Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0I002203.569ON70770737450.0
NCAS0E002503.569ON70870732250.0
KAFR0J028903.569ON70670732030.0
NDAI0I032503.569ON70970932020.0
Smik_7.163.569ON70870631210.0
YGL245W (GUS1)3.569ON70870631170.0
TDEL0D063703.569ON70670631140.0
CAGL0C01947g3.569ON70570631130.0
Suva_7.163.569ON70870631080.0
Skud_7.223.569ON70870630960.0
Kpol_507.83.569ON70770730840.0
Kwal_47.192723.569ON70470430270.0
SAKL0F00748g3.569ON70770730170.0
KLLA0A00682g3.569ON70870830030.0
ZYRO0E09570g3.569ON70670429800.0
TPHA0A060203.569ON70770629740.0
KLTH0G00682g3.569ON70470429490.0
AFR264W3.569ON70770929260.0
TBLA0E001903.569ON70770728970.0
ZYRO0C07018g6.51ON8034846336e-71
SAKL0E02134g6.51ON8013816213e-69
TDEL0G041906.51ON8093856152e-68
KNAG0M011006.51ON7993846091e-67
YOR168W (GLN4)6.51ON8093816047e-67
Skud_15.3326.51ON8093816012e-66
Smik_15.3486.51ON8103815969e-66
KLTH0C10340g6.51ON8003815942e-65
Kwal_56.225596.51ON8003815932e-65
Kpol_1037.386.51ON8083815933e-65
AGR259C6.51ON7983815914e-65
NCAS0F002406.51ON8113845915e-65
KAFR0G026106.51ON7943715897e-65
TPHA0J005506.51ON8083815907e-65
CAGL0L04532g6.51ON7953815871e-64
Suva_8.2236.51ON8213815845e-64
TBLA0G004506.51ON8083815836e-64
NDAI0K028606.51ON8143815811e-63
Ecym_31356.51ON8043845741e-62
KLLA0F20449g6.51ON8043725563e-60
NDAI0A084607.100ON5293451823e-13
KNAG0L006207.100ON5172181806e-13
NCAS0I005607.100ON5272151788e-13
TPHA0L005907.100ON5582661752e-12
Suva_15.1347.100ON5353481724e-12
YOL033W (MSE1)7.100ON5362321724e-12
CAGL0F01133g7.100ON5322221635e-11
Kpol_1044.127.100ON5362321611e-10
Skud_15.1227.100ON5322631592e-10
TDEL0H035007.100ON5342281548e-10
Smik_15.1327.100ON5353401493e-09
TBLA0E021807.100ON5312291493e-09
Ecym_26267.100ON5733501412e-08
KAFR0D013207.100ON5142151404e-08
KLTH0D02794g7.100ON5462261395e-08
AEL338C7.100ON5332351385e-08
ZYRO0D05808g7.100ON5332421332e-07
SAKL0B09548g7.100ON5542441323e-07
KLLA0F07975g7.100ON5422341314e-07
Kwal_26.72027.100ON5672411314e-07
Smik_12.4694.236ON89565743.2
TPHA0C006808.347ON69975715.7
Skud_5.2388.160aON17837688.6
TDEL0B008708.810ON55250708.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0I00220
         (707 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1447   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1246   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1238   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1238   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1206   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1205   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1204   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1203   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1201   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1197   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1192   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1170   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1166   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1161   0.0  
ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1152   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1150   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1140   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1131   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1120   0.0  
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   248   6e-71
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   243   3e-69
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   241   2e-68
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   239   1e-67
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   237   7e-67
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   236   2e-66
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   234   9e-66
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   233   2e-65
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   233   2e-65
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   233   3e-65
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   232   4e-65
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   232   5e-65
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   231   7e-65
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   231   7e-65
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   230   1e-64
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   229   5e-64
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   229   6e-64
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   228   1e-63
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   225   1e-62
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   218   3e-60
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    75   3e-13
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    74   6e-13
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    73   8e-13
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    72   2e-12
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    71   4e-12
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    71   4e-12
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    67   5e-11
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    67   1e-10
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    66   2e-10
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    64   8e-10
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    62   3e-09
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    62   3e-09
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    59   2e-08
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    59   4e-08
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    58   5e-08
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    58   5e-08
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    56   2e-07
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    55   3e-07
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    55   4e-07
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    55   4e-07
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    33   3.2  
TPHA0C00680 Chr3 complement(128269..130368) [2100 bp, 699 aa] {O...    32   5.7  
Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C (...    31   8.6  
TDEL0B00870 Chr2 (165444..167102) [1659 bp, 552 aa] {ON} Anc_8.8...    32   8.7  

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1447 bits (3745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 699/707 (98%), Positives = 699/707 (98%)

Query: 1   MSAATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKI 60
           MSAATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKI
Sbjct: 1   MSAATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKI 60

Query: 61  AAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120
           AAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV
Sbjct: 61  AAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120

Query: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180
           ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA
Sbjct: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180

Query: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240
           GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240

Query: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300
           FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300

Query: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360

Query: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420
           VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH
Sbjct: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHK 540
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHK 540

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD
Sbjct: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV
Sbjct: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK
Sbjct: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1246 bits (3225), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 590/707 (83%), Positives = 641/707 (90%), Gaps = 2/707 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           +ATLVINGKAP+VAY  LIAARI N  K +S++IEFVDDK AAPA FNGD++D   KI A
Sbjct: 2   SATLVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIVA 61

Query: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122
           QF ++F+  +  D+  WVK A++E V+KNF KL+ESL KLDAHLNLRTF+LGGLKYS AD
Sbjct: 62  QFSDVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAAD 121

Query: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182
           IACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F + HEFLTKS+QELKK + AGK
Sbjct: 122 IACWGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAGK 181

Query: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242
           KKE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFD
Sbjct: 182 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFD 241

Query: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302
           DTNPSKEKEEFQDSILEDL LLGIKGDR+T+SSDYFQ+MYD CIQ+IKEG AYCDDTPTE
Sbjct: 242 DTNPSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPTE 301

Query: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362
           KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVI
Sbjct: 302 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVI 361

Query: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422
           YRCNLTPHHRTG TWKVYPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WML AL+LR
Sbjct: 362 YRCNLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNLR 421

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
           KVHIWDFARVNFVRTLLSKRKLQWMVDKGLV NWDDPRFPT        MTVEGLRNFVL
Sbjct: 422 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 481

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V+PVK+H+EG   P+TPK EMKPKHK
Sbjct: 482 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKHK 541

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNPAVGEKKVI+++++VIDK+DA  LE +EEVT+MDWGNVIIT+++ DGSL GKLHLEGD
Sbjct: 542 KNPAVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEGD 601

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKTKHKLTWLADT DVVPVDLVDFDHLI KD+LEE ESFEDFLTP TEF T AIADLNV
Sbjct: 602 FKKTKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLNV 661

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K MKVGDIIQFERKGYYRLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 662 KDMKVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1238 bits (3203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/707 (82%), Positives = 641/707 (90%), Gaps = 4/707 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           +ATLVINGKAP+VAY  LIAAR+ N+A+  ++ IEFVDDK +APA FNG SE   +KI A
Sbjct: 2   SATLVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVA 61

Query: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122
            FP+ F     A  + W+  A++EF+VKNF KLA+SL KLDA+LNLRTF+ GGL+YS AD
Sbjct: 62  AFPDAFRNANVA--SEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAAD 119

Query: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182
           IA WGALRSNGMVGSIIKNKVYVNVSRWY+L EM P F   HEFLTKS+QELKK ++AGK
Sbjct: 120 IAAWGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGK 179

Query: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242
           KKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 239

