Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0I002303.567ON57157125070.0
YGL244W (RTF1)3.567ON55858016460.0
Skud_7.233.567ON56458016210.0
Suva_7.173.567ON56958216210.0
Smik_7.173.567ON56558016120.0
KAFR0J028803.567ON55556215770.0
NDAI0I032403.567ON56358515740.0
TPHA0A060003.567ON54957715220.0
ZYRO0E09526g3.567ON56058515190.0
KLTH0G00726g3.567ON56155614930.0
Kpol_507.103.567ON46147014630.0
AFR266W3.567ON56256014540.0
CAGL0H07711g3.567ON56656014540.0
Kwal_47.192653.567ON56749614440.0
Ecym_25973.567ON56251614270.0
TBLA0E002203.567ON57050913990.0
NCAS0E002603.567ON55833313141e-176
TDEL0D063503.567ON56532512471e-165
SAKL0F00814g3.567ON57433412421e-165
KLLA0A00737g3.567ON58233411401e-149
Kpol_1054.581.530ON40161761.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0I00230
         (571 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   970   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   638   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   629   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   629   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   625   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   612   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   610   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   590   0.0  
ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   589   0.0  
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   579   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   568   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   564   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   564   0.0  
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   560   0.0  
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   554   0.0  
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   543   0.0  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   510   e-176
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   484   e-165
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   483   e-165
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   443   e-149
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    34   1.2  

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  970 bits (2507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 488/571 (85%), Positives = 488/571 (85%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSDI                 RVLTSTVSKRSKQSDATASKKRRIYEGS           
Sbjct: 1   MSDIDEDLLALAGADEEEDDERVLTSTVSKRSKQSDATASKKRRIYEGSEEEVYDDEADD 60

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD
Sbjct: 61  VDEEEDDYNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120

Query: 121 RSQTMRKYQERKLFRERKRQQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQ 180
           RSQTMRKYQERKLFRERKRQQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQ
Sbjct: 121 RSQTMRKYQERKLFRERKRQQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQ 180

Query: 181 RSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXV 240
           RS                                     YNPLAIKSKY          V
Sbjct: 181 RSDDEYEEDEEEEEEDDYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDV 240

Query: 241 KWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRM 300
           KWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRM
Sbjct: 241 KWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRM 300

Query: 301 VKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETAN 360
           VKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETAN
Sbjct: 301 VKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETAN 360

Query: 361 ISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQ 420
           ISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQ
Sbjct: 361 ISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQ 420

Query: 421 YARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNY 480
           YARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNY
Sbjct: 421 YARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNY 480

Query: 481 DHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADER 540
           DHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADER
Sbjct: 481 DHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADER 540

Query: 541 KEKELLLAQFRRLGGLENMISKINVNFDIDL 571
           KEKELLLAQFRRLGGLENMISKINVNFDIDL
Sbjct: 541 KEKELLLAQFRRLGGLENMISKINVNFDIDL 571

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/580 (57%), Positives = 409/580 (70%), Gaps = 35/580 (6%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSD+                 +VLT+T +KR+K +D + SKKRRI  GS           
Sbjct: 1   MSDLDEDLLALAGADESEEEDQVLTTTSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDDY- 59

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NP+ VGN D G +E   EE NPFPL+GKYKDE DRE+LESLPE+ERET+LF+
Sbjct: 60  --------NPYSVGNADYGSEE--EEEANPFPLEGKYKDESDREHLESLPEMERETLLFE 109

Query: 121 RSQTMRKYQERKLFRERKR-----QQEAK------PTRSSGRTAHSTGHSDLKASKLSQL 169
           RSQ M+KYQERKLFR R R     QQ AK       TR+S R+ H+TGHSD+KASKLSQL
Sbjct: 110 RSQIMQKYQERKLFRARGRDMKEQQQRAKNDEDSRKTRASTRSTHATGHSDIKASKLSQL 169

Query: 170 KRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKY 229
           K+QR +K NR  S                                     YNP   +  Y
Sbjct: 170 KKQRARK-NRHYSDNEDEDDEEDYREEDYKDDEGSEYGDDEE--------YNPFDRRDTY 220

Query: 230 XXXXXXXXXXVKWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGV 289
                      +  +D  R  E++DFNKLRIGRSFVAKFCFYPGF D V GCYGRVNVG 
Sbjct: 221 DKREEVEWAEEEDEQD--REPEISDFNKLRIGRSFVAKFCFYPGFEDAVKGCYGRVNVGT 278

Query: 290 DKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEY 349
           DKR+G+T YRMV+IE+VFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMN+FSDG F ++EY
Sbjct: 279 DKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFAEDEY 338

Query: 350 ERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAV 409
           +RYLR+L+ + + +PS H LSNK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAV
Sbjct: 339 QRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAV 398

Query: 410 LEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKN 469
           LEKTVLR KLQYA+E+NNE+D+AKYSAQLRNFEKRM+ YEKHHEND +  KKLG LTSKN
Sbjct: 399 LEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKN 458

Query: 470 RKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQK 529
           RK+NM   +N +H KKEDS     DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ+
Sbjct: 459 RKLNMSNIRNAEHVKKEDSN--NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQE 516

Query: 530 EIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           +++++K+A +++EKELL+AQFRRLGGLE M+ ++++ FD+
Sbjct: 517 KLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKFDL 556

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/580 (56%), Positives = 406/580 (70%), Gaps = 29/580 (5%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSD+                 +VLTST +KR+K +D + SKKRRI   S           
Sbjct: 1   MSDLDEDLLALAGADESEEEDQVLTSTSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEE 60

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NP+ VGN   G   +E EE NPFPL+GK+KDE DRE+LESLPE+ERET+LF+
Sbjct: 61  DDY-----NPYSVGNAGYG---SEGEEANPFPLEGKFKDENDREHLESLPEMERETLLFE 112

Query: 121 RSQTMRKYQERKLFRERKR-----QQEAKP------TRSSGRTAHSTGHSDLKASKLSQL 169
           RSQ M+KYQERKLFR R R     QQ AK       TR+S R+ H+TGHSD+KASKLSQL
Sbjct: 113 RSQIMQKYQERKLFRARGRDMKEQQQRAKDKEDSRKTRTSTRSTHATGHSDIKASKLSQL 172

Query: 170 KRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKY 229
           K+QR +K NRQ S                                      NP   K  Y
Sbjct: 173 KKQRARK-NRQYSDNEDEEDDEDEYREDNYKNEEESEYEDDEEY-------NPFDRKDLY 224

Query: 230 XXXXXXXXXXVKWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGV 289
                      +  ++ DR  E++D+NKLRIGRSFVAKFCFYPGF D+V GCYGRVN+G 
Sbjct: 225 DKREEEVEWAEEGEDELDREPEISDYNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNIGT 284

