  +SSTF      F I Y +T ++ G W  D + I   +VS
Sbjct: 99  TNDNEQNMASFCSSSRTYNFQRSSTFTPTGYKFFIDYVNT-FSRGIWAKDRLVIGNADVS 157

Query: 208 GVSFAVANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKN 266
           G+ F V+N SN+++ G+LG+G   LE     S   +              Y N PM+LK 
Sbjct: 158 GLQFGVSNISNTTINGILGVGYERLESVKGYSGAPNRT------------YPNLPMLLKE 205

Query: 267 DGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDIT 326
            G I KVAYS+FLN       +V FG VD  KYTG LY  PLV+IY   +  +P +F IT
Sbjct: 206 SGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGDLYKFPLVNIY--KSIPRPSKFHIT 263

Query: 327 LYGLGVDKDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM 384
           L  L V  + S    T++ T +PAL D+GT     P  +A  IA   +AT+D +   Y  
Sbjct: 264 LQALEVHGNYSSLNKTVSNTPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLF 323

Query: 385 SCSYDTSNTNLVFDFGGFHITAPLDDFVV---QQSSQTCVLAIGPQQENWVVLGDVFLSN 441
           +C  +  +T LVFDFG   I APL +F+V   +  ++ C +AI P+   +  LG  FL +
Sbjct: 324 ACPAEEDDTKLVFDFGDIQIEAPLANFIVPAAELGTEQCGVAIIPEDGTF-TLGIPFLRS 382

Query: 442 AYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPWSSAVMMST 496
            YVVY+LE+ EV++AQAN+       +  I S +P A +A   + PW++ +  ST
Sbjct: 383 TYVVYNLEDYEVALAQANWKWDGKSKITPIISNIPGATQAT--ATPWNTNMEQST 435

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 38/61 (62%)

Query: 2  REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61
          +EW    ++ +    MD+ N    Y  ++E+GTPPQK+ VL DTGS+DLW   +DN  CA
Sbjct: 28 QEWDDTSNDGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCA 87

Query: 62 S 62
          +
Sbjct: 88 A 88

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/356 (35%), Positives = 197/356 (55%), Gaps = 25/356 (7%)

Query: 156 TVQCSTYGTFDHSKSSTFKS-NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
           +V C +  T+    SST+++ +N  F I Y D ++A G+WG +T+SI+ + +  + F +A
Sbjct: 101 SVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLA 160

Query: 215 NYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
            Y+ + + GVLGIG P  E            K    A +  Y   NFP +LK++ II  V
Sbjct: 161 KYATTPVSGVLGIGFPRRE----------SVKGYEGAPNKYY--PNFPQILKSEQIIDVV 208

Query: 274 AYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD 333
           AYSLFLN P+   GS++FGA+D SK++G L+T P+V+ Y +   + P    +T+ GLG  
Sbjct: 209 AYSLFLNSPESGTGSIIFGAIDESKFSGDLFTFPMVNEYPNIVDT-PATLAMTIQGLGAQ 267

Query: 334 KDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
              S    T  TT  P LLDSGT++   P  +A+++A   NATY +  G Y + C     
Sbjct: 268 NKNSCEYETFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFAD 327

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLGDVFLSNAYVVYDLE 449
                FDFG   I+ PL   ++   ++   C  A+ P  ++ +VLGDVFLS+AYVV+DL+
Sbjct: 328 EIEYTFDFGDLKISVPLTSLILSPEAEGGYCGFAVQPTNDS-MVLGDVFLSSAYVVFDLD 386

Query: 450 NLEVSMAQANFDSSLPESVEV---ISSTVPSAVKAASYSNPWSSAVMMSTGGNIFT 502
           N ++S+AQAN+D S   +  V      ++P    A   + PW++    +   NIF+
Sbjct: 387 NYKISLAQANWDVSEITTKLVNVRADGSIPGGKTAT--AEPWTANEPFTVTSNIFS 440

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 33/54 (61%)

Query: 25 FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKKFLGDEGDARV 78
          +Y+  L+IGTP Q++TVL DTGS+D W+M + NP C S      +L    D  +
Sbjct: 44 YYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFCLSTSSTSSYLNATYDGSI 97

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  205 bits (522), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 132/343 (38%), Positives = 188/343 (54%), Gaps = 25/343 (7%)

Query: 157 VQCSTYGTFDHSKSSTFKSNNTA-FAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           + C   GTFD++ SS+F+  +   F I Y D S+A G W  + + +N +++S + F VA+
Sbjct: 122 IDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVAD 181

Query: 216 YSNSSMG-VLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
           Y+   +G VLGIG P  E       +  G  D   A +  Y   NFP VLKN+G+I   A
Sbjct: 182 YATVPVGGVLGIGFPRRE-------SVKGYDD---APNEFY--PNFPQVLKNEGVIGVAA 229

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK 334
           YS+FLN+     GS+LFGAVD +KYTG+LYT P+V+ Y +    KP    +TL  LG   
Sbjct: 230 YSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPMVNEYPN-VVDKPATLAMTLQALGAKS 288

Query: 335 DGS--QSTIATTTIPALLDSGTTISYFPAQLANEIA-RKFNATYDSRSGFYTMSCSYDTS 391
           D S    T  TT    LLDSGTT+   P ++A E+A   +  TY+   G +   C  D  
Sbjct: 289 DSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSDDD 348

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQSSQ-TCVLAIGPQQENWVVLGDVFLSNAYVVYDLEN 450
           +T  +FDFG   IT PL   V+  S    C   + P   + + LG +FLS+AYVVYDL+N
Sbjct: 349 DTEFIFDFGDLKITLPLASLVISSSGDGHCGFGLTPASYS-MTLGAIFLSSAYVVYDLDN 407

Query: 451 LEVSMAQANFDSSLPESVEV---ISSTVPSAVKAASYSNPWSS 490
            ++S+AQA +D +  +   V      T+  A KA   + PW++
Sbjct: 408 YQISIAQAKWDGNPSQKSRVRIPKDGTIYGATKAT--ATPWTT 448

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 25/60 (41%), Positives = 39/60 (65%), Gaps = 5/60 (8%)

Query: 2   REWLAKRDNTDGYSLMDVQNQVS-FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           +  L +R +T+    +D+Q++   +YS  LEIGT  Q++ VL D+GSSD+WV  + NP C
Sbjct: 47  KRKLQRRKSTE----IDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYC 102

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  202 bits (515), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 122/354 (34%), Positives = 196/354 (55%), Gaps = 25/354 (7%)

Query: 157 VQCSTYGTFDHSKSSTFKS-NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           V CS   T++ ++S++F+  NN  F I YGD ++A G WG +T     + +  V F +A+
Sbjct: 115 VDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLAD 174

Query: 216 YSNSSMG-VLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
           Y+ + +G VLGIG    E     +N                 Y NFP VLKN+GII  VA
Sbjct: 175 YATTPIGGVLGIGFQRRESVKGYTNAPE------------VFYPNFPQVLKNEGIIDTVA 222

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVD- 333
           YSL L     Q   ++FGA+D + Y G + T P+++++ + A SKP    IT+ GLG   
Sbjct: 223 YSLSLG----QSSHIMFGAIDRNSYIGDMVTFPMINMFPN-AVSKPATLSITIQGLGAQN 277

Query: 334 -KDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN 392
            ++    T +TT  PALLDSG+T+   P ++A+++A    A +    G YT+ C  DT+N
Sbjct: 278 KQECKFQTFSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTN 337

Query: 393 TNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-ENWVVLGDVFLSNAYVVYDLENL 451
            + +FDFG    T PL + ++     + V   G Q+ +N +VLGDVFL +  VV+DL++ 
Sbjct: 338 IDYIFDFGDMKFTLPLSNLILPSQGGSNVCGFGLQRSDNEIVLGDVFLCSTLVVFDLDHY 397

Query: 452 EVSMAQANFDSSLPESVEVIS-STVPSAVKAASYSNPWSSAVMMSTGGNIFTVE 504
           ++S+A++N  SS  + V + S   +P A+ A + +  W++   ++   ++F  E
Sbjct: 398 QISLAKSNQKSSAEDIVNIPSDGKIPGAIIAKAEA--WTTYEPITATTDMFETE 449

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 5/59 (8%)

Query: 5  LAKRDNTDGYSLMDVQ-NQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
          LAKR++       D+Q    SFY+  L+IG PPQ++TV+ D+GS+D WVM   NP C S
Sbjct: 39 LAKRNHLK----FDLQFEDESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLS 93

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  186 bits (473), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/322 (35%), Positives = 177/322 (54%), Gaps = 23/322 (7%)

Query: 154 EATVQCSTYGTFDHSKSSTFKS-NNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212
           +  + CS    +D  KS TF    N  F I Y DT+Y SG W +D +++ + ++  + F 
Sbjct: 97  KCLIDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFG 156

Query: 213 VANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
           +A  +N++  GVLGIG P +E  N     A GK            Y NFP+ LKN G  +
Sbjct: 157 MAFATNATFSGVLGIGFPAMESVNGY-EFAPGKF-----------YPNFPLALKNAGFTN 204

Query: 272 KVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG 331
             AYS+  ND + ++GS+LFG++D S++ G LYT P+++ +   A  +P    +TL G+G
Sbjct: 205 IAAYSIEYND-ESKKGSILFGSIDTSRFIGPLYTFPMINEFPGIAD-EPSTLSLTLDGIG 262

Query: 332 VDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYD-- 389
           +D    Q  I+ T +PALLD+G+T+   P  +   IA   NAT+    G + ++C  D  
Sbjct: 263 IDGSCEQWVISNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDF 322

Query: 390 TSNTNLVFDFGGFHITAPLDDFVV---QQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVY 446
            + T+L F FG  H+  PL  F++   ++S+  C L I    +  V+LGD FL++ Y V+
Sbjct: 323 LTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCGLGIT-SSKGRVILGDSFLTHVYTVF 381

Query: 447 DLENLEVSMAQANFDSSLPESV 468
           DL+N  +S+A     SSLP  V
Sbjct: 382 DLDNYMISLAPMA-KSSLPGKV 402

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 43/87 (49%), Gaps = 3/87 (3%)

Query: 25  FYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC---ASGRRGKKFLGDEGDARVEIE 81
           +Y   LE GTPPQ + +++DTGSSDLWV    NPLC    SG+  K  +   G    +++
Sbjct: 52  YYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCSGLVFYDMD 111

Query: 82  AQQKDEWVTTGVVTITLGDLPPGGNIW 108
             Q  +++      I   D      IW
Sbjct: 112 KSQTFDYLKNVTFKIGYADTTYTSGIW 138

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  180 bits (457), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/228 (45%), Positives = 139/228 (60%), Gaps = 6/228 (2%)

Query: 262 MVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPV 321
           M LK+ G I K+AYSLFLN+P+   GS+LFGAVD SKY+G LYT+P++  Y    S  P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 322 EFDITLYGLGV-DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
            F +T   + V + D    T++    P L DSGTT S  P ++A+ I + F+  Y S   
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLS 440
            YT  CS    +T L  DFGGF+I+A + +FV +     C+L I      + VLGD FL 
Sbjct: 120 GYTFDCS-KVKDTLLSIDFGGFNISANISNFVTRTKDH-CLLNIEAADSGF-VLGDAFLV 176

Query: 441 NAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSNPW 488
           +AYVV+DLE+ EVS+AQA+FD    E +EVIS  VP A++A  YS+ W
Sbjct: 177 DAYVVFDLESHEVSIAQASFDDK-KEEIEVISDRVPGAIRAPGYSSTW 223

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  186 bits (471), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/362 (33%), Positives = 199/362 (54%), Gaps = 33/362 (9%)

Query: 156 TVQCSTYGTFDHSKSSTFK---SNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFA 212
           T+ CS +  ++   SST++   ++N+ F + Y D S+  G W  +T+ I+  N++ +  A
Sbjct: 113 TIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNYNITSLQLA 172

Query: 213 VANYSNSSMG-VLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQY-ANFPMVLKNDGII 270
           VANY+ + +G +LGI  P              ++ +     +L +Y  NFP VLKN+ II
Sbjct: 173 VANYATTPVGGLLGISFPR-------------RESVKGYDGALNEYYPNFPQVLKNENII 219

Query: 271 HKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGL 330
             V YS++LND   Q+GS+LFGA+D SK+ G + T P+V++Y +    KP    +T+ G+
Sbjct: 220 DIVLYSMYLND-LNQDGSLLFGAIDTSKFEGDMITYPMVNVYPNVVD-KPATLALTIQGV 277