Query: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302
           DTNPSKEK EFQDSILEDL LLGIKGDRVTYSSDYFQ+MYD+C+QLIKEGGAYCDDTPTE
Sbjct: 240 DTNPSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTE 299

Query: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362
           KMREERMDGIASARRDR+VEENL+IFTEEMKNGTEEGLKNCVRAKIDYAA NKTLRDPVI
Sbjct: 300 KMREERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVI 359

Query: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422
           YRCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLNALHLR
Sbjct: 360 YRCNLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLR 419

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
           KVHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVL
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540
           SQGPSRNVINLEWN+IWAFNKKVIDPVAPRHTAVV+PVK+H+ G  APETPK EMKPKHK
Sbjct: 480 SQGPSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHK 539

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNPAVGEKKVI+Y+++V+DKEDA  +E +EEVTLMDWGN+IITK++ DGS+E K+HLEGD
Sbjct: 540 KNPAVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGD 599

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKT HKLTWLADTEDVVPVDLVDFDHLI+KD+LEE ESFEDFLTP+TEF T AIADLNV
Sbjct: 600 FKKTAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K MKVGD+IQFERKGY+RLDSLPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 660 KEMKVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1238 bits (3202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/709 (82%), Positives = 638/709 (89%), Gaps = 2/709 (0%)

Query: 1   MSAATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKI 60
           MSA TLVINGKAP+VAYG LIAARI N AK +S+ I+FVDDK +AP+VFNG S+    KI
Sbjct: 1   MSANTLVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKI 60

Query: 61  AAQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120
              FPE+F +     VA W K AN+E VVKNF KL+ESL KLDA LNLRTF+LGGLKYS 
Sbjct: 61  IEGFPEIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSA 120

Query: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180
           ADIACWGALRSNGM GSI+KNKV VNVSRWY+L EM P F + HE LTKS+QELKK S +
Sbjct: 121 ADIACWGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNS 180

Query: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240
           GKKKE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIR
Sbjct: 181 GKKKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIR 240

Query: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300
           FDDTNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQQMY++C+++IKEG AYCDDTP
Sbjct: 241 FDDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTP 300

Query: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360
           TEKMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY A NKTLRDP
Sbjct: 301 TEKMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDP 360

Query: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420
           VIYRCNLTPHHRTG TWK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWML+A++
Sbjct: 361 VIYRCNLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMN 420

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLV NWDDPRFPT        MTVEGLRNF
Sbjct: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 480

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPK 538
           VLSQGPSRNVINLEWNLIWAFNKKVIDPVA RHTA+VDPVK+H+EG   P+TPKTEMKPK
Sbjct: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPK 540

Query: 539 HKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLE 598
           HKKNPAVGEKKVI+Y+++VIDK DA  +E +EEVT+MDWGNVIITK++ DGS+ GKLHL+
Sbjct: 541 HKKNPAVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLD 600

Query: 599 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADL 658
           GDFKKTKHKLTWLADTEDVVPVDLVDFDHLI+KD+LEE ESFEDFLTP TEF T AIADL
Sbjct: 601 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADL 660

Query: 659 NVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           NVK MKVGDIIQFERKGYYRLD++ KDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 661 NVKDMKVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1206 bits (3121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/706 (80%), Positives = 627/706 (88%), Gaps = 2/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           +TL INGKAPIVAY  LIAARI N+   +S+AI FVDDK A  A+ +  +EDV SKI  +
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGK 62

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           F  +F   +   +A WV  A  E VVKNFAKL++SL  LD+ LNLRTF+LGGLKYS AD+
Sbjct: 63  FAAIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AH+FL+KS+QELKK++  GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKK 182

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLP+AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGD++TYSSDYFQ+MYD CIQ+IK+G AYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIAS+RRDRSVEENL+IFTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 303 MREERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD+VEGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKK+IDP+APRHTA+V+PVK+H+EG  AP+ PKTE KPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKHKK 542

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEKKVI+Y+++V+DK+DA  +  DEE+TLMDWGNVIITK++ DGS+  KL+LEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEGDF 602

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADT+DVVPVDLVDFDHLI KDRLEE ESFEDFLTPQTEF T AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            MK+GDIIQFERKGYYRLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1205 bits (3117), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 568/706 (80%), Positives = 626/706 (88%), Gaps = 2/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           +TL INGKAPIVAY  LIAARI N+   +S+AI+ VDDK A  A  +  +EDV +KI ++
Sbjct: 3   STLTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKITSK 62

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           F  +F   +   VA WV  A  E V+KNFAKL++SL  LD+ LNLRTF+LGGLKYS AD+
Sbjct: 63  FAAIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AH+FL+KS+ ELKK++  GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVGKK 182

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQ+MYD C+Q+IK+G AYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDG+ASARRDRSVEENL+IFTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 303 MREERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V+PVK+H+EG  AP+ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKHKK 542

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEKKVI+Y+++V+DK+DA  +  DEEVTLMDWGNVIITK++ DGS+  KL+LEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEGDF 602

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADT+DVVPVDLVDFDHLI KDRLEE ESFEDFLTPQTEF T AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            MK+GDIIQFERKGYYRLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 DMKIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1204 bits (3114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 574/706 (81%), Positives = 632/706 (89%), Gaps = 3/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           A L+INGKAP+VAY  LIAAR+ N+    S+ +EFVDDK AAPAV +G+SE V  KI   
Sbjct: 2   AKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIEA 61

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           FP++F +  + ++A WVKTA+ ++V+KNF KL+ SL KLDA LNLRT++LGGLKYS ADI
Sbjct: 62  FPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAADI 121

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGMVGSIIKNKV VNVSRWYTL E    F  AHEFLTKSMQ+LKKAS  GKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGKK 181

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFA+ YKGKLIIRFDD
Sbjct: 182 KEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFDD 241

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSI+EDL LLGI+GDR+T+SSDYFQ+MYD+C+++IKEG AYCDDT TEK
Sbjct: 242 TNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTEK 301

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIASARRDR VEENL+IFT+EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVIY 361

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG T K YPTYDFCVP+VD++EGVTHALRTIEYRDRN QYDWMLNA++LRK
Sbjct: 362 RCNLTPHHRTGTT-KTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLRK 420

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR TAVV+PVKLH++G  AP++PKTEMKPKHKK
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHKK 540

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NP VGEKKVIFY++VVIDK+DA  LE +EEVTLMDWGNVIITK++ DGSLEGKL+L+GDF
Sbjct: 541 NPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGDF 600

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADTEDV PVDLVDFDHLI+KD+LEE ESFEDFLTP+TEF T AIADLNVK
Sbjct: 601 KKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVK 660

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            +KVGDIIQFERKGYYRLD+L KDGKPY+FFTIPDGKSVNRYGAKK
Sbjct: 661 DLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1203 bits (3113), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/706 (82%), Positives = 634/706 (89%), Gaps = 3/706 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKS-SSVAIEFVDDKNAAPAVFNGDSEDVLSKIA 61
           ++TLVINGKAP+VAY  LIAAR+ N +KS +SV +EFVDDK +A A F+G S++ L  I 
Sbjct: 2   SSTLVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAIV 61

Query: 62  AQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVA 121
           A+FPE+    E +    W+K A +E V+KNF KLA+SL KLDA LN RT++ GGLK+  A
Sbjct: 62  AKFPEILGANEES--KPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSA 119

Query: 122 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAG 181
           DIACWGALRSNGMVGSIIKNKVYVNVSRWY L E  P F  +HEFLTKS+QELKKA+ AG
Sbjct: 120 DIACWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAG 179

Query: 182 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 241
           KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 180 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 239

Query: 242 DDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPT 301
           DDTNPSKEK EFQDSILEDL LLGIKGDR+TYSSDYFQ+MY++C++LIKEG AYCDDTPT
Sbjct: 240 DDTNPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPT 299