Query: 290 DKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEY 349
           DKR+G+T YRMV+IE+VFLQKPY+MGKFYTNQYFGVTQGKDRKVFQMN+FSDG F  +EY
Sbjct: 285 DKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVTQGKDRKVFQMNYFSDGSFADDEY 344

Query: 350 ERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAV 409
            RY ++L+ +++ +PS H LSNK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAV
Sbjct: 345 RRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAV 404

Query: 410 LEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKN 469
           LEKTVLR KLQYA+E+NNE+D+AKYSAQLRNFEKRM+ YEKHHEND +  K LG LTSKN
Sbjct: 405 LEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSIYEKHHENDQSDIKTLGELTSKN 464

Query: 470 RKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQK 529
           RK+NM   +N +H KKED++    DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ+
Sbjct: 465 RKLNMSNIRNAEHVKKEDNS--NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQE 522

Query: 530 EIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           +++++KEA +++EKELLLAQFRRLGGLE MI ++++ FD 
Sbjct: 523 KLQEDKEAKDKREKELLLAQFRRLGGLERMIGELDIKFDF 562

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/582 (56%), Positives = 411/582 (70%), Gaps = 28/582 (4%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSD+                 +VLTST +KR+K +D + SKKRRI  GS           
Sbjct: 1   MSDLDEDLLALAGADESEEEDQVLTSTSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEE 60

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NP+ VGN   G +E E  E NPFPL+GKYKDE DRE+LESLPE+ERET+LF+
Sbjct: 61  DDY-----NPYSVGNTGYGSEEEEEVEPNPFPLEGKYKDESDREHLESLPEMERETLLFE 115

Query: 121 RSQTMRKYQERKLFRER----KRQQE---------AKPTRSSGRTAHSTGHSDLKASKLS 167
           RSQ M+KYQERKLFR R    K QQ+         ++ TR+S R+ H+TGHSD+KASKLS
Sbjct: 116 RSQIMQKYQERKLFRARGKDMKEQQQRKRARDDEDSRKTRTSTRSTHATGHSDIKASKLS 175

Query: 168 QLKRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKS 227
           QLK+QR +K NRQ S                                     YNP   K 
Sbjct: 176 QLKKQRARK-NRQYSDSEDEQDDQEEYREDDYKNDEGSEYGDDEE-------YNPFDRKG 227

Query: 228 KYXXXXXXXXXXVKWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNV 287
            Y           +  ++ DR  E++DFNKLRIGRSFVAKFCFYPGF D+V GCYGRVNV
Sbjct: 228 VYDKREEEVEWAEEEEDELDRDPEISDFNKLRIGRSFVAKFCFYPGFEDVVKGCYGRVNV 287

Query: 288 GVDKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQN 347
           G DKR+G+T YRMV+IE++FLQKPYNMGKF+TNQYFGVTQGKDRKVFQMN+FSDG FT +
Sbjct: 288 GTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNYFSDGLFTDD 347

Query: 348 EYERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTN 407
           EY+RY ++L+ +++ +PS H LSNK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTN
Sbjct: 348 EYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTPLTDKTTDEVVRHRMQFNKKLSGTN 407

Query: 408 AVLEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTS 467
           AVLEKTVLR KLQYA+E+NNE+D+AKYSAQLRNFEKRM+ YEKHHEND +  K LG LTS
Sbjct: 408 AVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKTLGELTS 467

Query: 468 KNRKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQ 527
           KNRK+N+   +N +H KKED++    DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQ
Sbjct: 468 KNRKLNISNIRNAEHVKKEDTS--NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEMAQ 525

Query: 528 QKEIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           Q+++++++E+ ER+EKELLLAQFRRLGGLE MI ++++ FD 
Sbjct: 526 QEKLQEDRESKERREKELLLAQFRRLGGLERMIGELDIKFDF 567

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/580 (57%), Positives = 404/580 (69%), Gaps = 28/580 (4%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSD+                 +VLT+T +KR+K +D + SKKRRI  G+           
Sbjct: 1   MSDLDEDLLALAGADESEEEDQVLTTTSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDE 60

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NP+ VGN   G +E E  E NPFPL+GKYK+E DRE+LESLPE+ERET+LF+
Sbjct: 61  EDDY----NPYSVGNASYGSEEVE--EPNPFPLEGKYKNESDREHLESLPEMERETLLFE 114

Query: 121 RSQTMRKYQERKLFRERKR-----QQEAK------PTRSSGRTAHSTGHSDLKASKLSQL 169
           RSQ M+KYQERKLFR R R     QQ AK       TR+S R+ H+TGHSD+KASKLSQL
Sbjct: 115 RSQIMQKYQERKLFRARGRDMKEQQQRAKNDEDSRKTRTSTRSTHATGHSDIKASKLSQL 174

Query: 170 KRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKY 229
           K+QR +K NR  S                                     YNP      Y
Sbjct: 175 KKQRARK-NRHYSDNEGEVDDEDEYREDDYKDDEGSEYGDDEE-------YNPFDRGDLY 226

Query: 230 XXXXXXXXXXVKWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGV 289
                      +  E  DR  E++DFNK+RIGRSFVAKFCFYPGF D+V GCYGRVNVG 
Sbjct: 227 DKREEEVEWAEEEDE-LDREPEISDFNKVRIGRSFVAKFCFYPGFEDVVKGCYGRVNVGT 285

Query: 290 DKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEY 349
           DKR+G+T YRMV+IE+VFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMN+FSDG F  +EY
Sbjct: 286 DKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNYFSDGLFADDEY 345

Query: 350 ERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAV 409
           +RYLR+L+ + I +PS H L+NK+KE++ F+  PLT+K TDE+VR+RM FNKKLSGTNAV
Sbjct: 346 QRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLTDKTTDEVVRHRMQFNKKLSGTNAV 405

Query: 410 LEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKN 469
           LEKTVLR KLQYA+E+NNE+D+AKYSAQLRNFEKRM+ YEKHHEND +  KKLG LTSKN
Sbjct: 406 LEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHHENDQSDIKKLGELTSKN 465

Query: 470 RKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQK 529
           RK+NM   +N +H KKED      DSKSDPFSRLKTRTK+YYQE+QKEEN KAK +AQQ+
Sbjct: 466 RKLNMSNIRNAEHVKKEDVN--NFDSKSDPFSRLKTRTKVYYQEIQKEENAKAKEIAQQE 523

Query: 530 EIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           +++++K A E++EKELLLAQFRRLGGLE MI ++++ FD 
Sbjct: 524 KLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKFDF 563