Query: 331 GVDK--DGSQS-TIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS 387
                 D +Q+ T  T+  P LLDSGTT+   P +LA+++A   NATY      Y ++C 
Sbjct: 278 AAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCP 337

Query: 388 YDT--SNTNLVFDFGGFHITAPLDDFVV--QQSSQTCVLAIGPQ-QENWVVLGDVFLSNA 442
                ++   +FDFGG  +  PL+ F++     S  C   + P+   + +VLGD+FLS  
Sbjct: 338 SQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFV 397

Query: 443 YVVYDLENLEVSMAQANFDSSLPESVEVISSTVPS--AVKAASYS--NPWSSAVMMSTGG 498
           Y V+DL++ ++S+A  N +++  ES E     +PS  A+  A  +   PWS+   ++   
Sbjct: 398 YAVFDLDHYQISLANINKNAN-SESNEDSIINIPSNGAIPGAKVATVKPWSTHEPITVTT 456

Query: 499 NI 500
           NI
Sbjct: 457 NI 458

 Score = 63.5 bits (153), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 43/61 (70%), Gaps = 1/61 (1%)

Query: 1  MREWLAKRDNTDGYSLMDVQN-QVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPL 59
          +   + KR++  G+  M +++ Q ++Y+  L++GTPPQ +TVL+D+GSSD W+M + NP 
Sbjct: 30 LSNRINKRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPF 89

Query: 60 C 60
          C
Sbjct: 90 C 90

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  174 bits (441), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 115/332 (34%), Positives = 171/332 (51%), Gaps = 25/332 (7%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           ++ C    TF +  S+T +     F I Y DT +  GSW  D + I   +VSG+ F V  
Sbjct: 98  SIDCRGIKTFCNESSTTLRILPNPFYIDYADT-FVDGSWATDRLVIGGHDVSGMKFGVGR 156

Query: 216 YSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
            SN+ + GVLG+G   LE            +  A A ++   Y N P  LK DG + K+A
Sbjct: 157 TSNTELSGVLGVGHANLESV----------RGYAGAPNA--TYPNLPRQLKLDGSVQKLA 204

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK 334
           YS+ L    E++G +LFGA+D SKY G L+T P+++I  D   + P  F I L G+ + +
Sbjct: 205 YSVSLQKTSERDGEILFGAIDTSKYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDI-Q 261

Query: 335 DGSQST---IATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTS 391
            G  ST   +  ++  ALLD+GT      + LA +I    NATYD+    + + C  +  
Sbjct: 262 GGRSSTGRPLINSSFHALLDTGTG-GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTEDD 320

Query: 392 NTNLVFDFGGFHITAPLDDFVVQQS---SQTCVLAIGPQQENWVVLGDVFLSNAYVVYDL 448
                F+FG   I  P+ +FVV  S   +  C LAI P       LG  FL   Y V++L
Sbjct: 321 TRQFNFNFGELQIAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNL 380

Query: 449 ENLEVSMAQANFDSSLPESVEVISSTVPSAVK 480
           E+ E+SMA+AN +   P+ +  I + VP+A++
Sbjct: 381 EDNEISMARANTNPQEPD-IRPIPAGVPAAIR 411

 Score = 61.2 bits (147), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 37/57 (64%)

Query: 12 DGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKK 68
          DG+  M + +    Y +++E+GTPPQK+  ++DTGS+DLW+   +NP C   +  K+
Sbjct: 32 DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQ 88

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  167 bits (423), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 95/235 (40%), Positives = 137/235 (58%), Gaps = 13/235 (5%)

Query: 228 LPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEG 287
           LP +E T+++ N       + +  ++ Y Y NFPM LK  G I K+AYSLFLN+P  + G
Sbjct: 1   LPSVEETDEIEN-------VMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFG 53

Query: 288 SVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEF---DITLYGLG-VDKDGSQSTIAT 343
           S+LFGAVD SKY+G LYT+P++  Y+   SS  +E     + +  +  +D      T++ 
Sbjct: 54  SILFGAVDKSKYSGQLYTLPMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSE 113

Query: 344 TTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFH 403
              P L DSGT+ S  P ++A+ I R F+  Y S +  Y   CS   +NT L  DFGGF+
Sbjct: 114 VQFPVLFDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDCS-KVNNTLLSIDFGGFN 172

Query: 404 ITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQA 458
           I+A + + V   +   C+L I      + VLGD FL + YVV+DLE+ EVS+AQA
Sbjct: 173 ISANISNSVTPITKDHCLLNIEADDSGY-VLGDAFLIDTYVVFDLESHEVSVAQA 226

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  164 bits (415), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 115/351 (32%), Positives = 184/351 (52%), Gaps = 28/351 (7%)

Query: 146 ARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLN 205
           A  T S ++A  QC     F    SS+F  N+  F + Y D SYA+G+W  DT S    +
Sbjct: 130 ANETASRSDA-YQCKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPS 188

Query: 206 VSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLK 265
              V+ A+ + +N ++G LG+GL   + TNQ         D    +S LY+       LK
Sbjct: 189 FYNVNIALVSETNLTVGSLGLGLRANQATNQ-------GDDPFVYNSLLYR-------LK 234

Query: 266 NDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTG-TLYTVPLVDIYHDSASSKPVEFD 324
             G I K+AYS++ ++     G + FG + H  Y G  LYT+PLV++  D    +P  F 
Sbjct: 235 TQGWIEKIAYSVYTSELNGTGGGIFFGGLYHDLYKGNVLYTLPLVNV--DPELDEPARFH 292

Query: 325 ITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG-FYT 383
           ITL  L    +G+  ++ +   PALL +G+  +Y P +L +    + +    ++    Y 
Sbjct: 293 ITLQNLTTSINGTNFSVLSEKYPALLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYV 352

Query: 384 MSCSYDTSNTNLVFDFGGFHITAPLDDFVVQ-QSSQT----CVLAIGPQQENWVVLGDVF 438
           + C    +N   ++DFGGF I  PL  +  + +S++T    C + + P  ++++ LG+ F
Sbjct: 353 IPCD---TNATFIYDFGGFEIETPLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGF 409

Query: 439 LSNAYVVYDLENLEVSMAQANFDSSLPE-SVEVISSTVPSAVKAASYSNPW 488
            +  YV+++LE+LE+SMA A+    L     E I S++PSA +AASYSN W
Sbjct: 410 FAATYVLFNLEDLEISMAPASGIEYLDAFDYEYIESSIPSASRAASYSNTW 460

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 23/33 (69%)

Query: 30  LEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           + +GTP Q +  L+DT SSD+W++ +++  C S
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCES 114

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  130 bits (328), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 79/234 (33%), Positives = 129/234 (55%), Gaps = 15/234 (6%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           ++ C+ +GT+   KSST    +    I YGD S+A G W  DT++I   ++  V F ++N
Sbjct: 111 SINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGISN 170

Query: 216 YSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
            +++ + GVLG+G    E  +    + +              Y N P  LK+  I +  A
Sbjct: 171 NASTIISGVLGLGFLRTESIDGYDGSPNK------------LYYNLPAYLKDQEITNTNA 218

Query: 275 YSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDK 334
           +SLFLN+  +  G+VLFG +D+SK++G L T PLV+IY     ++P  F ITL  L    
Sbjct: 219 FSLFLNNSNDASGTVLFGGIDYSKFSGDLVTFPLVNIY-PKLINEPCTFTITLQQLYGKI 277

Query: 335 DGSQST-IATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS 387
           +G +S  +    +PALLDSG+++   P ++ +EIA   N+T D+ +  + ++CS
Sbjct: 278 NGGKSIGLIKEKVPALLDSGSSLISMPIEITDEIALMVNSTLDTMTSLHNINCS 331

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 14 YSLMDVQNQV-SFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
          Y  +D+Q     FYS  L  G P Q VTVLVDTGSSDLWV   +N  C
Sbjct: 52 YLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYC 99

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  127 bits (319), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 97/327 (29%), Positives = 159/327 (48%), Gaps = 39/327 (11%)

Query: 157 VQCSTYGTFDHSKSSTFKS--NNTAFAISYGDTSYASGSWGIDTMSINK----------- 203
           + C+ +  F+ S S TF +   N+ F I Y D SY  G WG+D++SIN            
Sbjct: 70  IDCTGFTFFNKSNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTGL 129

Query: 204 -LNVSGVSFAVANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFP 261
             N+    FA+A  SN  +  VLG+G P  E  N       G K    A++    Y N P
Sbjct: 130 YANIPNAQFAIATNSNVPVQAVLGLGFPRREAVN-------GYK---LATNKF--YPNLP 177

Query: 262 MVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPV 321
            ++K  G    V  +++L    E   S++FGA D ++Y G L+  P+V+ Y +  + KP 
Sbjct: 178 QLIKQHGYSDNVTIAMYLGS-NETYNSIMFGAYDKTRYIGDLHNFPMVNQYPN-VTDKPA 235

Query: 322 EFDITLYGLGVDKDGSQSTIATTT----IPALLDSGTTISYFPAQLANEIARKFNATYDS 377
            F ITL  + +  D +QS     +       +LDSGT++   P    ++IA   NAT+D+
Sbjct: 236 TFAITLDSMYISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDN 295

Query: 378 RSGFYTMSCSYDTS---NTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ--ENWV 432
            +  Y +    D +   +  + F F  F++   + +F++     + V AI P +      
Sbjct: 296 TTHMYLLPSETDLTLYKDMIINFKFMDFNVPINMLEFILPY-DDSYVFAILPTKNVNTGF 354

Query: 433 VLGDVFLSNAYVVYDLENLEVSMAQAN 459
           VLGD+FL + Y +++L+N  +S+  +N
Sbjct: 355 VLGDIFLPHVYTIFNLDNYTISLGLSN 381

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (70%)

Query: 24 SFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64
          S+Y  ++ IG PPQ + VLVDTGSSDLWV   +NP C +G 
Sbjct: 29 SYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGN 69

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score =  107 bits (267), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 106/185 (57%), Gaps = 12/185 (6%)

Query: 325 ITLYGLGVDKDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFY 382
           +T+ GLG     S    T  TT  P LLDSGT++   P  +A+++A   NA+Y +  G Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 383 TMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLGDVFLS 440
            + C   T +    FDFG   I  PL   ++   ++   C  A+ P  ++ +VLGDVFLS
Sbjct: 61  ILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTNDS-MVLGDVFLS 119

Query: 441 NAYVVYDLENLEVSMAQANFDSSLPESVEVIS----STVPSAVKAASYSNPWSSAVMMST 496
           +AYVV+DL+N ++S+AQAN+++S  +S ++++     ++PS   A   + PWS+ V  + 
Sbjct: 120 SAYVVFDLDNYKISLAQANWNAS-NDSKQLVNIPTDGSIPSGKSAT--AQPWSTNVPFTV 176

Query: 497 GGNIF 501
             +I+
Sbjct: 177 TSDIY 181

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score =  109 bits (273), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 66/190 (34%), Positives = 107/190 (56%), Gaps = 12/190 (6%)

Query: 320 PVEFDITLYGLGVDKDGS--QSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDS 377
           P    +T+ GLG     S    T  TT  P LLDSGT++   P  +A+++A   NA+Y +
Sbjct: 206 PATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSA 265

Query: 378 RSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQ--TCVLAIGPQQENWVVLG 435
             G Y + C   T +    FDFG   I  PL   ++   ++   C  A+ P  ++ +VLG
Sbjct: 266 DEGIYILDCPESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTNDS-MVLG 324

Query: 436 DVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVIS----STVPSAVKAASYSNPWSSA 491
           DVFLS+AYVV+DL+N ++S+AQAN+++S  +S ++++     ++PS   A   + PWS+ 
Sbjct: 325 DVFLSSAYVVFDLDNYKISLAQANWNAS-NDSKQLVNIPTDGSIPSGKSAT--AQPWSTN 381

Query: 492 VMMSTGGNIF 501
           V  +   +I+
Sbjct: 382 VPFTVTSDIY 391

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score =  102 bits (255), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 88/315 (27%), Positives = 138/315 (43%), Gaps = 52/315 (16%)

Query: 159 CSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSN 218
           C  +  FDH +SS++  N++ F++SYG  S   G    DT+ I  L +    FA A    
Sbjct: 137 CLNHARFDHDRSSSYAKNDSRFSVSYGKGS-MEGFVSYDTLKIGDLTIKNQGFAEATVEP 195

Query: 219 SSM-------GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIH 271
            S        G+LG+   GL V + +                 Y+  +        G++ 
Sbjct: 196 GSAFVYGQFDGILGLAYDGLAVNHIVP--------------PFYEAVH-------QGLLD 234