Query: 302 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPV 361
           EKMREERMDGIASARR+RSVEENLKIFTE+MKNGTEEGLKNCVRAKIDYAA NKTLRDPV
Sbjct: 300 EKMREERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPV 359

Query: 362 IYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHL 421
           IYRCNLTPHHRTG  WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDW L+ L+L
Sbjct: 360 IYRCNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNL 419

Query: 422 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFV 481
           RKVHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFV
Sbjct: 420 RKVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFV 479

Query: 482 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKK 541
           LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V+PVK+HIEGAPE+PKTEMKPKHKK
Sbjct: 480 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHIEGAPESPKTEMKPKHKK 539

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEKKVI+YQNVVIDKEDA S+E +EEVTLMDWGN+IITK++ DGS+E KLHLEGDF
Sbjct: 540 NPAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEGDF 599

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADT+D V VDLVDFDHLI+KD+LEE ESFEDFLTPQTEF T+AIADLNVK
Sbjct: 600 KKTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLNVK 659

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            M VGDIIQFERKGYYRLD+  KDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 660 DMIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1201 bits (3108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 565/706 (80%), Positives = 626/706 (88%), Gaps = 2/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           +TL INGKAP VAY  LIAARI N+   +S+A+EFVDDK A  A  +  +EDV +KI  +
Sbjct: 3   STLTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKITGK 62

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           F  +F   +  +VA WVK A +E VVKNF KL++SL  LD  LNLRTF+LGGLKYS AD+
Sbjct: 63  FAAIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AHEFLTKS+QE+KK +  GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKK 182

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGK+IIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQ+MYD C+Q+IK+G AYCDDTPTEK
Sbjct: 243 TNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEK 302

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIASARRDRSVEENL+IFTEEMKNGTE GLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTAVV+PVK+H+EG  AP+ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKK 542

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEKKVI+Y+++V+DK+DA  ++ DEEVTLMDWGNV+ITK++ DGS+  KLHLEGDF
Sbjct: 543 NPAVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEGDF 602

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADT+D+VPVDLVDFDHL+ KD+LEE ESFEDFLTP+TEF T AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVK 662

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            MKVGDI+QFERKGY+RLD+LPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 DMKVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1197 bits (3096), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/706 (79%), Positives = 625/706 (88%), Gaps = 2/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           +TL +NGKAP VAY  LIAARI N+   +S+AI+FVDDK A  A  +  +E V +KI  +
Sbjct: 3   STLTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKITGK 62

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           F  +F   +   V+ W   A  E VVKNFAKL++SL  LD+ LN+RTF+LGGLKYS AD+
Sbjct: 63  FAAIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADV 122

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGM GSIIKNKV VNVSRWYTL EM P F  AH+FLTKS+QELKK++  GKK
Sbjct: 123 ACWGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKK 182

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD
Sbjct: 183 KETHKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 242

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGD++TYSSDYFQ+M+D C+Q+IK+G AYCDDTPTE+
Sbjct: 243 TNPSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTER 302

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIASARR+RSVEENL++FTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 303 MREERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIY 362

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN+QYDWML AL LRK
Sbjct: 363 RCNLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRK 422

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFAR+NFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 423 VHIWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 482

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDP+APRHTA+V+PVK+H+EG  AP+ PK EMKPKHKK
Sbjct: 483 QGPSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKK 542

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEKK+I+Y+++V+D+EDA  +  DEEVTLMDWGNVIITK++ DGS+  KLHLEGDF
Sbjct: 543 NPAVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDF 602

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHKLTWLADT+DVVPVDLVDFDHLI KDRLEE ESFEDFLTPQTEF T AIADLNVK
Sbjct: 603 KKTKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVK 662

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            MKVGDIIQFERKGYYRLD+LPK+GKPY+FFTIPDGKSVNRYGAKK
Sbjct: 663 DMKVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1192 bits (3084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 570/707 (80%), Positives = 625/707 (88%), Gaps = 3/707 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           +ATLVI GKAP+VAY  LIAARI NS+K  S+ IEFV+DK A+PA  NGDS DVLSKI  
Sbjct: 2   SATLVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIVT 61

Query: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122
              ++F  E AA+   W+K A++E VVKNF +L +SL KLDAHLNLRT++ GGL ++VAD
Sbjct: 62  ANSDVFP-EGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVAD 120

Query: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182
           IACWGALRSNGMVGSIIKNKV VNVSRWYTL E    F   HEFLTKS+QELKKASTAGK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGK 180

Query: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242
           KKE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302
           DTNPSKE  EFQDSILEDL LLGIKGDR+T+SSDYFQ+MYD C+QLIK+G AYCDDTPTE
Sbjct: 241 DTNPSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTE 300

Query: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362
           KMR+ERM+GIAS RRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDY A NKTLRDPVI
Sbjct: 301 KMRDERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVI 360

Query: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422
           +RCNLTPHHRTG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLNAL LR
Sbjct: 361 FRCNLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLR 420

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
           KVHIWDFARVNFVRTLLSKRKLQWMVDK LV NW+DPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540
           SQGPSRNVINLEWNLIW+FNKKVIDPV PR TAVVDPVK+H+EG  AP++ K EMKPKH 
Sbjct: 481 SQGPSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHP 540

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNP VGEKKV+FY+++VID+EDA S+E  EE+TLM+WGN IITK++ DGSL  KLHLEGD
Sbjct: 541 KNPVVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGD 600

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKTKHK+TWLADTEDVV VDLVDFDHLI+KD+LEE ESFEDFLTP+TEF T AIADLNV
Sbjct: 601 FKKTKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 660

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K MKVGDIIQFERKGYYRLDSL  DGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 661 KDMKVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1170 bits (3027), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 555/704 (78%), Positives = 614/704 (87%), Gaps = 1/704 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           A L +  KAP+VAY  LIAAR+ N+ K  ++ I+FV+DK A+PA F G+S DVL  I   
Sbjct: 2   AKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVES 61

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           FPE F +        W + A++E VVKNF KL+ SL KLDA LNLRTF+LGG  YS ADI
Sbjct: 62  FPEAF-KGGFDGCEKWSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSPADI 120

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWG+LRSNGMVGSIIKN+VYVNVSRWYTL E  P+F +AHEFLTK++QELKKAST  KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTGNKK 180

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGDRVTYSSDYFQ+MY++C+++I+EG AYCDDT TE+
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTATER 300

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIASARRDRSVEENL+IFT EMKNGTEEGLKNCVRAKIDY APNKTLRDPVIY
Sbjct: 301 MREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDPVIY 360

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QYDWMLNALHLRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALHLRK 420

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNP 543
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV+PVK HI+GAP+TP  +MK KHKKNP
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHIDGAPQTPDVQMKLKHKKNP 540

Query: 544 AVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDFKK 603
           AVGEKKVI+Y +V+ID++DA  +E  EE+TLMDWGNVI+TK++ DGSL GKLHLEGDFKK
Sbjct: 541 AVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLEGDFKK 600

Query: 604 TKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVKHM 663
           TK K+TWLADT D V VDLVDFDHLI+KD+LEEGE F DFLTP+TEF   AIADLNVK M
Sbjct: 601 TKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADLNVKDM 660

Query: 664 KVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K GDIIQFERKGYYRLD++    KPY+FF+IPDGKSVN+YGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1166 bits (3017), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 563/707 (79%), Positives = 625/707 (88%), Gaps = 3/707 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           +A LVINGKAP+VAY  LIAARI N++K+ ++ IEFVDDK AAPA FNG+++   SKI  
Sbjct: 2   SANLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIIN 61

Query: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122
            + ++F+ E     + W K A++EF++KNF KL+ SLAKLD+ LNLRT++L     + AD
Sbjct: 62  AYQDVFS-EGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPAD 120