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  612 bits (1577), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/562 (59%), Positives = 402/562 (71%), Gaps = 47/562 (8%)

Query: 27  TVSKRSKQS-DATASKKRRIYEGSXXXXXXXXXXXXXXXXXXXNPHEVGNYDTGDD---- 81
           T SKR+KQS D++A+KKRRI                       NP  +   D GD     
Sbjct: 24  TTSKRTKQSGDSSANKKRRI------------ESDSDEDEDDYNPAAI---DGGDGAYNE 68

Query: 82  --EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRER-- 137
             + E  E+NPFPL+GKYK+E+DR+YLESLPE+ERETVL+DRSQTMRKY+ER+ F++R  
Sbjct: 69  NDDEEEYEENPFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNK 128

Query: 138 --KRQQE------AKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXXXXX 189
             KRQ+E      A  TRSSGR  H+TGH        + LK  +  +L +QR        
Sbjct: 129 NLKRQKERNEDDEALKTRSSGRATHATGH--------TDLKASKLSQLKKQREKKNKSRQ 180

Query: 190 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXVKWAEDNDRV 249
                                         YNP   K+ Y           +     DR 
Sbjct: 181 YSDYEEEEEEDEEEFEDEYREGSEYEEEEDYNPYERKTAYKDEEDEEVEWAEDT---DRD 237

Query: 250 SELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQ 309
           +EL DFNKLRIGRSFVAKFCFYP F ++V GCYGRVNVGVDKR+GQT YRMVKIE++FLQ
Sbjct: 238 TELNDFNKLRIGRSFVAKFCFYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQ 297

Query: 310 KPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHIL 369
           KPY+MGKF+TNQYFGVTQGKDRKVFQM+FFSDG  T  EYERY+RSLE+++I +P+ + L
Sbjct: 298 KPYSMGKFFTNQYFGVTQGKDRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTL 357

Query: 370 SNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNER 429
            +KSKE+VSF++EPLTEKLT+EIVRNRM+FNKKLSGTNAVLEKTVL+ KLQYARE+NNER
Sbjct: 358 KSKSKELVSFVSEPLTEKLTNEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNER 417

Query: 430 DVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSA 489
           DVAKYSAQLRNFEKRMN YEKHHEND TG+KKLGALTSKN+KVNM K +N +H KKED  
Sbjct: 418 DVAKYSAQLRNFEKRMNMYEKHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLP 477

Query: 490 GPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQ 549
              +D KSDPFSRLKTRTKIYYQE+QKEENE+AKALAQQK++E+N+EA +RKEKELLLAQ
Sbjct: 478 ---ID-KSDPFSRLKTRTKIYYQEIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQ 533

Query: 550 FRRLGGLENMISKINVNFDIDL 571
           FRRLGGLE MIS +N+ FD+ +
Sbjct: 534 FRRLGGLEKMISGLNIEFDLGI 555

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/585 (56%), Positives = 398/585 (68%), Gaps = 38/585 (6%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSDI                   L +T  KR+K  D   SK+++I               
Sbjct: 1   MSDIDEDLLALAGADEEEEDDEQLLTTSGKRAKNHDQVGSKRKKI---------EVDSEA 51

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFD 120
                   NP+  GN     +E E +E NPFPL+ KYKDE DRE+LESLPE+ERET+LF+
Sbjct: 52  EEEEEDDYNPYG-GN---QSEEEEIDEPNPFPLENKYKDEDDREHLESLPEMERETLLFE 107

Query: 121 RSQTMRKYQERKLFRERKR-----------QQEAKPTRSSGRTAHSTGHSDLKASKLSQL 169
           RSQ MRKYQERKLFRER+R           ++E K TRSS R  H+TGHSDLKASKLSQL
Sbjct: 108 RSQVMRKYQERKLFRERQRNIKEQQERNELEEEGKKTRSSTRATHATGHSDLKASKLSQL 167

Query: 170 KRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKY 229
           K+QR++K   Q                                       YNP A +  Y
Sbjct: 168 KKQRERKTRDQ--DYNDVEDEDDLDDYAPDDNYKHEDSEYEEEGEEDEEDYNPYATRKSY 225

Query: 230 XXXXXXXXXXVKWAED-NDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVG 288
                     V+WAE+  DR +EL DFNK+++GRSF+AK+CFYPGF+DL+ GCYGRVNVG
Sbjct: 226 DMDKDE----VEWAEEQTDREAELDDFNKVKVGRSFIAKYCFYPGFSDLLKGCYGRVNVG 281

Query: 289 VDKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNE 348
            D+R+G + YRMVKIEKVFL+ PY MG F+TNQY GVTQG DRKV QMN FSDG FT  E
Sbjct: 282 TDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQGHDRKVLQMNIFSDGLFTSAE 341

Query: 349 YERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNA 408
           ++RY R+LE +++++PS H+L  KSKEI +F++EPLT K+TD IVRNRM+FNKKLSGTNA
Sbjct: 342 FDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAKMTDAIVRNRMMFNKKLSGTNA 401

Query: 409 VLEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSK 468
           VLEKTVL+ KL+YARE+NNERDVAKYS+QLRN EKRM+ YEKHHEND  G  KLGALTSK
Sbjct: 402 VLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSVYEKHHENDQLGMNKLGALTSK 461

Query: 469 NRKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQ- 527
           NRKVNM K +N +H KKED     +DSKSDPFSRLKTRTKIYYQEVQKEENEKA+A+A+ 
Sbjct: 462 NRKVNMDKIRNAEHIKKEDHG---LDSKSDPFSRLKTRTKIYYQEVQKEENEKAQAMAEA 518

Query: 528 -QKEIEKNKEADERKEKELLLAQFRRLGGLENMISK--INVNFDI 569
            QK++++NK  +E KEKELLLA+F+RLGGLEN+I    INV FDI
Sbjct: 519 KQKQLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVTFDI 563

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/577 (54%), Positives = 401/577 (69%), Gaps = 36/577 (6%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSDI                  V+ S+ SKR + ++ + SKKR I  G            
Sbjct: 1   MSDIEEDLLALAGVGDSEEEEDVVISSTSKRGRSNEDSVSKKRHINVGEDDEDDY----- 55

Query: 61  XXXXXXXXNPHEVGNYDTGDDEAENEEQN-PFPLQGKYKDEKDREYLESLPEVERETVLF 119
                   NP   G    GDD+  ++E+  PFPL+GKY+DE+DR+YLESLPE+ERET+LF
Sbjct: 56  --------NPASAG---LGDDDDNDDEEEAPFPLEGKYRDERDRDYLESLPEMERETLLF 104