Query: 272 KVAYSLFLNDPQEQE---GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFD-ITL 327
           +  ++ +L+D ++ +   G V+FG  D +K+TG +  +P++       +   VE + ITL
Sbjct: 235 EPVFAFYLSDEKKGDSLAGEVVFGGYDETKFTGEISWLPVI-----RKAYWEVELNSITL 289

Query: 328 YGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS 387
                   GSQ           LD+GT+   FP++L  E   K  AT D   G     CS
Sbjct: 290 --------GSQK-FQLQNYGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCS 340

Query: 388 YDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ----ENWVVLGDVFLSNAY 443
             +   +L F+  G   T    D+VVQ    TC +AI P         V++GDVFL   Y
Sbjct: 341 -GSGFPDLTFELAGRSFTISSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRRWY 399

Query: 444 VVYDLENLEVSMAQA 458
            +YDL    V +A++
Sbjct: 400 SIYDLSKNAVGLAKS 414

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 34/49 (69%), Gaps = 6/49 (12%)

Query: 7   KRDNTDGYSL-MD--VQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           +R +++G+ + +D  V NQ   Y  ++ +GTPPQ   V++DTGSS+LWV
Sbjct: 82  ERASSNGHPIALDNFVNNQ---YYSEIGLGTPPQSFKVVMDTGSSNLWV 127

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 140/325 (43%), Gaps = 64/325 (19%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  + H  SS++K+N T FAI YG  S   G    DT+SI  L +        
Sbjct: 135 GSLACFLHSKYSHDASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEA 193

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+G   + V   +                       P V
Sbjct: 194 TSEPGLAFAFGKFD----GILGLGYDTIAVDKVV-----------------------PPV 226

Query: 264 LK--NDGIIHKVAYSLFLN---DPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASS 318
            K  NDG++ +  ++ +LN   D +E  G V FG +D SKY G +  +P+          
Sbjct: 227 YKAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLPV---------R 277

Query: 319 KPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSR 378
           +   +++   G+G+  + ++         A +D+GT++   P+ LA  +  +  A     
Sbjct: 278 RKAYWEVKFDGIGLGDEYAE----LEGTGAAIDTGTSLIALPSGLAEVLNAEIGAK-KGW 332

Query: 379 SGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVV 433
           SG YT+ C       +L F F G + T    D+ ++ S  +C+ A  P           +
Sbjct: 333 SGQYTVDCESRDQLPDLTFTFNGKNFTISAYDYTLEVSG-SCISAFTPMDFPEPVGPLAI 391

Query: 434 LGDVFLSNAYVVYDLENLEVSMAQA 458
           +GD FL   Y VYDL N  V +AQA
Sbjct: 392 IGDAFLRKFYSVYDLGNNAVGLAQA 416

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  ++ +GTPPQ   V++DTGSS+LWV
Sbjct: 103 YFTEITLGTPPQSFKVILDTGSSNLWV 129

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 86/314 (27%), Positives = 144/314 (45%), Gaps = 42/314 (13%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
            ++ C  +  +DHS SS++K+N T F+I YG  S   G    DT+SI  L +    FA A
Sbjct: 133 GSLACFLHEKYDHSASSSYKANGTDFSIQYGSGS-LEGYISQDTLSIGDLTIPKQDFAEA 191

Query: 215 NYSNSSMGVLGI--GLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
                     G   G+ GL       +T S  K +    ++L Q            ++ +
Sbjct: 192 TSEPGLAFAFGKFDGILGLAY-----DTISVDKVVPPFYNALEQ-----------DLLDE 235

Query: 273 VAYSLFLNDPQ---EQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYG 329
             ++ +L D     E  G  +FG VD SKYTG +  +P+          +   +++ L G
Sbjct: 236 AKFAFYLGDTNKDAEDGGEAIFGGVDKSKYTGDVTWLPV---------RRKAYWEVKLEG 286

Query: 330 LGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYD 389
           LG+  + ++      +  A +D+GT++   P+ LA  I  +  A     +G YT+ C+  
Sbjct: 287 LGLGDEYAE----LESHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGWTGQYTLECNTR 341

Query: 390 TSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVFLSNAYV 444
               +L F+F G++ T    D+ ++ S  +C+ AI P           ++GD FL   Y 
Sbjct: 342 DQLPDLTFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDAFLRKYYS 400

Query: 445 VYDLENLEVSMAQA 458
           +YDLE+  V +A+A
Sbjct: 401 IYDLEHNAVGLAKA 414

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 22/27 (81%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ+  V++DTGSS+LWV
Sbjct: 101 YYTDITLGTPPQQFKVILDTGSSNLWV 127

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 94.4 bits (233), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 141/324 (43%), Gaps = 64/324 (19%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV--------- 206
           ++ C  +  + H  SS++K+N T+FAI YG  S   G    DT+SI  L +         
Sbjct: 131 SLACFLHSKYSHDASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEAT 189

Query: 207 --SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVL 264
              G++FA   +     G+LG+G   + V   +                       P V 
Sbjct: 190 SEPGLAFAFGKFD----GILGLGYDTISVDKVV-----------------------PPVY 222

Query: 265 K--NDGIIHKVAYSLFLN---DPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSK 319
           K  NDG++ +  ++ +LN   D +E  G V FG +D SKY G +  +P+          +
Sbjct: 223 KAINDGLLDEPRFAFYLNNADDSEESTGEVTFGGIDSSKYKGDITWLPV---------RR 273

Query: 320 PVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRS 379
              +++   G+G+  + ++         A +D+GT++   P+ LA  +  +  A     +
Sbjct: 274 KAYWEVKFDGIGLGDEYAE----LQGTGAAIDTGTSLIALPSGLAEVLNSEIGAK-KGWT 328

Query: 380 GFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVL 434
           G YT+ C       +L F F G + T    D+ ++ S  +C+ A  P           ++
Sbjct: 329 GQYTVDCESRDQLPDLTFTFNGKNFTITAYDYTLEVSG-SCISAFTPMDFPEPVGPLAII 387

Query: 435 GDVFLSNAYVVYDLENLEVSMAQA 458
           GD FL   Y +YDL N  V +AQA
Sbjct: 388 GDAFLRKFYSIYDLGNNAVGLAQA 411

 Score = 39.3 bits (90), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  ++ +GTPPQ   V++DTGSS+LWV
Sbjct: 98  YFTEISLGTPPQSFKVILDTGSSNLWV 124

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 92.0 bits (227), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 142/325 (43%), Gaps = 64/325 (19%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS------- 207
            ++ C  +  ++H +SST+K+N +AFAI YG  S   G    D M I  L ++       
Sbjct: 131 GSLACYLHSKYNHDESSTYKANGSAFAIQYGSGS-LEGYISQDVMEIGDLKITKQDFAEA 189

Query: 208 ----GVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G+SFA   +     G+LG+    + V   +                       P V
Sbjct: 190 TSEPGISFAFGKFD----GILGLAYDTIAVNRVV-----------------------PPV 222

Query: 264 LK--NDGIIHKVAYSLFLNDPQEQE---GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASS 318
               N G++ +  ++ +L D  + +   G  +FG +D +K+ G +  +P+          
Sbjct: 223 YNAINQGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDETKFEGDITWLPV---------R 273

Query: 319 KPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSR 378
           +   +++ L GLG+ ++ ++         A +D+GT++   P+ LA  I  +  A     
Sbjct: 274 RKAYWEVKLEGLGLGEEYTE----LENHGAAIDTGTSLITLPSGLAEIINSEIGAK-KGW 328

Query: 379 SGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVV 433
           +G YT+ C    S  ++ F F G++ T    D+ ++ S  +C+ AI P           +
Sbjct: 329 TGQYTIECDKRASLPDMTFTFDGYNFTISPYDYTLEVSG-SCISAITPMDFPEPVGPMAI 387

Query: 434 LGDVFLSNAYVVYDLENLEVSMAQA 458
           +GD FL   Y VYDL N  V +A A
Sbjct: 388 IGDAFLRKYYSVYDLGNDAVGLAPA 412

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 22/27 (81%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D++IGTPPQ   V++DTGSS+LWV
Sbjct: 99  YFADIKIGTPPQSFKVVLDTGSSNLWV 125

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 90.9 bits (224), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 145/323 (44%), Gaps = 60/323 (18%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  +DH  SS++K+N T FAI YG T    G    DT+SI  L +        
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+G           +T S  K +    +++ Q       
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGY----------DTISVDKVVPPFYNAIQQ------- 220

Query: 264 LKNDGIIHKVAYSLFLNDP---QEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
                ++ +  ++ +L D     E  G   FG +D SK+ G +  +P+          + 
Sbjct: 221 ----DLLDEKKFAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV---------RRK 267

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
             +++   G+G+  + ++      +  A +D+GT++   P+ LA  I  +  A     +G
Sbjct: 268 AYWEVKFEGIGLGDEYAE----LESHGAAIDTGTSLITLPSGLAEMINAELGAK-KGWTG 322

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLG 435
            YT+ C+   S  +L+F+F G++ T    D+ ++ S  +C+ AI P           ++G
Sbjct: 323 QYTLDCNTRDSLPDLIFNFNGYNYTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIIG 381

Query: 436 DVFLSNAYVVYDLENLEVSMAQA 458
           D FL   Y +YDL N  V +A+A
Sbjct: 382 DAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ   V++DTGSS+LWV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 144/323 (44%), Gaps = 60/323 (18%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  +DH  SS++K+N T FAI YG T    G    DT+SI  L +        
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+G           +T S  K +    +++ Q       
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGY----------DTISVDKVVPPFYNAIQQ------- 220

Query: 264 LKNDGIIHKVAYSLFLNDP---QEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
                ++ +  ++ +L D     E  G   FG +D SK+ G +  +P+          + 
Sbjct: 221 ----DLLDEKKFAFYLGDTSKDSENGGEATFGGIDESKFKGDITWLPV---------RRK 267

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
             +++   G+G+  + ++         A +D+GT++   P+ LA  I  +  A     +G
Sbjct: 268 AYWEVKFEGIGLGDEYAE----LEGHGAAIDTGTSLITLPSGLAEMINAELGAK-KGWTG 322

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLG 435
            YT+ C+   S  +L+F+F G++ T    D+ ++ S  +C+ AI P           ++G
Sbjct: 323 QYTLDCNTRDSLPDLIFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVG 381

Query: 436 DVFLSNAYVVYDLENLEVSMAQA 458
           D FL   Y +YDL N  V +A+A
Sbjct: 382 DAFLRKYYSIYDLGNDAVGLAKA 404

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ   V++DTGSS+LWV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 90.1 bits (222), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 143/322 (44%), Gaps = 59/322 (18%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS------- 207
           +++ C  +  +DH  SS++K N T FAI YG  S   G    DT+++  L+++       
Sbjct: 137 SSLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGS-LEGYISQDTLNLGDLSITKQDFAEA 195

Query: 208 ----GVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G+ FA   +     G+LG+G   + V   +    +  K                  
Sbjct: 196 TSEPGLQFAFGKFD----GILGLGYDTISVDGVVPPFYNAWK------------------ 233

Query: 264 LKNDGIIHKVAYSLFL-NDPQEQEGSVL-FGAVDHSKYTGTLYTVPLVDIYHDSASSKPV 321
               G++ +  ++ +L  D + Q+G V  FG VD SKY G +  +P+          +  
Sbjct: 234 ---QGLLDEPKFAFYLGRDGESQDGGVATFGGVDDSKYEGEITWLPI---------RRKA 281

Query: 322 EFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGF 381
            +++   G+G+ ++ ++         A +D+GT++   P+ LA  I  +  A   S +G 
Sbjct: 282 YWEVKFDGIGLGEEYAE----LENHGAAIDTGTSLIALPSGLAEIINAEIGAK-KSWTGQ 336

Query: 382 YTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGD 436
           YT+ C   +S  N+ F  GG +      D++++ S Q C+ AI P           ++GD
Sbjct: 337 YTVECEARSSLPNMTFTLGGHNFELTAYDYILEVSGQ-CISAIFPMDFPEPVGPLAIIGD 395

Query: 437 VFLSNAYVVYDLENLEVSMAQA 458
            FL   Y +YDL N  V +A A
Sbjct: 396 SFLRKYYSIYDLGNNAVGLADA 417

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 26/37 (70%), Gaps = 3/37 (8%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           Y  ++ +GTPPQ   V++DTGSS+LWV  T+   C+S
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTE---CSS 138

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 145/323 (44%), Gaps = 60/323 (18%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  +DH  SS++K+N T FAI YG T    G    DT+SI  L +        
Sbjct: 123 GSLACFLHSKYDHEASSSYKANGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 181