Query: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182
           IACWGALRSNGMVGSIIKNKVYVNVSRWYT+ E+ P FS AHEFLTKS+QELKKAS + K
Sbjct: 121 IACWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNK 180

Query: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242
           KKE+HKANFEI LPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD
Sbjct: 181 KKETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 240

Query: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302
           DTNPSKEK EFQDSILEDL LLGIKGD++TYSSDYF++MY +C+QLIKEG AYCDDTPTE
Sbjct: 241 DTNPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTE 300

Query: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362
           KMREERMDGIASARRDRSVEENL+IF EEMKNGTEEGLKNCVRAKIDY A NK LRDPVI
Sbjct: 301 KMREERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVI 360

Query: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422
           +RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WML+ALHLR
Sbjct: 361 FRCNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLR 420

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
           KVHIWDFARVNFVRTLLSKRKLQWMVDKG V NWDDPRFPT        MTVEGLRNFVL
Sbjct: 421 KVHIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 480

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVV PVKLH+EG   P+ PK EMK KHK
Sbjct: 481 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHK 540

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNP VGEKKVI+Y++V+ID+EDA  +   EE+TLMDWGNVIITK++ DGSL GKLHLEGD
Sbjct: 541 KNPDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGD 600

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKTK KLTWLADTED V VDLVDFDHLI+KD+LEEG++FEDFLTP+TEF T AIADLNV
Sbjct: 601 FKKTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNV 660

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K MKVGD+IQFERKGYYRLDSL KDGKPY+FFTIPDGK+VN+YGAKK
Sbjct: 661 KDMKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1161 bits (3003), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/708 (77%), Positives = 620/708 (87%), Gaps = 4/708 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKS-SSVAIEFVDDKNAAPAVFNGDSEDVLSKIA 61
           +A+L+I  KAP++AY  LIAAR  N++K  +++ I FV+DK AA A FNG++EDVL+K++
Sbjct: 2   SASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKLS 61

Query: 62  AQFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVA 121
           A +P++   + +   A W++    + V+KNF +LAESLAKL+AHLNLRT++L  L+ S+A
Sbjct: 62  AAYPDIL-NDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLA 120

Query: 122 DIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAG 181
           DIA WG LRSNGMVGSIIKNKVY+NVSRWY+ FE+ P+F  AHEFLTKS+QELKKAS   
Sbjct: 121 DIAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVN 180

Query: 182 KKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 241
           KKKE+HKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF
Sbjct: 181 KKKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRF 240

Query: 242 DDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPT 301
           DDTNPSKEKEEFQDSILEDL LLGIKGDR+TYSSDYFQ+MYD C+Q+IKEG AYCDDTPT
Sbjct: 241 DDTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPT 300

Query: 302 EKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPV 361
           E+MREER +GI S+RR+R+VEENLKIFTEEMKNGTEEGLKNCVRAKIDY A NK +RDPV
Sbjct: 301 ERMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPV 360

Query: 362 IYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHL 421
           IYRCNLTPHHRTG  WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWMLNALHL
Sbjct: 361 IYRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHL 420

Query: 422 RKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFV 481
           RKVHIWDFARVNFVRTLLSKRKLQW+VDK +V NWDDPRFPT        MT+EGLRNFV
Sbjct: 421 RKVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFV 480

Query: 482 LSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKH 539
           LSQGPSRNVINLEWNLIW+FNKKVIDPVAPRHTA+V PVK+H+EG   P+TP  EMK KH
Sbjct: 481 LSQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKH 540

Query: 540 KKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEG 599
           KKNPA+GEKKVI+Y+++VID+EDA  L   EEVTLMDWGN IITK++ DGS   KLHLEG
Sbjct: 541 KKNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEG 600

Query: 600 DFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLN 659
           DFK TK KLTWLADT+D V  DLVDFDHLI+KD+LEEGE+FEDFLTP+TEF T A ADLN
Sbjct: 601 DFKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLN 660

Query: 660 VKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           VK MKVGDIIQFERKGY+RLDSLPKDGKPY+FFTIPDGKSVN+YGAKK
Sbjct: 661 VKDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1152 bits (2980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/704 (76%), Positives = 611/704 (86%), Gaps = 3/704 (0%)

Query: 6   LVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQFP 65
           LVINGKAP+VAY  LIA+RI N+A   ++ +EFVD+KNAAP VFNG S+D  +KI + +P
Sbjct: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63

Query: 66  ELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADIAC 125
           ++F  E + +VA W+K A ++ VVKNF +L++SL +LDA LNLRTF+LGGLK S ADI C
Sbjct: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123

Query: 126 WGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKKKE 185
           WGALRSNGMVGSIIKNKVYVNVSRWYTL E+ P F  AHE+LTKSMQ +KKA TAGKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183

Query: 186 SHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 245
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243

Query: 246 PSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMR 305
           PSKE+ EFQD+ILEDL L+GIKGD++TYSSDYFQ+MYD+C+QLIKEG AYCDDT  EKMR
Sbjct: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303

Query: 306 EERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRC 365
           EERM+GI SA+RD SVEENL+IFTEEMKNGTE G KNCVRAKIDY A NKTLRDPVIYRC
Sbjct: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363

Query: 366 NLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVH 425
           NLTPHHRT   WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWML AL LRKVH
Sbjct: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423

Query: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQG 485
           IWDFARVNF+RTLLSKRKLQWMVD GLV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVISQG 483

Query: 486 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHI--EGAPETPKTEMKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDPVAPRHTAVVDPV++ +  EGAPETPK E+KPKHKKNP
Sbjct: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543

Query: 544 AVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDFKK 603
           AVGEKKVI+   ++IDKEDA+ LE  EE+TLMDWGN+IIT ++ DGSL  K +L GDFKK
Sbjct: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603

Query: 604 TKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVKHM 663
           TKHK+TWLA+T D VPV++VDFDHLI KD+LEE E+F DF+TPQTEF TKA+ D+NVK M
Sbjct: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662

Query: 664 KVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           KVGDIIQFERKGY RLDS  +  KPYIFFTIPDGKSVNRYGAKK
Sbjct: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1150 bits (2974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 557/706 (78%), Positives = 619/706 (87%), Gaps = 3/706 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           ATL+I GK+ +VAY  LIAARI NS K  S+ IEFV+DK AA A  NG+++DVLSKI + 
Sbjct: 3   ATLIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIVSA 62

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
             ++F  E       WVK A  E V+KNF KLA SL KLDAHLNLRTF+ GGL YS+ADI
Sbjct: 63  NADVFP-EGVTGSEEWVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIADI 121

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWGALRSNGMVGSIIKNKV VNVSRWYTLFE  P F  A+EFLTKS+QELKKAS+AGKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGKK 181

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFA AYKGKLIIRFDD
Sbjct: 182 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFDD 241

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEK EFQ+SILEDL+LLGIKGDR+T+SSDYFQ+MYD CIQLIKEG AYCDDTP +K
Sbjct: 242 TNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVDK 301

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDGIASARR+RSVEENLKIFTEEM+NGTEEGL+NCVRAKIDY A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVIY 361

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNL PHHRTG  WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QY+WMLNA++LRK
Sbjct: 362 RCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLRK 421

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MT+EGLRNFV+S
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVIS 481

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG--APETPKTEMKPKHKK 541
           QGPSRNVINLEWNLIWAFNKKVIDPVAPR T V++P+K+H+ G  APETP+ EMKPKH K
Sbjct: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHPK 541

Query: 542 NPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDF 601
           NPAVGEK+VIF +++VIDK+DA  +E  EE+TLM+WGN II K++ DGS++  LHLEGDF
Sbjct: 542 NPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGDF 601