Query: 120 DRSQTMRKYQERKLFRER----KRQQEA---KPTRSSGRTAHSTGHSDLKASKLSQLKRQ 172
           +RSQ M+KY++R LFRER    KRQ+E+   +  RSS R++  TGHSD+K+SKLSQLK+Q
Sbjct: 105 ERSQLMQKYKDRMLFRERQRTLKRQRESSENRKVRSSTRSSKVTGHSDVKSSKLSQLKKQ 164

Query: 173 RDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXX 232
           R++K N   S                                     Y+P   KS Y   
Sbjct: 165 RERKNNHHYSDEDDEDEYEEEENIYEDKYEEGSEYEDES--------YDPYKRKSTYAEE 216

Query: 233 XXXXXXXVKWAEDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKR 292
                  VKWA+D DR S + DFNK++IGRSFVAK+CFYPGFND+V  CYGRVNVGV+K 
Sbjct: 217 SEEED--VKWADDTDRESNVNDFNKIKIGRSFVAKYCFYPGFNDIVKDCYGRVNVGVNKN 274

Query: 293 SGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERY 352
           + Q +YRMVKIEKVFLQKPY+MG F+TNQYFGVTQGKDRKVFQM FFSDG  TQ+EYERY
Sbjct: 275 TNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVTQGKDRKVFQMKFFSDGAITQDEYERY 334

Query: 353 LRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEK 412
           +R+LE++N++ PS + LSNK KE+  F+ EP+T KLTDE+VRNRM+FNKKLSGTNAVLEK
Sbjct: 335 VRALESSNLTIPSTYALSNKFKEVDEFVNEPMTVKLTDEVVRNRMIFNKKLSGTNAVLEK 394

Query: 413 TVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKV 472
           TVLR KL +A+++N+ERD+AKYS+QLRN EKR+  YEKHHEND  G KKLG LTSKNRK+
Sbjct: 395 TVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLMTYEKHHENDQQGAKKLGKLTSKNRKL 454

Query: 473 NMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIE 532
           NM K K Y    KED    + D K+DPFSRLKTRTK+YYQE+Q+EENEKAK LA+QK+++
Sbjct: 455 NMDKIK-YGENVKEDR-DESFDIKTDPFSRLKTRTKVYYQEIQEEENEKAKELARQKKMQ 512

Query: 533 KNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           +NKEA E+KE+ELLLA+FRRLGGLE+++  +++N  +
Sbjct: 513 ENKEAIEQKERELLLAKFRRLGGLESIVHNLDINIKL 549

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  589 bits (1519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/585 (55%), Positives = 401/585 (68%), Gaps = 39/585 (6%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXX 60
           MSDI                  VL S+ +KRS +SD  +SKKRRI               
Sbjct: 1   MSDIEEDLLALAGADEEEDDDEVLASS-AKRSGKSDRASSKKRRI-------EVEGGEDD 52

Query: 61  XXXXXXXXNPHEVGNYDTGD-DEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLF 119
                   NP   G   TGD D+ E EE+NPFPL+GKYKDE DR+YL  LPE+ERET+LF
Sbjct: 53  EDEDEDDYNPAASGA-GTGDYDDEEEEEENPFPLEGKYKDEADRDYLGGLPEMERETMLF 111

Query: 120 DRSQTMRKYQERKLFRER-----------KRQQEAKPTRSSGRTAHSTGHSDLKASKLSQ 168
           +RSQ M+KYQ+RK+FR+R           K+Q+E K TRSS R+  +TGHSD+KASKLSQ
Sbjct: 112 ERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQQEEGKKTRSSTRSTVATGHSDIKASKLSQ 171

Query: 169 LKRQRDKK-LNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKS 227
           L++QR+KK  NR  S                                     Y+P + +S
Sbjct: 172 LRKQREKKSQNRPYSDEEEEGEDEGDDYGYEDKKYSDEEDEEE---------YDPYSRRS 222

Query: 228 KYXXXXXXXXXXVKWAEDN-DRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVN 286
           ++          V+WAE+  DR + +ADFNK +IGRSFVA FCFYPGFND+V G YGRVN
Sbjct: 223 RFEEDEDE----VQWAEEALDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVN 278

Query: 287 VGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQ 346
           VG DKRSG+TLYRMVKIEKVFLQKPYNMGKF TNQYFGVTQGKDRKVFQM +FSDG  TQ
Sbjct: 279 VGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQ 338

Query: 347 NEYERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGT 406
            E+ERY+ +LE  +I+ PS + L NK+KEI SF+++PLTE+LT++IVRNRM+FNKKLSG 
Sbjct: 339 QEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGV 398

Query: 407 NAVLEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALT 466
           NAVLEKTVL+ KLQYA E+ NERD+AKYS+QLR+FEKRM+ YEK HEND  G  KL ALT
Sbjct: 399 NAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNALT 458

Query: 467 SKNRKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALA 526
           +KNR+VN+ + KN +  KKED+   + DSKSDPFSRLKTRTK YYQE+QKEENEKAK  A
Sbjct: 459 TKNRRVNIDRLKNAEQVKKEDT---SFDSKSDPFSRLKTRTKFYYQEIQKEENEKAKNDA 515

Query: 527 QQKEIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDIDL 571
           +QK++E+++   ERK+ ELL A+FRRLGGL+ +I  ++  F ID+
Sbjct: 516 EQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/556 (57%), Positives = 397/556 (71%), Gaps = 36/556 (6%)

Query: 29  SKRSKQSDATASKKRRIYEGSXXXXXXXXXXXXXXXXXXXNPHEVGNYDTGDDEAENEEQ 88
           SK+  +SD  +S KRRI +                     NP E  +YD   +E E+EE 
Sbjct: 29  SKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDY----NP-EAASYDMDSEEDEDEEP 83

Query: 89  NPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR--------- 139
           NPFPL+GKYK+E+DR YLESLPE+ERET+LF+RSQTM+KYQER++ +ER +         
Sbjct: 84  NPFPLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKR 143

Query: 140 --QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXXXXXXXXXXXXX 197
             QQE K TRSS R+  +TGHSDLK S+LS+LK+QR KK                     
Sbjct: 144 QLQQEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKK----------KGTYEYSEEEE 193

Query: 198 XXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXVKWAEDND--RVSELADF 255
                                 Y P+     Y          +KWAED D  R  EL DF
Sbjct: 194 EEGQNEEDEYGYQDQEDESEDDYEPM-----YKKGKTEDEEELKWAEDEDLDREPELGDF 248

Query: 256 NKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMG 315
           N+++IGRSFVAKFCFYP FND++ GCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMG
Sbjct: 249 NRIKIGRSFVAKFCFYPEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMG 308