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+G           +T S  K +    +++ Q       
Sbjct: 182 TSEPGLTFAFGKFD----GILGLGY----------DTISVDKVVPPFYNAIQQ------- 220

Query: 264 LKNDGIIHKVAYSLFLNDPQ---EQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
                ++ +  ++ +L D     E  G   FG +D SK+ G +  +P+          + 
Sbjct: 221 ----DLLDEKRFAFYLGDTSKDTENGGEATFGGIDESKFKGDITWLPV---------RRK 267

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
             +++   G+G+  + ++      +  A +D+GT++   P+ LA  I  +  A     +G
Sbjct: 268 AYWEVKFEGIGLGDEYAE----LESHGAAIDTGTSLITLPSGLAEMINAEIGAK-KGWTG 322

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLG 435
            YT+ C+   +  +L+F+F G++ T    D+ ++ S  +C+ AI P           ++G
Sbjct: 323 QYTLDCNTRDNLPDLIFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVG 381

Query: 436 DVFLSNAYVVYDLENLEVSMAQA 458
           D FL   Y +YDL N  V +A+A
Sbjct: 382 DAFLRKYYSIYDLGNNAVGLAKA 404

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ   V++DTGSS+LWV
Sbjct: 91  YYTDITLGTPPQNFKVILDTGSSNLWV 117

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 88/319 (27%), Positives = 141/319 (44%), Gaps = 45/319 (14%)

Query: 151 SAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVS 210
           SA   ++ C  +  +DH  SS++K+N ++FAI YG  S   G    DT+SI  L +    
Sbjct: 119 SAECGSLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQD 177

Query: 211 FAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKD--IAAASSSLYQYANFPMVLK--N 266
           FA A              PGL         A GK D  +  A  S+      P V    +
Sbjct: 178 FAEATSE-----------PGLAF-------AFGKFDGILGLAYDSISVDKVVPPVYNAIH 219

Query: 267 DGIIHKVAYSLFLN--DPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFD 324
           +G++ +  +S +L   D     G   FG +D SKY G +  +P+          +   ++
Sbjct: 220 NGLLDEPKFSFYLGNADKSTDGGEATFGGIDSSKYEGNITWLPV---------RRKAYWE 270

Query: 325 ITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM 384
           +   G+G+   G +  I      A +D+GT++   P+ LA  +  +  A     SG Y++
Sbjct: 271 VKFDGIGL---GDEYAILDGH-GAAIDTGTSLIALPSGLAEILNAEIGAK-KGWSGQYSV 325

Query: 385 SCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVFL 439
            C    S  +L  +FGG++ T    D+ ++ S  +C+ A  P           ++GD FL
Sbjct: 326 ECDTRDSLPDLTLNFGGYNFTITPYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFL 384

Query: 440 SNAYVVYDLENLEVSMAQA 458
              Y VYDL N  V +A+A
Sbjct: 385 RKHYSVYDLGNDAVGLAKA 403

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  ++ +GTPPQ   V++DTGSS+LWV
Sbjct: 91  YYTEISLGTPPQNFKVILDTGSSNLWV 117

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/313 (25%), Positives = 139/313 (44%), Gaps = 42/313 (13%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           ++ C  +  +DH  SS++K+N T FAI YG  S   G    DT++I  L +    FA A 
Sbjct: 125 SLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPKQDFAEAT 183

Query: 216 YSNSSMGVLGI--GLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKV 273
                    G   G+ GL       +T S  K +    +++ Q           G++ + 
Sbjct: 184 SEPGLTFAFGKFDGILGLAY-----DTISVDKVVPPFYNAIEQ-----------GLLDEK 227

Query: 274 AYSLFLNDPQEQE---GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGL 330
            ++ +L D ++ E   G +  G +D SK+ G +  +P+          +   +++   G+
Sbjct: 228 KFAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV---------RRKAYWEVKFEGI 278

Query: 331 GVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDT 390
            +   G Q   A     A +D+GT++   P+ LA  I  +  A     +G YT+ C    
Sbjct: 279 AL---GDQYA-ALENHGAAIDTGTSLITLPSGLAEIINTEIGAK-KGWTGQYTLDCDTRD 333

Query: 391 SNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQ-----QENWVVLGDVFLSNAYVV 445
              +L F+F G + T    D+ ++ S  +C+ AI P           ++GD FL   Y +
Sbjct: 334 GLPDLTFNFNGKNFTISPFDYTLEVSG-SCISAIMPMDFPEPMGPMAIVGDAFLRKYYSI 392

Query: 446 YDLENLEVSMAQA 458
           YDL+N  V +A+A
Sbjct: 393 YDLDNHAVGLAEA 405

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ   V++DTGSS+LWV
Sbjct: 92  YFADISVGTPPQNFKVILDTGSSNLWV 118

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 86.3 bits (212), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 140/323 (43%), Gaps = 60/323 (18%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  +DH  SS++K N T FAI YG T    G    DT+SI  L +        
Sbjct: 124 GSLACFLHSKYDHEASSSYKPNGTEFAIQYG-TGSLEGYISQDTLSIGDLTIPKQDFAEA 182

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+G           +T S  K +    +++ Q       
Sbjct: 183 TSEPGLTFAFGKFD----GILGLGY----------DTISVDKVVPPFYNAIQQ------- 221

Query: 264 LKNDGIIHKVAYSLFLNDP---QEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
                ++ +  ++ +L D     E  G   FG +D SK+ G +  +P+          + 
Sbjct: 222 ----DLLDEKKFAFYLGDTSKDSENGGEATFGGIDKSKFKGDVTWLPV---------RRK 268

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
             +++   G+G+  + ++         A +D+GT++   P+ LA  I  +  A     SG
Sbjct: 269 AYWEVKFEGIGLGHEFAE----LEGHGAAIDTGTSLITLPSGLAEMINAEIGAK-KGWSG 323

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLG 435
            Y + C+      +L F+F G++ T    D+ ++ S  +C+ AI P           ++G
Sbjct: 324 QYALDCNTRDGLPDLTFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIIG 382

Query: 436 DVFLSNAYVVYDLENLEVSMAQA 458
           D FL   Y +YDL N  V +A+A
Sbjct: 383 DAFLRKYYSIYDLGNDAVGLAEA 405

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 24/37 (64%), Gaps = 3/37 (8%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           Y  D+ +G PPQ   V++DTGSS+LWV  T+   C S
Sbjct: 92  YYTDISLGNPPQNFKVILDTGSSNLWVPSTE---CGS 125

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 84.7 bits (208), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 81/320 (25%), Positives = 134/320 (41%), Gaps = 54/320 (16%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV-------- 206
            ++ C  +  +DH KSS++K N T FAI YG T    G    DT++I  LN+        
Sbjct: 126 GSLACYLHSKYDHDKSSSYKPNGTDFAIRYG-TGSLEGYISQDTLNIGDLNIPKQDFAEA 184

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+    + V   +    +      A    L     F   
Sbjct: 185 TSEPGLTFAFGKFD----GILGLAYDSISVNKVVPPFYN------AIEQELLDEKKFAFY 234

Query: 264 LKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEF 323
           L +             N   E  G +  G +D +K+ G +  +P+          +   +
Sbjct: 235 LGD------------ANKKSEDGGEITIGGIDKTKFKGDIDWLPV---------RRKAYW 273

Query: 324 DITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYT 383
           ++   G+G+   G Q         A +D+GT++   P+ LA  I  +  A     +G YT
Sbjct: 274 EVKFEGIGL---GDQFA-ELENHGAAIDTGTSLIALPSGLAEIINTEIGAK-KGWTGQYT 328

Query: 384 MSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVF 438
           + C    +  +L F+F G + T    D+ ++ S  +C+ AI P           ++GD F
Sbjct: 329 VECDARPNLPDLTFNFNGKNFTIGPYDYTLEVSG-SCISAIMPMDFPEPVGPMAIIGDAF 387

Query: 439 LSNAYVVYDLENLEVSMAQA 458
           L   Y +YDLEN  V +A+A
Sbjct: 388 LRKYYSIYDLENNAVGLAEA 407

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ +GTPPQ   V++DTGSS+LWV
Sbjct: 94  YFADITLGTPPQSFKVILDTGSSNLWV 120

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 84.3 bits (207), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 127/317 (40%), Gaps = 55/317 (17%)

Query: 159 CSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSN 218
           C  +  +DH +SST+K N T   ++YG  S   G    DT  I+ L + G  F       
Sbjct: 129 CRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPGQQFTETTDEP 187

Query: 219 SSM-------GVLGIGLP--GLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGI 269
            S+       G+LG+  P  G  VT         K                        +
Sbjct: 188 GSVFVFAAFDGILGLAYPSLGYGVTPPFQQLMEKK------------------------L 223

Query: 270 IHKVAYSLFLNDPQ--EQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITL 327
           + +  + ++L+D +  E  G ++ G  D +K+ G +  +P+          +   +++  
Sbjct: 224 VKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV---------RRQAYWEVVF 274

Query: 328 YGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCS 387
             + V  D     I      A +DSGT++  FP++L N+   K +     R G   + C+
Sbjct: 275 DSVTVGDD----NIPLENYGAAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCA 330

Query: 388 YDTSNTNLVFDFGGFHITAPLDDFVVQQSSQT--CVLAIGP----QQENWVVLGDVFLSN 441
              +   L F FGG   +   +D+++    Q+  C+ AI            ++GDVFL  
Sbjct: 331 NKQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRR 390

Query: 442 AYVVYDLENLEVSMAQA 458
            Y +YD  N  V +A A
Sbjct: 391 YYSIYDFGNNAVGLATA 407

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 10  NTDGY--SLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGK 67
           N DG+   L ++ N +  Y+ D+ IGTPPQ   V+VDTGSS LWV G +    A  R  K
Sbjct: 77  NNDGHVSELANLANNI--YAADVTIGTPPQDFRVVVDTGSSTLWVPGKECRAMAC-RLHK 133

Query: 68  KFLGDE 73
           ++  D 
Sbjct: 134 RYDHDR 139

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 80.1 bits (196), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 140/320 (43%), Gaps = 47/320 (14%)

Query: 151 SAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVS 210
           S   +++ C  +  +DHS SST++SN + F I YG  S   G    DT++I  L +    
Sbjct: 114 SVGCSSLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGS-LKGYISQDTLTIGDLIIPQQD 172

Query: 211 FAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKD--IAAASSSLYQYANFPMVLK--N 266
           FA A              PGL         A GK D  +  A  S+      P +    +
Sbjct: 173 FAEATAE-----------PGLAF-------AFGKFDGILGLAYDSISVNKAVPPLYNAIH 214

Query: 267 DGIIHKVAYSLFLNDPQEQE--GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFD 324
            G++ K  ++ +L D +  +  G   FG  D S++ G +  +P+        +   V+FD
Sbjct: 215 RGLLDKPMFAFYLGDEKSSKNGGEATFGGYDPSRFEGEIKWLPV-----RRKAYWEVQFD 269

Query: 325 -ITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYT 383
            I L    +  +G  + I         D+GT++   P+Q+A+ +  +  A   S +G YT
Sbjct: 270 GIKLGDKFMKLEGHGAAI---------DTGTSLITLPSQIADFLNNEIGAK-KSWNGQYT 319

Query: 384 MSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVF 438
           + C    S   L  +F   + T    D+ ++ S  +C+ AI P           ++GD F
Sbjct: 320 IDCKKRESLPKLTLNFYNHNFTIDPFDYTLEISG-SCISAITPMDFPQPVGPLSIIGDAF 378

Query: 439 LSNAYVVYDLENLEVSMAQA 458
           L   Y +YDLEN  V +A++
Sbjct: 379 LRRFYSIYDLENNAVGLAKS 398

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/27 (66%), Positives = 22/27 (81%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  D+ IGTPPQK  V++DTGSS+LWV
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWV 112

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 141/315 (44%), Gaps = 49/315 (15%)

Query: 182 ISYGDTSYASGSWGIDTMSI-----NKLNVSGVSFAVANYSN-SSMGVLGIGLPGLEVTN 235
           I + + S  SG++ ID+ S      + +++S +SF   NY++  + G LG+G        
Sbjct: 123 IHFTNISDVSGTYSIDSSSTAIIGSDYMSISNISFFETNYASFYTAGSLGLG-------G 175

Query: 236 QLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLND---PQEQE------ 286
           ++S+  S   D     SS +    F   L N GII   +YSL+      P ++       
Sbjct: 176 RISD-GSAAIDSEKFDSSFF----FLDRLMNLGIIKTPSYSLWFGADTVPYDRRKLASGT 230