Query: 602 KKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVK 661
           KKTKHK+TWLA+TEDV  VDLVDFDHLI KD+LEE ESFE+FLTP TEF T AIAD+NVK
Sbjct: 602 KKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNVK 661

Query: 662 HMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
            MKVGDIIQFERKGYYRLD+LPKDGKPYIFFTIPDGK+VN+YGAKK
Sbjct: 662 DMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1140 bits (2949), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 546/704 (77%), Positives = 612/704 (86%), Gaps = 1/704 (0%)

Query: 4   ATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQ 63
           A L+I  KAP+VAY  LIAAR+ NSAK+ ++ IEFV+DK ++PA F    +DVL +I   
Sbjct: 2   AKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQT 61

Query: 64  FPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADI 123
           +PE+F +    +   W K A++E  VKNF KL+ SLAKLDA LN RTF+LGG  +S ADI
Sbjct: 62  YPEVF-KHGFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAADI 120

Query: 124 ACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKK 183
           ACWG+LRSNGMVGSIIKNKVYVNVSRWYTL E  P+F +AHEFL K++QELKKAST+ KK
Sbjct: 121 ACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNKK 180

Query: 184 KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDD 243
           KE+HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQ YKGKLIIRFDD
Sbjct: 181 KETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFDD 240

Query: 244 TNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEK 303
           TNPSKEKEEFQDSILEDL LLGIKGDRVTYSSDYFQ+MYD+C+++I+EG AYCDDTPT+K
Sbjct: 241 TNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTDK 300

Query: 304 MREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIY 363
           MREERMDG+ASARRDRSVEENL+IFT+EMKNGTEEGLKNCVRAKIDY A NKTLRDPVIY
Sbjct: 301 MREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIY 360

Query: 364 RCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRK 423
           RCNLTPHHRTG TWK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY WML+ALHLRK
Sbjct: 361 RCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLRK 420

Query: 424 VHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLS 483
           VHIWDFARVNFVRTLLSKRKLQWMVDK LV NWDDPRFPT        MTVEGLRNFVLS
Sbjct: 421 VHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLS 480

Query: 484 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNP 543
           QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTA+V PVK H+EGAP+TP  ++K KHKKNP
Sbjct: 481 QGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHVEGAPQTPDVQIKLKHKKNP 540

Query: 544 AVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDFKK 603
           AVGEKKVI+Y +++ID++DA ++   EE+TLMDWGN I+TK++ DGSL GKLHLEGDFKK
Sbjct: 541 AVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGDFKK 600

Query: 604 TKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVKHM 663
           TK KLTWLADT+D V VDLVDFDHLI KD+LEEGE F D+LTPQTEF   A+ADLNVK M
Sbjct: 601 TKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNVKDM 660

Query: 664 KVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K GDIIQFERKGYYRLDS     KPY+FF IPDGKSVN+YGAKK
Sbjct: 661 KKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1131 bits (2926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 538/709 (75%), Positives = 607/709 (85%), Gaps = 7/709 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           ++TL+I  K+P VAY  LIAAR  N AK  +VAI+F + K AA A F+G+S++ L ++  
Sbjct: 2   SSTLIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVE 61

Query: 63  QFPELFAQ--EEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSV 120
           ++P++     EEAA    W+  A  + VVK+F KL+ SL KLDAHLNLRTFVLGG++ +V
Sbjct: 62  KYPDVLGSVPEEAA---WWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTV 118

Query: 121 ADIACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTA 180
           AD+A WGALRSNG VGSIIKNKVYVNVSRWYT  E+ P F  AHEFL KS++ELK A   
Sbjct: 119 ADVAVWGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNV 178

Query: 181 GKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 240
            KKKE+HKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR
Sbjct: 179 NKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIR 238

Query: 241 FDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTP 300
           FDDTNPSKE+ EFQDSILEDL LLGIKGDR+T+SSDYFQ+MYD C+Q+IKEG AYCDDTP
Sbjct: 239 FDDTNPSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTP 298

Query: 301 TEKMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDP 360
           TE+MREERM+GIASARR+RSVEENLKIFTEEMKNGTEEGLKNCVRAK DYAA NKTL+DP
Sbjct: 299 TERMREERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDP 358

Query: 361 VIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420
           V+YRCNLTPHHRTG  WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRN QY+WMLNAL 
Sbjct: 359 VLYRCNLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALK 418

Query: 421 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNF 480
           LRKVHIWDFARVNFVRTLLSKRKLQW+VDK +V NWDDPRFPT        MT+EGLRNF
Sbjct: 419 LRKVHIWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNF 478

Query: 481 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGA--PETPKTEMKPK 538
           VLSQGPSRNVINLEWNLIWAFNKKVIDP+APRHT V +PVKLH+ GA  P+TP TEMKPK
Sbjct: 479 VLSQGPSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPK 538

Query: 539 HKKNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLE 598
           HKKNPAVGEKKVI+Y++V+I  EDAA L   EEVTLMDWGN II  ++ DGSL   L+LE
Sbjct: 539 HKKNPAVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLE 598

Query: 599 GDFKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADL 658
           GDFKKTK KLTWLADT D VPVDLVDFDHLI+KDRLEE ++FEDFLTP+TEF T AIADL
Sbjct: 599 GDFKKTKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADL 658

Query: 659 NVKHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           NVK MKVGD+IQFER GYYRLD++    KP++FFTIPDGK+VN+YGAKK
Sbjct: 659 NVKDMKVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/707 (78%), Positives = 617/707 (87%), Gaps = 3/707 (0%)

Query: 3   AATLVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAA 62
           +  L+++GKA  VAYG LIAARI N++ +++V I FV+DK AAPA  +G S+DVL+KI A
Sbjct: 2   STKLILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIVA 61

Query: 63  QFPELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVAD 122
             P  FA     DVA W K A ++ VVKNF +LA++L  LDA LNLR+FVLGGL +S AD
Sbjct: 62  LSPSSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAAD 121

Query: 123 IACWGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGK 182
           +A WGALRSNGMVGSIIKNKVYVNVSRWY+  E+ P F  +HEFLTKS+QELKKA+ AGK
Sbjct: 122 VAVWGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAGK 181

Query: 183 KKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 242
           KKESHKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAA+LNQYFAQAYKGKLIIRFD
Sbjct: 182 KKESHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFD 241

Query: 243 DTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTE 302
           DTNPSKEKEEF++SI+EDL+LLGIKGDRVT+SSDYFQ+MYD CIQ+IKEG AYCDDTPTE
Sbjct: 242 DTNPSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPTE 301

Query: 303 KMREERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVI 362
           KMREERM+G  SARR+RSVEENLKIFTE+M NGTEEGLKNCVRAKIDY A NKTLRDPVI
Sbjct: 302 KMREERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPVI 361

Query: 363 YRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLR 422
           YRCNLTPHH TGD WKVYPTYDFCVPIVDS+EGVTHALRTIEYRDRN QY+WML+AL LR
Sbjct: 362 YRCNLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKLR 421

Query: 423 KVHIWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVL 482
            VHIWDFARVNFVRTLLSKRKLQWMVDKGLV NWDDPRFPT        M++EGLRNFVL
Sbjct: 422 HVHIWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFVL 481

Query: 483 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGA--PETPKTEMKPKHK 540
           SQGPSRNVINLEWNLIWAFNKKVIDP APRHTAVV+P K+H+EG+  P+T K EMKPKHK
Sbjct: 482 SQGPSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKHK 541

Query: 541 KNPAVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGD 600
           KNP VGEKKV+F +N++IDKEDA  LE  EE TLMDWGN IITK+  + S+  KLHLEGD
Sbjct: 542 KNPDVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEGD 600