Query: 316 KFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNKSKE 375
           KF+TNQYFGVTQGK+RKVFQMNFFSDG  TQ E+ERYLRSLET+ I++PS +I++NKS E
Sbjct: 309 KFFTNQYFGVTQGKNRKVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKSNE 368

Query: 376 IVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKYS 435
           I SF+++P+T KLTDE+VRNRM+FNKKLSGTNAVLEKT+L+ KLQYA+ES +ERDVAKYS
Sbjct: 369 INSFVSQPVTSKLTDELVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYS 428

Query: 436 AQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTVDS 495
           +QLRN EKR+++YEKHHEND  G+KKLGALTSKNR+VN+ K KN +  KKED+     D+
Sbjct: 429 SQLRNLEKRLSSYEKHHENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDTP---FDA 485

Query: 496 KSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFRRLGG 555
           K+DPFSRLKTRTKIYYQE+Q+EENEKAK LA+Q++++K+      KE++LLLA+F+ LGG
Sbjct: 486 KTDPFSRLKTRTKIYYQEIQREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGG 545

Query: 556 LENMISKINVNFDIDL 571
           LE++IS ++    +D+
Sbjct: 546 LEDIISNMDFQVSLDV 561

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/470 (62%), Positives = 353/470 (75%), Gaps = 21/470 (4%)

Query: 112 VERETVLFDRSQTMRKYQERKLFRERKRQ-----------QEAKPTRSSGRTAHSTGHSD 160
           +ERET+LF+RSQ M+KYQ+RKLFRER+R            QE K TR+S R+  +TGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 161 LKASKLSQLKRQRDKKLNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXY 220
           +KASKLSQLKRQR+K  NRQ S                                      
Sbjct: 61  VKASKLSQLKRQREKNKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYD--- 117

Query: 221 NPLAIKSKYXXXXXXXXXXVKWAEDN-DRVSELADFNKLRIGRSFVAKFCFYPGFNDLVN 279
            P + K +Y          VKWAE++ +R S++ DFNK++IGRSFVA++CF+P FN++V 
Sbjct: 118 -PYSRKPRYREEEEEED--VKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVK 174

Query: 280 GCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFF 339
           GCYGRVNVGVD+R+ QT YRMVKIEKVFLQKPYNMGKF+TNQYFGVTQGKDRKVFQMNFF
Sbjct: 175 GCYGRVNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFF 234

Query: 340 SDGHFTQNEYERYLRSLETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLF 399
           SDG  T  E++RY RSL+ +N S+PS + L+ K KEI  F++EP+T+KLTDEIVRNRM+F
Sbjct: 235 SDGPITIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVF 294

Query: 400 NKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGT 459
           NKKLSGTNAVLEKTVLR KLQYA+E+NNERD+AKYS QLRN EKR++ YEKHHEND  G 
Sbjct: 295 NKKLSGTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGA 354

Query: 460 KKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEEN 519
           +KLGALTSKNRKVNM K KN +H K+ED      DSK+DPFSRLKTRTKIYYQEVQKEEN
Sbjct: 355 RKLGALTSKNRKVNMDKAKNVEHVKEED---INFDSKADPFSRLKTRTKIYYQEVQKEEN 411

Query: 520 EKAKALAQQKEIEKNKEADERKEKELLLAQFRRLGGLENMISKINVNFDI 569
           EKAK LAQQK++E+++EA  +KE+ELLLA+FRRLGGLE++IS I++   I
Sbjct: 412 EKAKELAQQKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/560 (54%), Positives = 390/560 (69%), Gaps = 41/560 (7%)

Query: 27  TVSKRSKQSDATASKKRRIYE---GSXXXXXXXXXXXXXXXXXXXNPHEVGNYDTG--DD 81
           T  KRSK  D++ SKKRR+ +   G                    NP     +D G    
Sbjct: 27  TSQKRSKH-DSSGSKKRRVMDEESGDDEDNDNDAGDEEDEDEDDYNPGTEYGFDEGHEAS 85

Query: 82  EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR-- 139
           E E EE+NP+PL GKY+D+ DRE++E++PE+ERET+LF+RSQ M+KYQERK+ RER +  
Sbjct: 86  EDEVEEENPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKNI 145

Query: 140 --------QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXXXXXXX 191
                   Q++    RSSGR+  +TGHSDL+ SKLS+L++QR KK               
Sbjct: 146 RAQQQRRQQKDGSALRSSGRSTRTTGHSDLRDSKLSELRKQRAKK--------------- 190

Query: 192 XXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXVKWAEDN-DRVS 250
                                       Y+P   +  Y          VKWAED+ DR +
Sbjct: 191 -SGNYDYSAGEDDSDHSDDYVDSDNEDDYDPHDGRQLYREEADE----VKWAEDDLDRDA 245

Query: 251 ELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQK 310
           EL DFNK+++GRSFVAKFCFYP FN  V GCYGRVN+GVDK +GQ +YRMVKIEKVFLQK
Sbjct: 246 ELDDFNKIKVGRSFVAKFCFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQK 305

Query: 311 PYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILS 370
           PYNMGKF+TNQYFGVTQGKDRKVFQMNFFSDG   Q EYERYL  +   +I++PS + L+
Sbjct: 306 PYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLN 365

Query: 371 NKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERD 430
           NK+K++ +F+++P+T KLTD+IVRNRM FNKKL+GTNAVLEKTVLR KLQYAR++NNE+D
Sbjct: 366 NKAKDLTNFVSQPMTPKLTDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKD 425

Query: 431 VAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAG 490
           +AKYS+QL+N EKRM++YEKHHEND TG +KL ALTSKNRKVN+ K ++ ++ KKEDSA 
Sbjct: 426 IAKYSSQLKNLEKRMSSYEKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSA- 484

Query: 491 PTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQF 550
            T++ K+DPFSRLKTRTKIYYQE+Q+EENEKA+ LA+QK+ +  +E  +RK++  LLA+F
Sbjct: 485 -TLNVKTDPFSRLKTRTKIYYQEIQQEENEKAQELAKQKQQQDKEEKHDRKQQ--LLAKF 541

Query: 551 RRLGGLENMISKINVNFDID 570
           RRLGGLE+ +SK++    +D
Sbjct: 542 RRLGGLEDALSKLDFRIKLD 561

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/560 (56%), Positives = 390/560 (69%), Gaps = 26/560 (4%)

Query: 23  VLTSTVSKRSKQSDATASKKRRIYEGSXXXXXXXXXXXXXXXXXXXNPHE-VGNYDTGDD 81
           VLT+T +KR+K S  +  KKRRI                       NP +     D  D 
Sbjct: 22  VLTTT-NKRTKGSSNSQVKKRRI------------EVDSEDEEDDYNPDDGYEPVDVSDK 68