Query: 287 ----GSVLFGAVDHSKYTGTLYT---VPLVD-IYHDSASSKPVEFDITLYGLGVDKDGSQ 338
               G ++ GAVD S YTG L +   +P +D +    +++ P+    T+Y    +     
Sbjct: 231 MADCGKLILGAVDPSLYTGILRSFKMIPFIDPVSQAQSNNYPILPLGTIYINSANGKSLN 290

Query: 339 STIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFD 398
            T      P LLDS  + +Y P     +IA +  AT+      + ++CS    + +L F 
Sbjct: 291 MTSEEFVEPVLLDSRYSTTYLPIDAIVQIAVQIGATFVESLDKWLVACSVAKLDVSLDFT 350

Query: 399 FGGFHITAPLDDFVV-------------QQSSQTCVLA-IGPQQENWVVLGDVFLSNAYV 444
           FG   I  PL+DF+V                 + C LA +   +  + VLG  FL N Y+
Sbjct: 351 FGNIEIRVPLEDFLVTTYDPKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYM 410

Query: 445 VYDLENLEVSMAQAN 459
             D+E+  +++AQA 
Sbjct: 411 AVDIEDSSIAIAQAK 425

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 79.7 bits (195), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 83/320 (25%), Positives = 141/320 (44%), Gaps = 47/320 (14%)

Query: 151 SAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVS 210
           SA   ++ C  +  +DH  SST+K+N + FAI YG  S   G    D ++I  L +    
Sbjct: 124 SAECGSLACFLHTKYDHEASSTYKANGSEFAIQYGSGS-LEGYVSRDLLTIGDLVIPDQD 182

Query: 211 FAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKD--IAAASSSLYQYANFPMV---LK 265
           FA A              PGL         A GK D  +  A  S+      P V   +K
Sbjct: 183 FAEATSE-----------PGLAF-------AFGKFDGILGLAYDSISVNRIVPPVYNAIK 224

Query: 266 NDGIIHKVAYSLFLNDPQEQE--GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEF 323
           N  ++    ++ +L D  + E  G   FG +D  KYTG +  +P+          +   +
Sbjct: 225 NK-LLDDPVFAFYLGDSDKSEDGGEASFGGIDEEKYTGEITWLPV---------RRKAYW 274

Query: 324 DITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYT 383
           ++   G+G+ ++   +T+      A +D+GT++   P+ LA  +  +  A     SG Y+
Sbjct: 275 EVKFEGIGLGEE--YATLEGHG--AAIDTGTSLIALPSGLAEILNAEIGAK-KGWSGQYS 329

Query: 384 MSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVF 438
           + C    S  +L  +F G++ T    D+ ++ S  +C+ A  P           ++GD F
Sbjct: 330 VDCESRDSLPDLTLNFNGYNFTITAYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAF 388

Query: 439 LSNAYVVYDLENLEVSMAQA 458
           L   Y +YD+ +  V +A+A
Sbjct: 389 LRKYYSIYDIGHDAVGLAKA 408

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           Y  ++ +G+PPQ   V++DTGSS+LWV
Sbjct: 96  YFTEITLGSPPQSFKVILDTGSSNLWV 122

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 104/381 (27%), Positives = 154/381 (40%), Gaps = 83/381 (21%)

Query: 158 QCS------TYGTFDHS-KSSTFK----SNNTAFAISYGDTSYASGSWGIDTMSINKLNV 206
           QC+      T+G   +S +S++FK    S N A+ +S+ D +   GS GID  +   +  
Sbjct: 78  QCNRVNSGCTHGNLYYSGESTSFKNQSGSLNAAYNMSFIDYTEFYGSAGIDIANFTSVES 137

Query: 207 SGV----------------------SFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           SG                       SF  A +SN   G LG+G         LS TA   
Sbjct: 138 SGTEGDPTNTQVQWFGKHTLSIPEFSFFRAEHSNIVDGSLGLG------ARILSGTAEDS 191

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFL-ND---------PQEQEGSVLFGAV 294
               ++   L        +LKN   I   +YS++L ND              G++L GAV
Sbjct: 192 SGFDSSFFFL-------DMLKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAV 244

Query: 295 DHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIP-----AL 349
           D + + G  Y   ++  + DS +         +    VD   ++ T    T P      L
Sbjct: 245 DPNYFIGNFYRFKMLP-FRDSKTETTFNSLPIVPLTKVDIVNAKGTAVNVTQPGFMEPVL 303

Query: 350 LDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLD 409
           LD   TISY P +L  +IA + NA Y      + + C     +  + F FG   I  PL 
Sbjct: 304 LDPRYTISYLPIELILQIAMQTNAVYVKSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLS 363

Query: 410 DFV-------------VQQSSQTCVLAIGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSM 455
            FV             +  S+ TC L + P   + + +LG  FL + Y+  DLE   V+M
Sbjct: 364 HFVSSGYVGSPIASTQLGASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAM 423

Query: 456 AQA-------NFDSSLPESVE 469
           AQA       +  SSLP ++E
Sbjct: 424 AQAYNAVKDGDNASSLPLTLE 444

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 73.9 bits (180), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 43/117 (36%), Positives = 67/117 (57%), Gaps = 10/117 (8%)

Query: 145 PARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKL 204
           P+ T  S + +T+ C+ +GTF    SSTFK N+T F  +YGD +Y  G++G D +S+  +
Sbjct: 17  PSFTISSESYSTL-CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNI 75

Query: 205 NVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFP 261
            +   SF VAN + +  G+LGI LP  E T+ L           A +++ ++Y NFP
Sbjct: 76  TLESFSFGVANNTENQGGILGISLPAGENTHSLG---------GAYNTTPFEYENFP 123

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 128/311 (41%), Gaps = 39/311 (12%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           ++ C  +  +DHS SST+K N T F+I YG  S   G    D + I  L + G  FA A 
Sbjct: 122 SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGS-MEGYISQDVLQIGDLVIPGQDFAEAT 180

Query: 216 YSNSSMGVLGIGLPGLEVT-NQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
                        PGL     +         D  A +  +  + N      N  ++ +  
Sbjct: 181 SE-----------PGLAFAFGKFDGILGLAYDTIAVNRVVPPFYN----AINKKLVDEPI 225

Query: 275 YSLFLNDPQEQE--GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
           +S +L D  + E  G V FG  D S +TG +  +P+        +   V+FD    G   
Sbjct: 226 FSFYLGDDTKSEDGGQVTFGGYDSSLFTGDITWLPV-----RRKAYWEVKFDAIALG--- 277

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSN 392
                          A +D+GT++   P+ LA  I  +  A   S SG + + C    + 
Sbjct: 278 -----NEVADLVNHGAAIDTGTSLITLPSGLAEVINSQIGAK-KSWSGQWIVDCKTRDTL 331

Query: 393 TNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVFLSNAYVVYD 447
            ++ F F G++ T    D+ ++ S  +C+ AI P           ++GD FL   Y +YD
Sbjct: 332 PDMTFTFDGYNFTITPYDYTLEVSG-SCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYD 390

Query: 448 LENLEVSMAQA 458
           + N  V +A A
Sbjct: 391 VGNNAVGLAAA 401

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD 56
           Y  D+ +GTP Q   V++DTGSS+LWV   D
Sbjct: 89  YYTDITLGTPAQSFKVILDTGSSNLWVPSVD 119

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 79.0 bits (193), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 136/306 (44%), Gaps = 45/306 (14%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215
           ++ C  +  +DH  SST+  N T FAI YG  +   G    DT+++  L +    FA A 
Sbjct: 132 SLACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEAT 190

Query: 216 YSNSSMGVLGIGLPGLEVT-NQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVA 274
                        PGL     +         D  + + ++  + N      N G++    
Sbjct: 191 SE-----------PGLAFAFGKFDGIFGLAFDTISVNRAVPPFYN----AVNRGLLDAPQ 235

Query: 275 YSLFLNDP--QEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGV 332
           ++ +L D   +++ G V FG  D +++TG +  +P+          +   +++   G+  
Sbjct: 236 FAFYLGDKRLRKEGGEVTFGGYDETRFTGNITWLPV---------RREAYWEVDFNGISF 286

Query: 333 DKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSR---SGFYTMSCSYD 389
              GSQ    T T  A +D+GT++   P+ LA EI    NA   +R   SG Y + CS  
Sbjct: 287 ---GSQYAPLTAT-GAAIDTGTSLITLPSGLA-EI---LNAQIGARKNWSGQYVLDCSRR 338

Query: 390 TSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVFLSNAYV 444
           ++  ++ F+ GG + +    D+ + ++S TC+ AI P           ++GD FL   Y 
Sbjct: 339 STLPDITFNLGGSNFSIGPYDYTL-EASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYS 397

Query: 445 VYDLEN 450
           VYDL N
Sbjct: 398 VYDLGN 403

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 30/54 (55%), Gaps = 8/54 (14%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD-NPLCASGRRGKKFLGDEGDARV 78
           Y  D+ IG+P Q   V++DTGSS+LWV   D N L         FL ++ D RV
Sbjct: 99  YFADISIGSPGQTFRVIMDTGSSNLWVPSVDCNSLAC-------FLHNKYDHRV 145

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 77.0 bits (188), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 76/303 (25%), Positives = 130/303 (42%), Gaps = 48/303 (15%)

Query: 167 HSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYS-----NSSM 221
           H+ SST+KS+     ++ G T    G    D + +    +    FA A  S      S  
Sbjct: 2   HANSSTYKSSGEEVELASG-TGSMQGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQ 60

Query: 222 GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFL-- 279
           GV G+G   L    Q+                +Y        +   G +    + +FL  
Sbjct: 61  GVFGLGHRELAKGGQVP--------------PIYN-------MMERGQLKDPMFGIFLPK 99

Query: 280 NDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKDGSQS 339
           N     EG ++FG  D +K+ G+L  +P+            VEF+    G        +S
Sbjct: 100 NLAHINEGEIIFGGYDSTKFAGSLEWLPITK-----KGFWEVEFNSISTG--------ES 146

Query: 340 TIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDF 399
           T+    + A+LD+G++++  P ++ ++      A   S++G   +SCS   +   +VF+ 
Sbjct: 147 TVQGEGLGAILDTGSSLTLLPTEIFDKFNGALEAALGSKTG-GRVSCSARETAPEIVFEL 205

Query: 400 GGFHITAPLDDFVVQQSSQTCVLAIGPQ----QENWVVLGDVFLSNAYVVYDLENLEVSM 455
           GG       +++++   S+ C++ I PQ    Q N V+LG  FL   Y VYDL +  V +
Sbjct: 206 GGKKFAITGNEYIMPAGSE-CMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGL 264

Query: 456 AQA 458
           A+A
Sbjct: 265 AEA 267

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 137/323 (42%), Gaps = 61/323 (18%)

Query: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNV--------- 206
           ++ C  +  +DH +S+T++ N T F I YG  S   G    DT+ I    V         
Sbjct: 137 SLACYLHSKYDHDESTTYEKNGTKFTIQYGSGS-MDGYISRDTLIIGDDLVIPEQDFAEA 195

Query: 207 ---SGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV 263
               G++FA   +     G+LG+            +T +  K +    +++ Q       
Sbjct: 196 TSEPGLAFAFGKFD----GILGLAY----------DTIAVNKVVPPFYNAIKQ------- 234

Query: 264 LKNDGIIHKVAYSLFLNDPQEQE---GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKP 320
               GI+ +  ++ +L D  +     G   FG  D SK+TG +  +P+        +   
Sbjct: 235 ----GILDENKFAFYLGDTNKDNKSGGEATFGGYDKSKFTGDITWLPV-----RRKAYWE 285

Query: 321 VEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSG 380
           V+FD    G            +     A +D+GT++   P+ LA  I  +  A   S SG
Sbjct: 286 VKFDSIALG--------DEVASLDGYGAAIDTGTSLITLPSGLAEVINTQIGAK-KSWSG 336

Query: 381 FYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLG 435
            YT+ C    +  ++ F+F G++ T    D+ ++ S  +C+ AI P           ++G
Sbjct: 337 QYTIDCDTRDALPDMTFNFNGYNFTVSPYDYTLEMSG-SCISAITPMDFPEPVGPLAIIG 395

Query: 436 DVFLSNAYVVYDLENLEVSMAQA 458
           D FL   Y +YDL+N  V +A++
Sbjct: 396 DAFLRKYYSIYDLDNNAVGLAKS 418

 Score = 38.5 bits (88), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 21/31 (67%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTD 56
           Y  D+ +GTP Q   V++DTGSS+LWV   D
Sbjct: 104 YYTDISLGTPKQNFKVILDTGSSNLWVPSKD 134