Query: 601 FKKTKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNV 660
           FKKTKHK+TWLADT+DVV VDLVDFDHL+NKDR+EEGESFEDFLT +TEF T AIADLNV
Sbjct: 601 FKKTKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLNV 660

Query: 661 KHMKVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707
           K MK+GD IQFERKGYYRLDSLPK+G PY+FFTIPDGK+VN+YGAKK
Sbjct: 661 KDMKIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  248 bits (633), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 160/484 (33%), Positives = 257/484 (53%), Gaps = 45/484 (9%)

Query: 175 KKASTAGKKKESHKANFEIDL----------PD-------AKIGEVVTRFPPEPSGYLHI 217
           KK +TAG K+      F  DL          P+       A  G V TRFPPEP+GYLHI
Sbjct: 206 KKDATAGPKRTMFSEGFLGDLHTVEDNPQNNPEHLVNHLKATHGLVHTRFPPEPNGYLHI 265

Query: 218 GHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSLLGIKGDRVTYSSDY 277
           GH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI+  ++ LG    ++TYSSDY
Sbjct: 266 GHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESIIRMVNWLGFHPWKITYSSDY 325

Query: 278 FQQMYDMCIQLIKEGGAYCDDTPTEKMREERM---DGI------ASARRDRSVEENLKIF 328
           F Q+Y++  +LI +G  Y  +   E+++  R    DG       A   R RSVEENL  F
Sbjct: 326 FDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPGGERHACKHRSRSVEENLTEF 385

Query: 329 TEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHHRTGDTWKVYPTYDFCVP 388
             +MK+G  +  +  +R K D ++P+  + D + YR    PH RTG+ W++YPTYDF   
Sbjct: 386 -RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGNKWRIYPTYDFTHC 444

Query: 389 IVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWMV 448
           +VDS E +TH+L T E+      Y+W+ + + + +    ++ R+N   T+LSKRK+  +V
Sbjct: 445 LVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQREYGRLNITGTVLSKRKIAKLV 504

Query: 449 DKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVIDP 508
           D+  V  WDDPR  T        +    + +F+ + G + +V N++     +  +K ++ 
Sbjct: 505 DEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSVTNIQLVRFESAIRKYLED 564

Query: 509 VAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKVIFYQNVVIDKEDAASLE 567
             PR   ++DPV++ ++  P++ +  +  P     P  GE++V F + V ID+ D +   
Sbjct: 565 TTPRLMFILDPVEVVVDNVPDSFEDVVSIPFRPGTPEFGEREVPFTKRVFIDRSDFSENA 624

Query: 568 TDEE---------VTLMDWGNVIITK---RHPDGSLEGKLHL----EGDFKKTKHKLTWL 611
           +D+E         V L+   + +I K   +  DG +  K+H+    EG  KK K  + W+
Sbjct: 625 SDKEFFRLTPEQPVGLIKVPHALIYKSLEKDSDGKIT-KIHVHYDTEGKIKKPKTYIQWV 683

Query: 612 ADTE 615
             +E
Sbjct: 684 PLSE 687

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  243 bits (621), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 217/381 (56%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 246 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESIKRM 305

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDG------ 311
           +S LG +  ++TYSSDYF ++YD+   LIK G AY      E+++  R    DG      
Sbjct: 306 VSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 365

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
           +A   RDR +EENL+ F  +M++G  +  +  +R K D ++P+  + D + YR    PH 
Sbjct: 366 VACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 424

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 425 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 484

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++G+V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 485 LNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 544

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++    R   V+DPV++ ++  PE  +  +  P     P  G++ V
Sbjct: 545 NIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTIPYRPGTPEFGDRTV 604

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F +   I++ D +    D+E
Sbjct: 605 PFTKKFFIERSDFSEAADDKE 625

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  241 bits (615), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 138/385 (35%), Positives = 217/385 (56%), Gaps = 11/385 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G+  +RFDDTNP  E  E+ +SI   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDG------ 311
           +S LG K  ++TYSSDYF ++Y++   LIK G  Y     +E+++  R    DG      
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RDRS+EE L  F  +M+NG  +  +  +R K D ++P+  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DPV++ ++  PE  +  +K P    +P  GE++V
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRPGSPEFGEREV 610

Query: 551 IFYQNVVIDKEDAASLETDEEVTLM 575
            F +   I++ D +    D+E   M
Sbjct: 611 PFTKRFFIERSDFSENSDDKEFFRM 635

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  239 bits (609), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/384 (34%), Positives = 215/384 (55%), Gaps = 11/384 (2%)

Query: 198 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 258 LEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDG--- 311
              +S LG +  ++TYSSDYF ++Y++   LIK G  Y      E++R  R    DG   
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 312 ---IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLT 368
                   R+ S+E+NL+ F E MK G  +  +  +R K D+++P+  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 369 PHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWD 428
           PH RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V++ +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 489 NVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNPA-VGE 547
           +V N++     +  +K ++   PR   V+DP+++ ++  PE  +  ++  +K   A  G 
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVDNLPEDHEELVEVPYKAGSAEFGS 604

Query: 548 KKVIFYQNVVIDKEDAASLETDEE 571
           + + F     ID+ D +    D+E
Sbjct: 605 RTLPFTNRFYIDRSDFSETVDDKE 628

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  237 bits (604), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 213/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +S LG K  ++TYSSDYF ++Y +   LIK G AY   C     ++ R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RD+S+E+NL+ F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  W++YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG-APETPKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DPV++ ++  + +  +    P     P  GE+ V
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNLSDDYEELATIPYRPGTPEFGERTV 608

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 609 PFTNKFYIERSDFSENVDDKE 629

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  236 bits (601), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 211/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDG------ 311
           +S LG K  ++TYSSDYF ++Y +   LI  G  Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RD+S+E NLK F  +M++G  +  +  +R K D ++P+  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPET-PKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DP+++ ++  P+   +  + P        GE+ V
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVVDNLPDDYEELAIIPFRPGTSEFGERTV 608

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 609 PFTNKFYIERSDFSENVDDKE 629

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  234 bits (596), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 211/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDG------ 311
           +S LG    ++TYSSDYF ++Y +   LIK G  Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RD+S+E NL+ F  +M++G  +  +  +R K D ++P+  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG-APETPKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DPV++ ++  + +  +    P     P  GE+ V
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRPGTPEFGERTV 609

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 610 PFTNRFYIERSDFSENVDDKE 630

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  233 bits (594), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 211/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDGI----- 312
           +S LG K  ++TYSSDYF ++Y++  +LI  G AY      E+++  R    DG      
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   R RSVEENL  F  +M++G  +  +  +R K D  +P+  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DPV++ ++  PE  +  +  P     P  GE++V
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTVPYRPGTPEFGERQV 603

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 604 PFTGKFYIERSDFSEATDDKE 624

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  233 bits (593), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 211/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKNM 304

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           ++ LG K  ++TYSSDYF ++Y++   LI    AY   C     ++ R  + DG      
Sbjct: 305 VAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPGGER 364

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   R RSVEENL  F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 365 RACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNAPHP 423

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   ++DPV++ ++  P+  +  +K P     P  GE+ V
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRPGTPEFGERSV 603

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F +   I++ D +    ++E
Sbjct: 604 PFTKKFYIERSDFSEATGNKE 624

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  233 bits (593), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 207/381 (54%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +S LG K  ++TYSSDYF ++Y++   LI+    Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RDR VEE+LK F   M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPET-PKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DP+++ ++  PE   +    P     P  GE+ V
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYEEIASIPYRPGTPEFGERNV 609

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F +   I++ D +    D E
Sbjct: 610 PFTKKFYIERSDFSENTDDSE 630

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  232 bits (591), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 131/381 (34%), Positives = 210/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 245 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESIERM 304