Query: 82  EAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKRQ- 140
           E E EE+NPFPL+GKYKD  DR++LESLPE+ERET+LF+RSQ MRKYQERKLFRER R  
Sbjct: 69  EEEEEEENPFPLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNL 128

Query: 141 --------QEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXXXXXXXX 192
                   ++++ TRSS R+  +TGHSD+KASKLSQLK+QR++K   +RS          
Sbjct: 129 KQQKIQAGEDSQKTRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDN 188

Query: 193 XXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXVKWAEDN-DRVSE 251
                                      Y+P A KSKY               +  DR +E
Sbjct: 189 YGDEDEFKDDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAE 248

Query: 252 LADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKP 311
           + DFNK+RIGRSFVAK+CFYPGFN+L+ GCYGRVNVGVDKR+G   YRMVKIEKVFLQKP
Sbjct: 249 VQDFNKIRIGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKP 308

Query: 312 YNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSN 371
           YNMGKF+TNQYFGVTQGKDRKVFQMNFFSDG F + E+ERYL++L+++NI +PS + +  
Sbjct: 309 YNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKT 368

Query: 372 KSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDV 431
           K KEI  FI++PLTEKLTDEIVRNRM+ NKKLSGTNAVLEKT+L+ KL+YA+E+ NE D+
Sbjct: 369 KFKEISEFISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDI 428

Query: 432 AKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGP 491
           AKYS QLRNFEKRM  YEKHHEND    KKL  LTSKNRK+NM + +N +  KKE+    
Sbjct: 429 AKYSKQLRNFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDV-- 486

Query: 492 TVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFR 551
             DSKSDPFSRLKTRTK+YYQE+QKEENEKAK  A Q++++ ++E  + KEK+L+LA+FR
Sbjct: 487 NFDSKSDPFSRLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFR 546

Query: 552 RLGGLENMISKINVNFDIDL 571
           RLGGL+ +I  INV+  +D+
Sbjct: 547 RLGGLQKIIGSINVDIKLDI 566

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  560 bits (1444), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/496 (59%), Positives = 362/496 (72%), Gaps = 28/496 (5%)

Query: 89  NPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR--------- 139
           NPFPL+GKYKDE+DREYLESLPE+ERET+LFDRSQ M+KY+ER++ +ER R         
Sbjct: 87  NPFPLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKR 146

Query: 140 --QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXXXXXXXXXXXXX 197
             QQE+  TRSS R+  +TGHSDLK S+LS+LK+Q        R+               
Sbjct: 147 QLQQESTKTRSSTRSTRTTGHSDLKESRLSELKKQ--------RAKKSGTYDYSEDEDDG 198

Query: 198 XXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXXXXXVKWAE--DNDRVSELADF 255
                                 Y P   K K           VKWAE  D DR  EL+DF
Sbjct: 199 GRDEEDDYGYDDQDEEEESEDDYQPGYKKDKIDEDDEE----VKWAEEDDLDRDPELSDF 254

Query: 256 NKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMG 315
           NK++IGRSFVAKFCFYP FNDL+ GCYGRVNVGVDKR+ QTLYRMVKIE+VFLQKPYNMG
Sbjct: 255 NKVKIGRSFVAKFCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMG 314

Query: 316 KFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNKSKE 375
           KF+TNQYFGVTQGKDRKVFQMNFFSDG  TQ E+ERY++SL+ + I+ PS + L+NKS E
Sbjct: 315 KFFTNQYFGVTQGKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNE 374

Query: 376 IVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKYS 435
           I  F+++P+T KLTDE+VRNRMLFNKKLSGTNAVLEKT+LR KLQYA+E+ +ERDVAKYS
Sbjct: 375 INGFVSQPVTPKLTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYS 434

Query: 436 AQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTVDS 495
           +QLR+ E+R+ +YEKHHEND  G+KKLGALTS+NR+ NM K KN D  KKED+     D+
Sbjct: 435 SQLRSLERRLTSYEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKEDTP---FDA 491

Query: 496 KSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFRRLGG 555
           K+DPFSRLKTRTKIYYQE+QKEENEKAK LA+ +++EK       KE++LLLA+F+ LGG
Sbjct: 492 KTDPFSRLKTRTKIYYQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGG 551

Query: 556 LENMISKINVNFDIDL 571
           LE ++S I+    I++
Sbjct: 552 LEEVVSGIDFKLSIEV 567

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  554 bits (1427), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/516 (55%), Positives = 371/516 (71%), Gaps = 36/516 (6%)

Query: 69  NPHEVGNYDTGDDEA--ENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMR 126
           NP    +++  DD +  E EE+NP+PL+GKYKDE+DR  ++ +PE+ERET+LF+RSQ M+
Sbjct: 68  NPGTQYDFEGNDDGSGDEQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQ 127

Query: 127 KYQERKLFRERKRQQEAKPT----------RSSGRTAHSTGHSDLKASKLSQLKRQRDKK 176
           KYQERK+ R+R +   A+            RSSGR+  +TGHS+L+ SKLS+L++QR KK
Sbjct: 128 KYQERKVLRQRAKSIRAQQQQRQLQKDSTKRSSGRSTRTTGHSELRTSKLSELRKQRAKK 187

Query: 177 LNRQRSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPLAIKSKYXXXXXXX 236
                                                      Y+P      +       
Sbjct: 188 ----------------SGNYDYSESEEDESDQSDNYAESDNDDYDP---HHGHKDGFSDH 228

Query: 237 XXXVKWAE-DNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQ 295
              VKWAE D DR +EL DFNK++IGRSFVAKFCFYP F + V  CYGRVN+G+DK +G 
Sbjct: 229 DNEVKWAEEDLDRDAELEDFNKVKIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGL 288

Query: 296 TLYRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRS 355
            +YRMVKIE+VFLQKPY+MGKF+TNQYFGVTQGKDRKVFQMN+FSDG  TQ E+ERYL  
Sbjct: 289 PMYRMVKIERVFLQKPYSMGKFFTNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQ 348

Query: 356 LETANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVL 415
           +   ++++PS + L+NK+KE+ +F+++P+T KLTD+IVRNRM+FNKKL+GTNAVLEK+VL
Sbjct: 349 MAKYDMNKPSLYTLNNKAKELFNFVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVL 408

Query: 416 RSKLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMG 475
           + KLQYA+++NNE  VAKY+AQL+N EKRM++YEKHHEND TG +KLGALTSKNRKVNM 
Sbjct: 409 KDKLQYAKDTNNESAVAKYAAQLKNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMD 468