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/311 (25%), Positives = 134/311 (43%), Gaps = 46/311 (14%)

Query: 204 LNVSGVSFAVANYSNSSM-GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPM 262
           L ++  SF +AN + S + G LG+  P       +S  AS          S Y    F  
Sbjct: 148 LTINSTSFILANETGSLVHGALGLSGP-------ISVPASDSVSSLNFDDSYY----FLT 196

Query: 263 VLKNDGIIHKVAYSLFLNDPQEQE----------GSVLFGAVDHSKYTGTLYTVPLVDIY 312
            LKN G+I   +YSL++N+               G++L G+VD   Y G L +   +   
Sbjct: 197 HLKNAGVIETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFK 256

Query: 313 HDSASSKPVEFDITLYGLGVDKDGSQSTIATT----TIPALLDSGTTISYFPAQLANEIA 368
            +S+      + I         +  Q  +  T      P  + S    SY P  L  +++
Sbjct: 257 DESSGYLSTGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVS 316

Query: 369 RKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV-------------VQQ 415
            + NA Y      + ++C      +NL+F+FG  +I+ P  DF+                
Sbjct: 317 IQTNAVYVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTN 376

Query: 416 SSQTCVLAIGPQ-QENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESV------ 468
             + C L + P    ++ VLG  F+ NAY+V+D++N  +++AQA  D ++ ++       
Sbjct: 377 GKEACYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASDEAVEKAANNSPAK 436

Query: 469 EVISSTVPSAV 479
           ++ SST+P A+
Sbjct: 437 KIESSTIPYAL 447

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 76.3 bits (186), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 139/317 (43%), Gaps = 45/317 (14%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVA 214
            ++ C  +  +DHS SS++K N T FAI YG  S   G    DT+S+  L +    FA A
Sbjct: 123 GSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGS-LEGYISQDTLSVGDLVIPKQDFAEA 181

Query: 215 NYSNSSMGVLGI--GLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHK 272
                     G   G+ GL       NT S  K +    +++ Q            ++ +
Sbjct: 182 TSEPGLAFAFGKFDGILGLAY-----NTISVDKVVPPFYNAIDQ-----------DLLDE 225

Query: 273 VAYSLFLNDPQEQE------GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDIT 326
             ++ +L D  + E      G   FG +D SK+ G +  +P+          +   +++ 
Sbjct: 226 PRFAFYLGDSSDSEDSSVSGGVATFGGIDKSKFKGEISWLPV---------RRKAYWEVK 276

Query: 327 LYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSC 386
             G+G+   G +  I      A +D+GT++   P+ LA  I  +  A     SG YT+ C
Sbjct: 277 FEGIGL---GDEFAILDGH-GAAIDTGTSLITLPSGLAEIINSEIGAK-KGWSGQYTVDC 331

Query: 387 SYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ-----ENWVVLGDVFLSN 441
              +S  +L F+F G + T    D+ ++ S  +C+ AI P           ++GD FL  
Sbjct: 332 ETRSSLPDLTFNFSGKNYTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDTFLRR 390

Query: 442 AYVVYDLENLEVSMAQA 458
            Y VYDL N  V +A+A
Sbjct: 391 FYSVYDLGNNAVGLAKA 407

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 23/37 (62%), Gaps = 3/37 (8%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           Y  D+ +GTP Q   V++DTGSS+LWV   D   C S
Sbjct: 91  YYTDISLGTPAQNFKVILDTGSSNLWVPSVD---CGS 124

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 76.3 bits (186), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 136/310 (43%), Gaps = 44/310 (14%)

Query: 204 LNVSGVSFAVANYSN-SSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPM 262
           L++S VSF     SN  + G+LG+       + +++N  +     A  SS   + + F  
Sbjct: 171 LSISNVSFFDIQSSNFKTSGLLGL-------SGKVTNPGN-----AIDSSQYTEQSYFLS 218

Query: 263 VLKNDGIIHKVAYSLFL----------NDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIY 312
           +LK+  II   +YSL+L           DP    G +L G VD S +TGTL    L+   
Sbjct: 219 LLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIPYV 278

Query: 313 HDSASSKPVEFDITLYG-LGVDKDGSQSTIATTT---IPALLDSGTTISYFPAQLANEIA 368
              +++  V + I   G + +  +  QS   T+     PALLDS +++SY P     +IA
Sbjct: 279 DPVSNAVSVGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIA 338

Query: 369 RKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV-------------VQQ 415
            +  ATY      + + CS      +L F      I  PL D +                
Sbjct: 339 VQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSSMFFSS 398

Query: 416 SSQTCVLAIGPQQENWV-VLGDVFLSNAYVVYDLENLEVSMAQANF---DSSLPESVEVI 471
             + C L +       V +LG+ F+ N Y+  DLE+  +++AQA     D+   E+ E  
Sbjct: 399 GQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQAKKVEDDAVTEETNETT 458

Query: 472 SSTVPSAVKA 481
           +ST+   +K+
Sbjct: 459 ASTIIKKIKS 468

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 82/302 (27%), Positives = 129/302 (42%), Gaps = 49/302 (16%)

Query: 185 GDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGK 244
           G+  + SGS  I        NVS  S   +N+  S  G+LG+       + +++N  S  
Sbjct: 162 GNVQFNSGSLSIS-------NVSFFSVESSNFKTS--GLLGL-------SGKITNPGS-- 203

Query: 245 KDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFL----------NDPQEQEGSVLFGAV 294
              AA SS   + + F  +LK+  +I   +YSL+L           DP    G +L G V
Sbjct: 204 ---AADSSHYTEQSYFLSLLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGV 260

Query: 295 DHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYG-LGVDKDGSQSTIATTT---IPALL 350
           D S +TGTL    L+      +S+    + I   G + +  +  QS   T+     PALL
Sbjct: 261 DPSLFTGTLGKFDLIPYVDPVSSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALL 320

Query: 351 DSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDD 410
           DS +++SY P     +IA +  ATY      + + CS      +L F      I  PL D
Sbjct: 321 DSTSSVSYLPTNTIIQIAVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRD 380

Query: 411 FV-------------VQQSSQTCVLAIGPQQENWV-VLGDVFLSNAYVVYDLENLEVSMA 456
            +                  + C L +       + +LG+ F+ N Y+  DLE+  +++A
Sbjct: 381 LLSSTYDTSTNSSMFFSSGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIA 440

Query: 457 QA 458
           QA
Sbjct: 441 QA 442

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 76/289 (26%), Positives = 128/289 (44%), Gaps = 45/289 (15%)

Query: 202 NKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFP 261
           + L +S  SF   N + SS GVLG+G    ++ ++ ++  S + D     SS +   +  
Sbjct: 287 HSLTLSNSSFFEINDTTSSKGVLGLGG---KINDKGTDIDSSQFD-----SSFFLLES-- 336

Query: 262 MVLKNDGIIHKVAYSLFL------------NDPQEQE-GSVLFGAVDHSKYTGTLYTVPL 308
             L+++GII  ++YSL+L            N P E   G ++ G VD   Y+G L     
Sbjct: 337 --LRDNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVDPYYYSGPLKKFNN 394

Query: 309 VDIYHDSASSK-----PVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQL 363
           + I+ DS +       PV    T+  +    +    T      P LLDS  + S+ PA+ 
Sbjct: 395 L-IFLDSRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLTPVLLDSRYSFSHLPAET 453

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSS------ 417
             +IA + NA Y      + +SC       N+ F+FG   I  P  DF++   +      
Sbjct: 454 IVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQFEFGDVSIDVPFKDFLMSTHNPETNST 513

Query: 418 -------QTCVLAIGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQA 458
                  + C + +   +E  + +LG  FL N Y+  D ++  +++AQA
Sbjct: 514 MKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHDDQSIAIAQA 562

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 81/284 (28%), Positives = 120/284 (42%), Gaps = 41/284 (14%)

Query: 204 LNVSGVSFAVANYSN-SSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPM 262
           L++S VSF     SN  S G+LG  L G +VTN          DI   SS   +Y+ F  
Sbjct: 161 LSISNVSFFNIESSNFKSSGLLG--LSG-KVTNP-------GTDID--SSQYTEYSYFLS 208

Query: 263 VLKNDGIIHKVAYSLFL----------NDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIY 312
           +LK+   I   +YSL+L           DP    G +L G VD S +TGTL    L+   
Sbjct: 209 LLKDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQFDLIPYA 268

Query: 313 HDSASSKPVEFDITLYGLGVDKDGSQSTIATTTI----PALLDSGTTISYFPAQLANEIA 368
               ++  + + I   G       S  ++  T+     PALLDS +++SY P     +IA
Sbjct: 269 DPVTNAITIGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLPTSTIIQIA 328

Query: 369 RKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDF-------------VVQQ 415
            +  ATY      + + CS       L F      I  PL D              +   
Sbjct: 329 VQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNSSMLFSS 388

Query: 416 SSQTCVLAIGPQQENWV-VLGDVFLSNAYVVYDLENLEVSMAQA 458
             + C L +       + +LG+ F+ N Y+  DLE+  +++AQA
Sbjct: 389 GQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 432

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 107/230 (46%), Gaps = 42/230 (18%)

Query: 264 LKNDGIIHKVAYSLFL----NDPQEQE------GSVLFGAVDHSKYTGTLY---TVPLVD 310
           L ++ +I+  ++S+++     DP E        G V+FGAVD S YTG      T+P   
Sbjct: 208 LVDESLIYTSSFSMWMGADTRDPLESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIP--- 264

Query: 311 IYHDSASSK-----PVEFDITLYGLGVD-KDGSQSTIATTTI--PALLDSGTTISYFPAQ 362
            +H++ + +     P+   I L  + V  K G    + + +   P L+DS    +Y P +
Sbjct: 265 -FHNARTGETSRGYPI---IPLTKVNVQSKSGETKNMTSDSFLEPVLIDSRFRYNYLPLE 320

Query: 363 LANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV---------- 412
           +  +IA + NA Y      + ++C       +++F+FG   I  PL++ +          
Sbjct: 321 IIVQIAMQANAYYVESLNRWLLACDVGRLGASIIFEFGNLSINVPLNNLMGPTFDSDTNG 380

Query: 413 ---VQQSSQTCVLAIGPQQEN-WVVLGDVFLSNAYVVYDLENLEVSMAQA 458
                   Q C L + P   + + VLG  F+ N Y+  +LE+ +V++AQA
Sbjct: 381 TLHFSNKQQACELKLLPSTASGFNVLGGAFIKNVYMAAELESNQVALAQA 430

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 71.2 bits (173), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/193 (28%), Positives = 88/193 (45%), Gaps = 22/193 (11%)

Query: 287 GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG----VDKDGSQSTIA 342
           G+++ GAVD   Y G L    ++    ++ + + V + + +  +G     +  G+Q  + 
Sbjct: 249 GNLVLGAVDQRYYEGRLVQFDMLPALLNNVT-EAVTYGLPIIPMGPIYIENSSGTQLNLT 307

Query: 343 TTTI--PALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFG 400
           TT    P LLDS  T +  P     +IA + NA Y    G + + CS    N NL F+F 
Sbjct: 308 TTNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQ 367

Query: 401 GFHITAPLDDFV--------------VQQSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVV 445
           G  I   L+DF+               + S   C LA+ P  +  + +LG  FL N Y+ 
Sbjct: 368 GLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLA 427

Query: 446 YDLENLEVSMAQA 458
            D E   V++A+A
Sbjct: 428 IDNEGRSVAIAKA 440

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 124/294 (42%), Gaps = 60/294 (20%)

Query: 194 WGIDTMSINKLNVSGVSFAVANYSNS-SMGVLGIG----LPGLEVTNQLSNTASGKKDIA 248
           W +D+   + L+++ VSF   +YS S + G LG+G     PG ++ +             
Sbjct: 155 WDLDS---DTLSMTNVSFINVDYSGSITQGALGLGGRITAPGEDINSD------------ 199

Query: 249 AASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQE------------GSVLFGAVDH 296
               S +    F   L  + +I   +YSL+L     QE            G ++ GAVD 
Sbjct: 200 GFDGSFF----FLEQLVANNVIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDP 255

Query: 297 SKYTGTLY---TVPLVDIYHDSAS-SKPVEFDITLYGLGVDKDGSQSTIATT---TIPAL 349
           S YTG      T+P  D+   + S   P+   + L  + V     Q+   T+     P L
Sbjct: 256 SLYTGDFVRFDTIPFHDVDTGATSFGYPI---VPLTKVSVKASSGQTLNVTSPDFAEPVL 312