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDG------ 311
           ++ LG    ++TYSSDYF Q+Y++   LIK G  Y      E++R  R    DG      
Sbjct: 305 VAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPGGER 364

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
           +  A R+R +EENL  F   M++G     +  +R K D ++P+  + D V YR    PH 
Sbjct: 365 LPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNAPHP 423

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  W++YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 424 RTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V +  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++    R   V+DP+++ ++  PE  +  +  P     P  GE+ V
Sbjct: 544 NIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSIPYRPGTPEFGERTV 603

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F +   I++ D +   +D+E
Sbjct: 604 PFSKRFYIERSDFSEDTSDKE 624

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  232 bits (591), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/384 (34%), Positives = 208/384 (54%), Gaps = 11/384 (2%)

Query: 198 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A+   G  I+RFDDTNP  E  E+ +SI
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 258 LEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI-- 312
              +S LG    ++TYSSDYF ++YD+   LI     Y   C     ++ R  + DG   
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 313 ----ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLT 368
               A   R  S+E NLK F   M++G  +  +  +R K D  +P+  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 369 PHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWD 428
           PH RTG  WK+YPTYDF   +VDS E +TH+L T E+R     Y+W+ + +H+ +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 489 NVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGE 547
           +  N++        +K ++   PR   ++DP+++ ++  PE  +  +  P     P  G+
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVVDNLPEDYEEILSIPYRAGTPEFGD 609

Query: 548 KKVIFYQNVVIDKEDAASLETDEE 571
           + V F +   I++ D + +  D+E
Sbjct: 610 RTVPFTKRFYIERSDFSEVSDDKE 633

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  231 bits (589), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 131/371 (35%), Positives = 207/371 (55%), Gaps = 12/371 (3%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + GK  +RFDDTNP  E  E+ +SI   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +S LG K  ++TYSSDYF ++YD+   LIK    Y   C     ++ R  + DG      
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A A R R +EE+L  F  +MK+G  E  K  +R K D  +PN  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD W++YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNPAVGEKKVI 551
           N++        +K ++   PR   ++DP+++ ++   E  +  +   + K    G++ V 
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNLAEDYEEIVSIPYSK--KFGDRTVP 603

Query: 552 FYQNVVIDKED 562
           F + + I+++D
Sbjct: 604 FTKRIYIERKD 614

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  231 bits (590), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 129/381 (33%), Positives = 210/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESIQRM 310

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +S LG K  +VTYSSDYF ++Y++   LIK    Y   C     ++ R  + DG      
Sbjct: 311 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RDR +EE+L+ F   M+ G  +  +  +R K D  +P+  + D + YR   +PH 
Sbjct: 371 SACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNSPHP 429

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD WK+YPTYDF   +VDS E ++H+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKNPA-VGEKKV 550
           N++     +  +K ++   PR   ++DP+++ +E   E  +  +   ++   A  G+++V
Sbjct: 550 NIQVARFESAIRKFLEDTTPRLMFILDPIEVIVENLSENYEELVTIPYRAGSAEFGDRQV 609

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +   +D+E
Sbjct: 610 PFTNRFYIERSDFSEDSSDKE 630

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  230 bits (587), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 210/381 (55%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 241 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 300

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREER---MDGI----- 312
           +S LG K  +VTYSSDYF ++Y++   LIK G  Y      E+++  R    DG      
Sbjct: 301 VSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGER 360

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RD+SVE+NL+ F   M++G  +  +  +R K +  +P+  + D + YR    PH 
Sbjct: 361 HACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNAPHP 419

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 420 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 479

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 480 LNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 539

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   ++DP+++ +E  PE  +  +  P        G++ V
Sbjct: 540 NIQVVRFESAIRKYLEDSTPRLMMILDPIEVVVENLPEDYEELVTIPYRAGTKEFGDRNV 599

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 600 PFTNKFYIERADFSENTEDKE 620

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  229 bits (584), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 130/381 (34%), Positives = 209/381 (54%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP KE  E+ +SI   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDG------ 311
           +S LG +  ++TYSSDYF ++Y +   LI     Y   C     ++ R  + DG      
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RD+ +E NL+ F   M++G  +  +  +R K D ++P+  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG-APETPKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   V+DP+++ ++  A +  +    P     PA GE+ V
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNLADDFEELATIPYRPGTPAFGERTV 608

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +    D+E
Sbjct: 609 PFTNKFYIERSDFSENVDDKE 629

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  229 bits (583), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/381 (33%), Positives = 207/381 (54%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMREERM---------DG 311
           +S LG K  ++TYSSDYF ++Y++   LI     Y      E+++  R          D 
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 312 IASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   R+R +EENLK F   M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEG-APETPKTEMKPKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   ++DP+++ ++  A +  +    P     P  GE+ V
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSIPYRPATPEFGERNV 609

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D +   +++E
Sbjct: 610 PFTNKFYIERSDFSEDSSNKE 630

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  228 bits (581), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 128/381 (33%), Positives = 206/381 (54%), Gaps = 11/381 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +  LG    ++TYSSDYF ++YD+   LI  G  Y   C     ++ R  + DG      
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   RDR +EENL+ F   M++G  +  +  +R K D  +P+  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +VD+  V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGEKKV 550
           N++     +  +K ++   PR   ++DP+++ ++   +  +  +  P     P  GE+ V
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTIPYRAGTPEFGERTV 613

Query: 551 IFYQNVVIDKEDAASLETDEE 571
            F     I++ D + +  D+E
Sbjct: 614 PFTNKFFIERSDFSEVTDDKE 634

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  225 bits (574), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 128/384 (33%), Positives = 208/384 (54%), Gaps = 11/384 (2%)

Query: 198 AKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSI 257
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A+ + G   +RFDDTNP  E  E+ +SI
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 258 LEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI-- 312
              ++ LG K  ++TYSSDYF Q+YD+   LI+    Y   C     ++ R  + DG   
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 313 ----ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLT 368
               + + R+RS+ ENL  F  +M++G  +  +  +R K D  +P+  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 369 PHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWD 428
           PH RTG  WK+YPTYDF   +VDS E +TH+L T E+      Y+W+ + +H+ +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 429 FARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSR 488
           + R+N   T+LSKRK+  +V++  V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 489 NVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMK-PKHKKNPAVGE 547
              N++     +  +K ++    R   ++DP+++ +   PE  +  +  P     P  G+
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVVNNLPEDYQELVTIPYRPGTPEFGD 606

Query: 548 KKVIFYQNVVIDKEDAASLETDEE 571
           + V F +   I++ D +    D+E
Sbjct: 607 RTVPFTKRFYIERTDFSENTADKE 630

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  218 bits (556), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 130/372 (34%), Positives = 206/372 (55%), Gaps = 11/372 (2%)

Query: 201 GEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILED 260
           G+V TRFPPEP+GYLHIGH+KA ++N  FA+ + G   +RFDDTNP  E  E+ +SI   
Sbjct: 249 GKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESIKSM 308

Query: 261 LSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERMDGI----- 312
           +S LG K  + TYSSDYF ++Y +   LIK G AY   C     ++ R  + DG      
Sbjct: 309 VSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPGGER 368

Query: 313 -ASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHH 371
            A   R+R +EE+L  F  +M++G  +  +  +R K D  +P+  + D + YR    PH 
Sbjct: 369 KACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDAPHP 427

Query: 372 RTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFAR 431
           RTGD WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+ + +H+ +    ++ R
Sbjct: 428 RTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 487

Query: 432 VNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVI 491
           +N   T+LSKRK+  +V  G V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 488 LNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 547