Query: 476 KTKNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNK 535
           K +  ++ +KEDS+   VD+KSDPFSRLKTRTKIYYQE+Q+EENEKA  LA+QK  E++K
Sbjct: 469 KIRLAENVRKEDSS--NVDAKSDPFSRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDK 526

Query: 536 EADERKEKELLLAQFRRLGGLENMISKINVNFDIDL 571
           E  E KE++LLLA+FRRLGGLE ++S I   F I+L
Sbjct: 527 ETQENKERQLLLAKFRRLGGLEEIVSSI--PFKIEL 560

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  543 bits (1399), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/509 (56%), Positives = 357/509 (70%), Gaps = 20/509 (3%)

Query: 76  YDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFR 135
           Y+T D   E EE NPFPL+GKYKDE DRE +ES+PE+ERET+LF+RSQ M+KYQERK+FR
Sbjct: 69  YNTMD--GEREEPNPFPLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFR 126

Query: 136 ERKRQQ---------EAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSXXXX 186
           ER R+Q           + TR+S R  H+TG SD K+SKLSQLKRQR+++   Q +    
Sbjct: 127 ERSRKQMSLNNNSNLTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNKGQSNYSDE 186

Query: 187 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNPL-AIKSKYXX--XXXXXXXXVKWA 243
                                               L   K+KY            VKWA
Sbjct: 187 DEYEDEYEDDLEQEYKSSGSDYDENEAAEEEEDDYDLYGSKTKYNHRGSEEDDDDDVKWA 246

Query: 244 EDNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKI 303
           ED DR S + DFNK++IGRSF  KFCFYP FND+V  CY +VNV  D+   + +YRMVKI
Sbjct: 247 EDIDRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKI 304

Query: 304 EKVFLQK-PYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANIS 362
           EKVFL K P++MGKF+TNQ FGVTQG +RKV+ M +FSD   T  E++RY+R+LE  +I+
Sbjct: 305 EKVFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHIT 364

Query: 363 RPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYA 422
           RPS + ++NK KEI +F TEPLT+KLTD+IVRNRM FNKKLSGTNAVLEKTVLR KLQ+A
Sbjct: 365 RPSVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFA 424

Query: 423 RESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDH 482
           +E+ NERDV KYSAQLRN EKR++ YEKHHEND TG KKLG LTS+NRK+NM K +N +H
Sbjct: 425 KETGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEH 484

Query: 483 GKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKE 542
            KK + AG   D+K+DPFSRLKTRTKIYYQE+QKEENEKA+ LA +K++E++ EA  + E
Sbjct: 485 -KKVELAG--FDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSE 541

Query: 543 KELLLAQFRRLGGLENMISKINVNFDIDL 571
           KE LLA+F+ LGGLE M+  +N  FD D+
Sbjct: 542 KEQLLAEFKCLGGLEKMVGSLNFKFDFDI 570

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  510 bits (1314), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 246/333 (73%), Positives = 290/333 (87%), Gaps = 6/333 (1%)

Query: 240 VKWAED-NDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLY 298
           V+WAE+  DR +EL DFNK++IGRSFVAK+CFYPGFN+L+ GCYG+VNVG D+R+G T Y
Sbjct: 229 VEWAEEQTDRETELDDFNKVKIGRSFVAKYCFYPGFNELIKGCYGKVNVGTDRRTGTTSY 288

Query: 299 RMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLET 358
           RMVKIEK+FLQKPY MG+F+TNQYFGVTQG +RKVFQMNFFSDG FT +E+ERY+RSL+T
Sbjct: 289 RMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSNRKVFQMNFFSDGLFTPDEFERYVRSLDT 348

Query: 359 ANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSK 418
           ++I++PS + L NK+KEI SFI+EPLTE+L D IVRNRMLFNKKLSGTNAVLEKTVLR K
Sbjct: 349 SHITKPSIYTLKNKAKEIQSFISEPLTEQLMDTIVRNRMLFNKKLSGTNAVLEKTVLRDK 408

Query: 419 LQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTK 478
           L+YA+E+NNERDVAKYS+QLRN EKR++ YEKHHEND  G+ KLGALTSKNRKVNM K K
Sbjct: 409 LRYAQENNNERDVAKYSSQLRNLEKRLSVYEKHHENDQVGSNKLGALTSKNRKVNMDKIK 468

Query: 479 NYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEAD 538
           N  H KKE+      DSKSDPFSRLKTRTKIYYQEVQ+EENEKAKALA +K++++N EA 
Sbjct: 469 NTGHEKKEEIG---FDSKSDPFSRLKTRTKIYYQEVQQEENEKAKALAAEKQLKENNEAQ 525

Query: 539 ERKEKELLLAQFRRLGGLENMISKIN--VNFDI 569
            RKE ELLLA+FRRLGGLENMI+ +N  VNFDI
Sbjct: 526 ARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  484 bits (1247), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 225/325 (69%), Positives = 283/325 (87%), Gaps = 3/325 (0%)

Query: 247 DRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKV 306
           DR +++ DFNK++IGRSFVAKFCFYPGFND+V G YGRVNVGVDKRSGQT YRMVKIEKV
Sbjct: 244 DREADITDFNKIKIGRSFVAKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKV 303

Query: 307 FLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSA 366
           F QKPYNMG F+TNQYFGVTQGKDRKVFQMNFFSDG+FTQ+EY+RYLR+L+  +I++PS 
Sbjct: 304 FFQKPYNMGNFFTNQYFGVTQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSM 363

Query: 367 HILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESN 426
           + L NK+KE+ +F+++PLT+KLTD+IVRNRMLFNKKLSG+NAVLEKTVL+ KL+YA+E+ 
Sbjct: 364 YSLDNKAKEMNAFVSQPLTDKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETG 423

Query: 427 NERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKE 486
           N+RD+AKYS+QLRN  KRM+ YEKHHE D +G KKLGALTSKNRKVNM + +N +H KKE
Sbjct: 424 NDRDIAKYSSQLRNLVKRMSAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKE 483

Query: 487 DSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELL 546
           D      D+KSDPFSRLKTRTK+YYQE+QKEENE+A+ +A+QK++++++EA  R+EKELL
Sbjct: 484 DV---NFDAKSDPFSRLKTRTKVYYQEIQKEENERAQDIARQKQLDESEEAIARREKELL 540

Query: 547 LAQFRRLGGLENMISKINVNFDIDL 571
            + F+RLGGLE +I ++ + F  D+
Sbjct: 541 SSDFKRLGGLERVIGQMQLPFTFDV 565

 Score =  135 bits (339), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 115/194 (59%), Gaps = 21/194 (10%)