Query: 350 LDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLD 409
           LD+    S+ P +L  +IA + NA Y      + +SCS    N +++F+F G  I  P+ 
Sbjct: 313 LDTRYLYSFLPLKLIIQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGLSIDVPIK 372

Query: 410 DFV-------------VQQSSQTCVLAIGPQ-QENWVVLGDVFLSNAYVVYDLE 449
           DF+                 +  C L + P     + VLG  F+ NAY+  DLE
Sbjct: 373 DFLSNSYDSVSNSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 83/331 (25%), Positives = 132/331 (39%), Gaps = 69/331 (20%)

Query: 155 ATVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVS------- 207
            ++ C  +  +DHS+SST+  +    +ISYG  S   G    D + I  L +        
Sbjct: 123 GSLACFLHNKYDHSQSSTYIKDGRPLSISYGSGS-IEGYISEDNLQIGDLTIQNQKFGET 181

Query: 208 ----GVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDI-----AAASSSLYQYA 258
               G++FA   +     G+LG           L+     + DI     +A    L   +
Sbjct: 182 TSEPGLAFAFGKFD----GILG-----------LAYDTIAQDDITPPFYSAIQQHLLDES 226

Query: 259 NFPMVLKNDGIIHKVAYSLFLNDPQEQEGSV------LFGAVDHSKYTGTLYTVPLVDIY 312
            F   LK+            +NDP  + GS         G VD SK+ G L  +PL    
Sbjct: 227 KFSFYLKS------------VNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPL---- 268

Query: 313 HDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFN 372
                 +   +++ L  +   K G QST       A +D+GT++   P+ +A  I  +  
Sbjct: 269 ---HVRRQAYWEVPLNAI---KLGDQSTGKLENTGAAIDTGTSLITLPSDMAEIINAQIG 322

Query: 373 ATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQ---- 428
           A     +G YT+ CS      +L F   G        ++ ++ S  +C+  I P      
Sbjct: 323 AK-KGWTGQYTLECSTRAKLPDLTFTLDGHDFVLSPFEYTLEVSG-SCISVITPMDFPEP 380

Query: 429 -ENWVVLGDVFLSNAYVVYDLENLEVSMAQA 458
                +LGD FL   Y V+DL+   VS+A+A
Sbjct: 381 IGRMAILGDAFLRRYYSVFDLDANVVSLAEA 411

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 28/46 (60%), Gaps = 8/46 (17%)

Query: 17  MDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           MD Q     Y  D+ +GTPPQK  V++DTGSS+LWV   D   C S
Sbjct: 87  MDAQ-----YFADISLGTPPQKFKVILDTGSSNLWVPSVD---CGS 124

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 70/266 (26%), Positives = 111/266 (41%), Gaps = 34/266 (12%)

Query: 264 LKNDGIIHKVAYSL-FLNDPQ---------EQEGSVLFGAVDHSKYTGTLYT---VPLVD 310
           +++ G+I   +YSL F ND           E  G+++ GAVD   Y G  Y    VP VD
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 311 IY--HDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIA 368
           I     +    P+     +  LG +      T  T   P LL+S    S+ P  +  +IA
Sbjct: 256 IASGQHTRGGYPIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQIA 315

Query: 369 RKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV------------VQQS 416
           R+ NA +   S    + CS      +  F FG   +  PL DF+               +
Sbjct: 316 RQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPDT 375

Query: 417 SQTCVLAIGPQQ-ENWVVLGDVFLSNAYVVYDLENLEVSMAQANFD-----SSLPESVEV 470
           ++TC L + P     + +LG   L   Y+  D E+  V MA A        +SLP S   
Sbjct: 376 NETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALAVRPVDRNVTSLPRSTGE 435

Query: 471 ISSTVPSAVK-AASYSNPWSSAVMMS 495
           +++    ++  A   + P +S++ +S
Sbjct: 436 VAAIRSGSIPFATPVTLPCTSSMTLS 461

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 69.7 bits (169), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 98/228 (42%), Gaps = 34/228 (14%)

Query: 264 LKNDGIIHKVAYSLFLND----------PQEQE----GSVLFGAVDHSKYTGTLYTVPLV 309
           L N G+I   +YS++  +          P E++    G ++FG VD S   GT  +  ++
Sbjct: 229 LLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMI 288

Query: 310 DIYHDSASSKPVE-FDITLYGLGVDKDGSQSTIATTTI----PALLDSGTTISYFPAQLA 364
             Y D++       + I   G       S  T+  TT+    P LLDS  T S  PA   
Sbjct: 289 P-YEDTSDGLTTSGYPILPMGPIYIIANSGRTLNLTTLDFLEPVLLDSRITNSRLPASFI 347

Query: 365 NEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVV----------- 413
            ++A +  A Y      + + CS    N N  F FG   I  PL+DF+V           
Sbjct: 348 IQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSVRIRVPLEDFLVPSGLTGDNKTI 407

Query: 414 --QQSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVVYDLENLEVSMAQA 458
              Q+   C LA+ P  +  + +LG  FL NA +  D  + ++++ +A
Sbjct: 408 HFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAIGKA 455

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 97/238 (40%), Gaps = 31/238 (13%)

Query: 264 LKNDGIIHKVAYSLFLNDPQE----------QEGSVLFGAVDHSKYTGTLYTVPLVDIYH 313
           LK   +I+  +YSL+L   +           + G ++FGAVD +   G      ++   H
Sbjct: 204 LKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIH 263

Query: 314 DSASSKPVEFDITLYGLGVDKDGSQSTIATTT----IPALLDSGTTISYFPAQLANEIAR 369
                    + +   G       S  ++  TT     P LLD    +SY P +   +IA 
Sbjct: 264 PQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTDGFSAPVLLDPSFALSYLPTKAIIQIAI 323

Query: 370 KFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQT---------- 419
           +  A Y      + +SC   +S   + F FG   I  PL D +     Q+          
Sbjct: 324 QIAAVYVESLDLWLVSCDVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHFNTG 383

Query: 420 ---CVLAIGPQQ-ENWVVLGDVFLSNAYVVYDLENLEVSMAQ-ANFDSSLPESVEVIS 472
              CVL + P     + VLG  F+ NAY+  DLE   V+M Q ANF S   E  E+I+
Sbjct: 384 QEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSG--ERKEIIT 439

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 102/237 (43%), Gaps = 24/237 (10%)

Query: 269 IIHKVAYSLFLND-PQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDIT- 326
           +I   AYS  L+    E  G ++FG VD S YTG L  +  +  Y+         + I  
Sbjct: 222 VIESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGYPIVP 281

Query: 327 LYGLGVDKDGSQSTIATTTI---PALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYT 383
           L  + V     Q    T+     P LLD+    +Y P  L  +IA + NA Y      + 
Sbjct: 282 LVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRWL 341

Query: 384 MSCSYDTSNTNLVFDFGGFHITAPLDDFV-------------VQQSSQTCVLAIGPQQE- 429
           ++C       +++FDFG   I  PL D +                + Q C L   P  + 
Sbjct: 342 LACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNSDL 401

Query: 430 NWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSAVKAASYSN 486
            + +LG  F+ N Y+  +L++ +V++AQA          E +SS +  ++  ++Y+N
Sbjct: 402 GFSILGGPFIKNVYLAAELQSNQVALAQA-----YKWPTETVSSNLGGSISVSTYAN 453

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 56/193 (29%), Positives = 85/193 (44%), Gaps = 24/193 (12%)

Query: 287 GSVLFGAVDHSKYTGTLYT---VPLVDIYHDSASS-KPVEFDITLYGLGVDKDGSQSTIA 342
           G +L G VD S +TGTL     +P VD   +  S+  P+   + L  + +  +  QS   
Sbjct: 254 GKLLLGGVDPSLFTGTLGKFDLIPYVDPVSNVVSTGYPI---VPLGPIYIISNSGQSMNM 310

Query: 343 TTT---IPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDF 399
           T+     PALLDS +++SY P     +IA +  ATY      + + CS       L F F
Sbjct: 311 TSKDFLSPALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVECSMADMGVTLGFMF 370

Query: 400 GGFHITAPLDDFV-------------VQQSSQTCVLAIGPQQENWV-VLGDVFLSNAYVV 445
               I  PL D +                  + C L +       V +LG+ F+ N Y+ 
Sbjct: 371 RSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYMA 430

Query: 446 YDLENLEVSMAQA 458
            DLE+  +++AQA
Sbjct: 431 VDLEDNSIAIAQA 443

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 63.5 bits (153), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 91/229 (39%), Gaps = 33/229 (14%)

Query: 263 VLKNDGIIHKVAYSLFLN---------------DPQEQEGSVLFGAVDHSKYTGTLY--- 304
           +L   G+I   +YSL+L                DPQ   G +L G+VD S +    Y   
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 305 TVPLVDIYHDSAS-SKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQL 363
            +P VD      S S PV     +Y +     G+  T      P LL+S    +Y P   
Sbjct: 275 VLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNS 334

Query: 364 ANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV----------- 412
             +IA +  ATY      + + CS    N +  F F   +I APL DF+           
Sbjct: 335 IIQIAIQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTS 394

Query: 413 --VQQSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVVYDLENLEVSMAQA 458
                +S+ C L + P     +  LG  FL + Y+  + E   V MAQA
Sbjct: 395 MHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRIVGMAQA 443

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 5/53 (9%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWVM-GTDNPLC----ASGRRGKKFLGDE 73
           Y V++ IG+PPQ+  + +DT    +WV+ G D+  C    +    G +F  +E
Sbjct: 51  YYVNVTIGSPPQQEMLRIDTSQPFVWVLSGADDKQCNRLDSGCLSGNRFYPEE 103

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 62.8 bits (151), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 66/318 (20%), Positives = 126/318 (39%), Gaps = 62/318 (19%)

Query: 159 CSTYGTFDHSKSSTFKSNNTAFAISY----------GDTSYASGSWGIDTMSINKLNVSG 208
           C T   +    SSTFK+ +    + Y           DT Y +G+  I+     +    G
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGDAKARVSYDTLYFAGA-KIENQGFGEAEAIG 177

Query: 209 VSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMV--LKN 266
             F+ A +     G++GIG P +                         Y   P +  L +
Sbjct: 178 DDFSGARFD----GIIGIGYPSI------------------------GYGIKPPINTLID 209

Query: 267 DGIIHKVAYSLFLNDPQEQE---GSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEF 323
            G +    + +++++ Q +    G ++ G  +  K+ G +  +P++            E 
Sbjct: 210 SGGLKDPMFGIYISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVL-------RKAFWET 262

Query: 324 DITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYFPAQLANEIARKF-NATYDSRSGFY 382
           D++ + +G         +    + A+ D+G++    P     +   +F  A++D  + + 
Sbjct: 263 DLSAFKVG------NFALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY- 315

Query: 383 TMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQE--NWVVLGDVFLS 440
            + CS   S  +L  DFGG  +     D+V+Q    TC+LA+         V+LGD FL 
Sbjct: 316 -VDCSTVNSGPDLTLDFGGVALKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLR 374

Query: 441 NAYVVYDLENLEVSMAQA 458
             Y +Y+  +  + +A A
Sbjct: 375 RYYTIYNFGDNTIGVASA 392

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 26  YSVDLEIGTPPQKVTVLVDTGSSDLWV 52
           YSVD+ +GTP Q   V +DTGSS LW+
Sbjct: 83  YSVDITLGTPAQNFRVALDTGSSLLWI 109

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (57%), Gaps = 14/102 (13%)

Query: 159 CSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSN 218
           CS +GTF+ + SSTFK N T F ++YG       ++G D +S+  + +S  +F V+N + 
Sbjct: 165 CSYWGTFNPNISSTFKYNETIFDLTYG-------TYGTDVVSLGNITLSNYTFGVSNDTT 217

Query: 219 SSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANF 260
            S G+LGI LP  E+T++        +D  +++ + + Y NF
Sbjct: 218 MSYGILGISLPSEEITDR-------GQDALSSNKTPFAYDNF 252

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCAS 62
           ++KR      +++++      Y V+++IGTPPQ   + +DTGSSD+ V   D+  C S
Sbjct: 73  ISKRSEAFNSTIINMFASAGIYVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS 130

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 58.2 bits (139), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 133/329 (40%), Gaps = 52/329 (15%)

Query: 177 NTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN----YSNSSMGVLGIGLPGLE 232
           NTA+A S  +T     + G+  +  N L VS VSF  A+    Y+  S+G+ G       
Sbjct: 137 NTAYAHSTYNTK---NNKGLINLGTNYLGVSNVSFINADDTVPYAMGSLGLSG------- 186

Query: 233 VTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFL------------N 280
              +++ T +   DI   SS+     +F   L    +I   +YSL+L            N
Sbjct: 187 ---KITGTGT---DID--SSNFDNSYDFLDRLYQTNLIDSHSYSLWLAMNQTYNGTRVQN 238

Query: 281 DPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYG--LGVDKDGSQ 338
                 G ++ GAVD + +TG+     ++      ++++ + + I   G    V K G  
Sbjct: 239 SVTSSFGKLILGAVDPTLFTGSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGEM 298

Query: 339 STIATTTI--PALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLV 396
           + + +     P  LDS  T +Y P  +  ++A +  A Y      + + C+    +  L 
Sbjct: 299 ANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVAIQIGAMYVESLERWLVPCNIANQHATLD 358

Query: 397 FDFGGFHITAPLDDFV-------------VQQSSQTCVLAI-GPQQENWVVLGDVFLSNA 442
           F F    I  PL D +                  + C L I   Q   + +LG  FL + 
Sbjct: 359 FTFQDVSIRVPLTDLLGTTYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHV 418

Query: 443 YVVYDLENLEVSMAQANFDSSLPESVEVI 471
           Y+  DL+   +++AQA  +  L     V+
Sbjct: 419 YMAVDLDGNNIAIAQATQEEELQAKENVL 447

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 57.0 bits (136), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 121/288 (42%), Gaps = 44/288 (15%)

Query: 222 GVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLND 281
           GVLG+G   +  +N+  N  SG  D     SS + +  F    K   I    +YSL+L +
Sbjct: 208 GVLGLG-GSITSSNEYEN--SGNYD-----SSYFIFNKF----KEANITQSNSYSLWLVE 255

Query: 282 PQ----------EQEGS---VLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLY 328
            +          E+EG+   +L G +D + Y G+LY   ++      +      + I   
Sbjct: 256 DESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIPYVDPESLVSSQGYPILPM 315

Query: 329 GLGVDKDGSQSTIATTTI----PALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTM 384
           G+   K  S + +  T+     P LLDS    +Y P     +IA +  ATY      + +
Sbjct: 316 GVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLV 375

Query: 385 SCSYDTSNTNLVFDFGGFHITAPLDDFVVQ-------------QSSQTCVLAIGPQQE-N 430
           SC   +   +++F F G  I  PL++ +                    C L I       
Sbjct: 376 SCDMASYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYYSDGETACALTIYDNANMG 435

Query: 431 WVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTVPSA 478
           + +LG  F  N Y+  DLE   V++AQA   S   +S  + ++T+P+A
Sbjct: 436 YNLLGSAFFRNTYIAVDLEGNTVAIAQAK-PSDEDDSSNLSATTLPAA 482

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 50.1 bits (118), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 262 MVLKNDGIIHK-VAYSLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIY 312
           M  +  G I K ++YSLFLN P    GS+LFGAVD SKY   L T P+   Y
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAY 52

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 74/293 (25%), Positives = 116/293 (39%), Gaps = 45/293 (15%)

Query: 198 TMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQY 257
           TM+ + L +  +SF   + S + +G LG+G              S    +    S  +Q 
Sbjct: 154 TMTSDYLALRNISFVTTSSSTTDLGSLGLG-------------GSIHSSVFDIDSENFQD 200

Query: 258 ANFPM-VLKNDGIIHKVAYSLFLND---------PQEQEGSV----LFGAVDHSKYTGTL 303
             F +  + N  +I   +YSL+L +         P    GSV    + GAVD S Y G  
Sbjct: 201 TFFLLKTMANLNLIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEF 260

Query: 304 Y---TVPLVDIYHD-SASSKPVEFDITLYGLGVDKDGSQSTIATTTIPALLDSGTTISYF 359
           +   T+  ++  H+ S    P+     +Y           T      PALLDS    S+ 
Sbjct: 261 FQFNTISYIEPSHNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFL 320

Query: 360 PAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFVVQ----- 414
           PA    +IA +  A Y      + + CS  +   ++ F F G  I  PL D +       
Sbjct: 321 PANTIIQIAIQIGAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPA 380

Query: 415 --------QSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVVYDLENLEVSMAQA 458
                   +    C L +       + VLG  F+ NAY+  DL+  +V++AQA
Sbjct: 381 TNSTMHFAEGESACFLMLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQA 433

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 132/310 (42%), Gaps = 53/310 (17%)

Query: 183 SYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTAS 242
           SYG+ S      G+  +    LN+S +SF  + Y++  + +  +GL G  V ++ S+  S
Sbjct: 147 SYGNHS------GLVEVDHGHLNISSMSF-FSTYNSGGLSIGSLGLGG-NVESRNSDLDS 198

Query: 243 GKKDIAAASSSLYQYANFPMV--LKNDGIIHKVAYSLFLNDPQ----EQEGSV------- 289
           G+ D            +F ++  LK  G+I    YSL+L        EQEG+V       
Sbjct: 199 GQYD-----------GSFFLLEELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIA 247

Query: 290 ---LFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLG--VDKDGSQSTIATT 344
              + GAV+ +   G   +  ++   +         + I   G    + K G+   + + 
Sbjct: 248 GRLILGAVNPNLIDGKFVSFNMLPYQNPDTLEMSNGYPILPMGPINIISKSGASLNMTSN 307

Query: 345 TI--PALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGF 402
               P LLDS  T S  P +   +IA + +A+Y  +   + +SCS    +  L F FG  
Sbjct: 308 NYLQPVLLDSRYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPL 367

Query: 403 HITAPLDDFV-------------VQQSSQTCVLAIGPQQE-NWVVLGDVFLSNAYVVYDL 448
            I  PL  F+             +    Q C+L++ P  +  + +LG  F+ + Y+  D 
Sbjct: 368 RIKVPLKQFLKKAIDPDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDN 427

Query: 449 ENLEVSMAQA 458
           E   +++ Q+
Sbjct: 428 EGGTIALGQS 437

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 49.7 bits (117), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 34/54 (62%), Gaps = 3/54 (5%)

Query: 7   KRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLC 60
           KRD+    +L+   N V  Y V +EIGTPPQ   + +DTGSSD++V   D+P C
Sbjct: 51  KRDDVLNSTLI---NAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 67/138 (48%), Gaps = 12/138 (8%)

Query: 345 TIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHI 404
           T  +++DSGTT+   P Q A +I   F  +    + F  M  S  T    L  +F   + 
Sbjct: 314 TRSSIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIMCNSTQT----LTLEFDNKNW 369

Query: 405 TAPLDDFVVQQSSQT------CVLAI-GPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQ 457
           T P + ++  + SQ       CV  I G   ++  +LGDVFL   Y V+D+EN  +  A+
Sbjct: 370 TIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRLGFAE 429

Query: 458 ANFDSSL-PESVEVISST 474
            N ++ L P S E  ++T
Sbjct: 430 GNENALLVPYSKETNATT 447

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 29/51 (56%)

Query: 19  VQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGRRGKKF 69
           V N +  Y V +EIGTPPQ V + +DTGSSD+ V   D   C S   G  +
Sbjct: 60  VINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSMSDGSDY 110

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/187 (24%), Positives = 84/187 (44%), Gaps = 30/187 (16%)

Query: 310 DIYHDSASSKPVEFDITLYGLGVDKDGSQSTIATTTIP-------------ALLDSGTTI 356
           DIY+      P  +    + + +D+    ST+ T   P              ++DSG+T 
Sbjct: 262 DIYYSELVVNPNNY----WLIAIDRIFCNSTLVTFQNPENFTGAQSRSKRSGIIDSGSTF 317

Query: 357 SYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNLVFDFGGFHITAPLDDFV---V 413
              P   A +I      +  +   ++ + C+   S  +L F+ G  + T P   ++    
Sbjct: 318 LVLPKVDALDIHSYLPGSI-TDGNYFAVFCN---STVDLTFELGNKNWTIPASSYLGEPY 373

Query: 414 QQSSQT---CVLAIGPQ--QENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESV 468
           Q+ S+    CV  I  Q    +W+ LGDVF+ N Y V+D++N +V  A  N + +L ++ 
Sbjct: 374 QEGSKYYGYCVSNIEGQAIHSSWI-LGDVFIKNFYTVFDMDNQQVGFALKNSNVNLVQNS 432

Query: 469 EVISSTV 475
            + ++T+
Sbjct: 433 NISTNTL 439

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 129/323 (39%), Gaps = 59/323 (18%)

Query: 167 HSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGI 226
           HS S T    ++ F I Y  +  A G     T+SIN L +    F VA           I
Sbjct: 141 HSNSCTV--TDSIFTIFY-RSGTAHGPLYTGTLSINGLKIQDFRFGVA-----------I 186

Query: 227 GLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLND-PQEQ 285
           G+P L     LS       D   + +S+        +L+   +I+K ++S+ L+  P E 
Sbjct: 187 GVPSLLDAYALSGIFGLPSDPTDSDTSVVG------LLQGSKLINKKSFSVLLSHIPSES 240

Query: 286 E------GSVLFGAVDHSKYTGTLYTVPLVD---------IYHDSASSKPVEFDITLYGL 330
                  G ++FG    + Y G L   PLV          I      S+ VE   T    
Sbjct: 241 RNLDDNNGLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELP-TAKNP 299

Query: 331 GVDKD-GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYD 389
            +DK+ G +S I        +D+G+T+   P + A  +   F+ +      F      Y 
Sbjct: 300 SIDKNIGIRSGI--------IDTGSTLVVLPQEDALALHSYFDDSISDGKNF----AIYC 347

Query: 390 TSNTNLVFDFGGFHITAPLDDFVVQQSSQT------CVLAI--GPQQENWVVLGDVFLSN 441
            S+  +  +    + T    +FV +   +       CV  I  G    +W+ LG+VFL +
Sbjct: 348 NSSEPIHLELSKHNWTILPSNFVGEPYPKDSPYNGYCVSNIQGGDISSSWI-LGEVFLQD 406

Query: 442 AYVVYDLENLEVSMAQANFDSSL 464
            Y V+D+E  +V  A  N  ++L
Sbjct: 407 LYTVFDIEGRQVGFANRNTKATL 429

>KLLA0D01507g Chr4 (133636..135183) [1548 bp, 515 aa] {ON} weakly
           similar to uniprot|Q12303 Saccharomyces cerevisiae
           YLR121C YPS3 Aspartic protease
          Length = 515

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 66/138 (47%), Gaps = 18/138 (13%)

Query: 336 GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKF-NATYDSRSGFYTMSCSYDTSNTN 394
           GSQS+   + I   +DSGTT+   P Q A ++   F N+  D  +  + + C+   S   
Sbjct: 317 GSQSSYIRSGI---VDSGTTLLILPTQDALDLHTFFVNSVSDGTN--FAIPCN---STEI 368

Query: 395 LVFDFGGFHITAPLDDFVVQQSSQT------CVLAIGPQQ--ENWVVLGDVFLSNAYVVY 446
           L  +  G       ++++ +   Q       CV  I   +  E+W+ LG VFL + Y V+
Sbjct: 369 LSLEINGVKWPISSEEYLGEAYPQDSYYYGYCVSNIQGLELDESWI-LGAVFLKDKYAVF 427

Query: 447 DLENLEVSMAQANFDSSL 464
           D++N +  +A  N ++ L
Sbjct: 428 DVQNQQFGLANKNENAIL 445

>Kwal_YGOB_Anc_5.326 s33 (642310..642363,642439..642930) [546 bp,
           181 aa] {ON} ANNOTATED BY YGOB -
          Length = 181

 Score = 30.4 bits (67), Expect = 7.6,   Method: Composition-based stats.
 Identities = 16/49 (32%), Positives = 25/49 (51%)

Query: 38  KVTVLVDTGSSDLWVMGTDNPLCASGRRGKKFLGDEGDARVEIEAQQKD 86
           K+  +VD  + + W    D  L A GR G++ L    D RVE  A++ +
Sbjct: 113 KIYEMVDNWTFESWEERRDAYLSAGGREGRRALAKPDDQRVESSAEKME 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 54,334,036
Number of extensions: 2206592
Number of successful extensions: 5541
Number of sequences better than 10.0: 173
Number of HSP's gapped: 5258
Number of HSP's successfully gapped: 277
Length of query: 569
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 454
Effective length of database: 40,294,809
Effective search space: 18293843286
Effective search space used: 18293843286
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 68 (30.8 bits)