Query: 1   MSDIXXXXXXXXXXXXXXXXXRVLTSTVSKRSKQSDATASKKRRI-YEGSXXXXXXXXXX 59
           MSDI                  VLT T +KR+K SD  +SK+R+I  EG+          
Sbjct: 1   MSDIEEDLLALAGADEEEDEDEVLT-TSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDE 59

Query: 60  XXXXXXXXXNPHEV----GNYDTGDDEAENEEQNPFPLQGKYKDEKDREYLESLPEVERE 115
                    NP  V    G Y   D+E E EE+NPFPL+GKYKD+ DR +LE LPE+ERE
Sbjct: 60  EDDY-----NPAAVQTESGRYSEEDEEDEEEEENPFPLEGKYKDDNDRAHLEGLPEMERE 114

Query: 116 TVLFDRSQTMRKYQERKLFRERKRQ----------QEAKPTRSSGRTAHSTGHSDLKASK 165
           T+LF+RSQ M+KY +R+LFRER R           +E   TRSS RT H+TGHSDLKASK
Sbjct: 115 TLLFERSQIMQKYHDRRLFRERGRNMKEQQKNRQLREGNKTRSSARTTHATGHSDLKASK 174

Query: 166 LSQLKRQRDKKLNR 179
           LSQL++QR++K +R
Sbjct: 175 LSQLRKQREQKGHR 188

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  483 bits (1242), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 232/334 (69%), Positives = 283/334 (84%), Gaps = 5/334 (1%)

Query: 240 VKWAE--DNDRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTL 297
           VKWAE  D DR + LADFNK++IGRSFVAKFCFYPGFN+LV   YGRVNVG+DK +GQT 
Sbjct: 244 VKWAETEDFDRDTGLADFNKVKIGRSFVAKFCFYPGFNELVQNSYGRVNVGIDKHTGQTA 303

Query: 298 YRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLE 357
           YRMVKIEKVFLQKPYNMGKF+TNQYFGVTQGKDRKVFQMNFFSDG  TQ EYERYL+SLE
Sbjct: 304 YRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGAITQVEYERYLKSLE 363

Query: 358 TANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRS 417
              I++PS + L+NKSKEI  F+++P+T KLTD+IVRNRM+FNKKLSGTNAVLEKTVL+ 
Sbjct: 364 KYGINKPSVYNLNNKSKEISEFVSQPMTSKLTDDIVRNRMVFNKKLSGTNAVLEKTVLKE 423

Query: 418 KLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKT 477
           KLQYA+E++NERD+AKYS+QL+N EKR+++YEKHHEND  G KKLG LTSKNRK+N+ + 
Sbjct: 424 KLQYAKETSNERDIAKYSSQLKNLEKRISSYEKHHENDQAGIKKLGVLTSKNRKLNIDRI 483

Query: 478 KNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEA 537
           K+ +  +K+D      D+KSDPFSRLKTRTKIYY+EVQ++ENEKAK  A+QK++E++K  
Sbjct: 484 KHAELVQKDDV---NFDAKSDPFSRLKTRTKIYYKEVQQQENEKAKEAARQKQLEEDKGT 540

Query: 538 DERKEKELLLAQFRRLGGLENMISKINVNFDIDL 571
             RKE ELLLA+FR LGGLE +I  I++  +++L
Sbjct: 541 ATRKENELLLAKFRSLGGLEEIIGGIDLQINVNL 574

 Score =  107 bits (268), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 58/99 (58%), Positives = 74/99 (74%), Gaps = 11/99 (11%)

Query: 89  NPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR--------- 139
           NPFPL+GKYKDE+DR  LESLPE+ERE++LF+RSQ M++YQER+  ++R +         
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 140 --QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKK 176
             QQE K  RSS RT  +TGHSD+K SKLS+LK+QR KK
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKK 191

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  443 bits (1140), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 210/334 (62%), Positives = 274/334 (82%), Gaps = 4/334 (1%)

Query: 240 VKWAEDN--DRVSELADFNKLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTL 297
           V+WAED+  DR S L D+NK++IGRSFVAKFCFYP FN +V GCYGRVN+G DK +G ++
Sbjct: 251 VEWAEDDNLDRESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSM 310

Query: 298 YRMVKIEKVFLQKPYNMGKFYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLE 357
           YRMVKIE+VFLQKPYNMGKF+TNQYFGVTQGKDRK+FQM++FSD   TQ EYERYL SLE
Sbjct: 311 YRMVKIERVFLQKPYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLE 370

Query: 358 TANISRPSAHILSNKSKEIVSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRS 417
             +I++PS +IL+NKSK +  F+ EPLT KL D+IVRNRM+FNKKLSGTNAV+EK VL+ 
Sbjct: 371 KYDITQPSPYILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKE 430

Query: 418 KLQYARESNNERDVAKYSAQLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKT 477
           KLQ++++S +    +KY+ QL+  EKR+++YEKHHEND    K LGALTSKNRK+N+ + 
Sbjct: 431 KLQFSKQSGDIESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRI 490

Query: 478 KNYDHGKKEDSAGPTVDSKSDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEA 537
           ++ +  K+E+     VD+KSDPFSRLKTRTKIYYQE+Q+EENEKA+  A ++++E ++EA
Sbjct: 491 RHAETIKREEGVN-KVDAKSDPFSRLKTRTKIYYQEIQQEENEKAREEA-KRQLEVDQEA 548

Query: 538 DERKEKELLLAQFRRLGGLENMISKINVNFDIDL 571
           +E+K+KELLLA+FRRLGGLE +I  +++   ID+
Sbjct: 549 EEQKKKELLLAKFRRLGGLEEIIGSLDLKLHIDI 582

 Score =  115 bits (289), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 77/96 (80%), Gaps = 9/96 (9%)

Query: 90  PFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRER----KRQQE--- 142
           PFPL+GKYKDEKDRE LE LPE+ERE++LF+RSQ M+KYQERKL R+     K+QQ+   
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSIKQQQQLQR 148

Query: 143 --AKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKK 176
             +K TR+S R++ +TGHSDLK SKLS+LK+QR KK
Sbjct: 149 EGSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKK 184

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 2/61 (3%)

Query: 379 FITEPLTEKL--TDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKYSA 436
            I++ LTE+    DE+V+ R L  KK++    + E   LR KL Y  E N  R    Y  
Sbjct: 78  LISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPAYIW 137

Query: 437 Q 437
           Q
Sbjct: 138 Q 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,693,770
Number of extensions: 2405584
Number of successful extensions: 16945
Number of sequences better than 10.0: 451
Number of HSP's gapped: 16917
Number of HSP's successfully gapped: 622
Length of query: 571
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 456
Effective length of database: 40,294,809
Effective search space: 18374432904
Effective search space used: 18374432904
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)