Query: 492 NLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHIEGAPETPKTEMKPKHKKN-PAVGEKKV 550
           N++     +  +K ++   PR   ++DPV++ ++   E         ++ N P  G++ V
Sbjct: 548 NIQVVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVDEDFVELCNIPYRPNTPEFGDRTV 607

Query: 551 IFYQNVVIDKED 562
            F +   I++ D
Sbjct: 608 PFTKRFYIERSD 619

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 74.7 bits (182), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 83/345 (24%), Positives = 141/345 (40%), Gaps = 54/345 (15%)

Query: 204 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSL 263
           +TRF P P+G LH+G  + AL N   A++  GK I+R +DT+ S+   E   +I E L  
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 264 LGIKGDRVTYSSDYFQQMYDMCIQLIKEGGA----YCDDTPTEKMREERMDGIASARRDR 319
            GI  D           +Y   I+++ + GA    +C     E++R +  +   S   DR
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 320 SVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHHRTGDTW-- 377
           +      + TE +++     L   +R K     P  T  D +  + ++  + +    W  
Sbjct: 163 NCYH---LDTEIVESNLTANLPYTIRLKSPDRYPPFT--DLLHGQVDIQLNQKERGVWFD 217

Query: 378 -------KVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIWDFA 430
                    YPTY F   + D + G+TH +R  E+     ++      + L ++  WD  
Sbjct: 218 DPILIKSDGYPTYHFANVVDDHLMGITHVIRGEEWLPSTPKH------VALYQLFGWDMP 271

Query: 431 RVNFVRTL-------LSKRKLQWMV----DKGLVE----------NWDDPRFPTXXXXXX 469
           +   +  L       LSKRK  + V    +KG++            W  PR         
Sbjct: 272 KFIHIPLLTSIDDKKLSKRKGDFSVLSLKEKGVLPEALVNFCALLGWSPPRDIAKANHEC 331

Query: 470 XXMT-VEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDP 508
             M  +E L N       ++  + +++  +W FNK     K+ DP
Sbjct: 332 FTMNEIEKLFNL---NHLTKGNVKVDYKKLWFFNKHFLREKIKDP 373

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 73.9 bits (180), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 96/218 (44%), Gaps = 26/218 (11%)

Query: 200 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 259
           +  VVTRF P P+G LH+G  + AL N   A+   GK I+R +DT+  +   E + +IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 260 DLSLLGIKGDRVTY-SSDYFQQ-MYD-MCIQLIKEGGAY---CDDTPTEKMREERMDGIA 313
            L    IK D   Y  SD  ++ +Y     QL+K G AY   C       +REE  D   
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 314 SARRDRSVEE------NLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNL 367
           +   D+ V         ++    E+ +  ++ L   VR  I          DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSDR 215

Query: 368 TPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEY 405
                       +PTY     + D + GVTH +R  E+
Sbjct: 216 ------------FPTYHLANVVDDHLMGVTHVIRGEEW 241

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 73.2 bits (178), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 97/215 (45%), Gaps = 18/215 (8%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V+TRF P P+G LH+G  + AL N   A+   GK I+R +DT+ ++   E   +I + L 
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 263 LLGIKGDRVTYSSDYFQQMYDMCI-QLIKEGGAYCDDTPTEKMREERMDGIA--SARRDR 319
              ++ D           +Y   I +L+K G AY      E++ + R   +A  S   DR
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNMAPGSLSYDR 165

Query: 320 SVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPHHRTGDTW-- 377
                + +  E +K   ++G+   +R K     P   + D +    N+ P++R G  W  
Sbjct: 166 KC---IHLDEETIKVNLDKGIPYTIRMKSPERYP--LIHDLLHGELNIQPNNREG-MWFD 219

Query: 378 -------KVYPTYDFCVPIVDSVEGVTHALRTIEY 405
                    +PTY F   + D +  VTH +R  E+
Sbjct: 220 DPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 120/266 (45%), Gaps = 30/266 (11%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G++H+G  + AL N   A++  G+ ++R +DT+  +  E  ++ I E L 
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 263 LLGIKGDR--VTYSSDY--FQQ-----MYDMCIQLIKEGG----AYCDDTPTEKMRE--E 307
             GI+ D      S  Y  F+Q     +Y   I+++ E G     +C     ++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 308 RMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAP--NKTLRDPVIYRC 365
           +++  +SA  DR     L +  EE+K          +R K     P     L   +  + 
Sbjct: 166 KLNPPSSASYDRHC---LHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQI 222

Query: 366 NLTPHHRTGDTWKV-----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALH 420
              PH +T D   +      PTY F   + D +  +TH +R  E+     ++  M NAL 
Sbjct: 223 QYNPHKKTYDDPILIKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISMYNALG 282

Query: 421 LRK---VHIWDFARVNFVRTLLSKRK 443
            +    +HI     +N  +  LSKRK
Sbjct: 283 WQAPKYIHIPLLTSINDKK--LSKRK 306

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/348 (24%), Positives = 138/348 (39%), Gaps = 54/348 (15%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G+LH+G  + AL N   A+  KG+ ++R +DT+  +     +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 263 LLGIKGDRVTYSSDYFQQMYDMCIQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 316
              I  D         + +YD  ++ L+  G AY      E++ + R   +     + A 
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPPSMAS 164

Query: 317 RDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPH-----H 371
            DR      K   EE+++   + +   VR K     P  T  D +    NL P       
Sbjct: 165 YDRCCAHLAK---EEIESKLAQDMPFTVRFKSPEQYP--TFTDVLHGEINLQPQVNYNDR 219

Query: 372 RTGDTWKV----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIW 427
           R  D   V     PTY     + D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 428 DFARVNFVRTL-------LSKRKL---------QWMVDKGLVE-----NWDDPRFPTXXX 466
           D+ +   +  L       LSKRK          Q ++ + LV       W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 467 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK-----KVIDPV 509
                 ++E L       G ++    ++   +W FNK     ++ DPV
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPV 379

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/232 (26%), Positives = 101/232 (43%), Gaps = 20/232 (8%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  E  +++I E L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 263 LLGIKGDRVTYSSDYFQQMYDMCIQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 316
              I  D         + +YD  ++ L+  G AY      E++ + R   +     + A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 317 RDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPH-----H 371
            DR       +  EE+K+   +G+   VR K     P  T  D +  + NL P       
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERYP--TFTDLLHGQINLQPQVNFNDK 219

Query: 372 RTGDTWKV----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNAL 419
           R  D   V     PTY     + D + G+TH +R  E+     ++  + NA 
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAF 271

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 99/222 (44%), Gaps = 30/222 (13%)

Query: 204 VTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSL 263
           VTRF P P+G LH+G  + AL N   A+   GK I+R +DT+ S+ K+   D+I   L  
Sbjct: 47  VTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLKW 106

Query: 264 LGIKGDRVTYSSDYFQQMYDMCI-QLIKEGGAY-CDDTPTEKMREERMDGI-ASARR--- 317
             +K D   Y       +Y   I  LI+ G AY C  T      +ER+D +  SA R   
Sbjct: 107 CNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCT------KERLDDLRQSALRLVP 160

Query: 318 --DRSVEENLKIFTE-EMKNGTEEGLKNCVRAKIDYAAPNK--TLRDPVIYRCNLTPHHR 372
             + S + +    +E E+K+  ++G+   VR    + AP K     D +  + +L P   
Sbjct: 161 PTNVSYDRHCAHLSEGEIKSKLDQGIPFTVR----FKAPEKYPPFEDLLHGKIDLQPQQN 216

Query: 373 TGDTW---------KVYPTYDFCVPIVDSVEGVTHALRTIEY 405
             D             YPTY     I D    ++H +R  E+
Sbjct: 217 PSDIRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEW 258

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 102/232 (43%), Gaps = 33/232 (14%)

Query: 200 IGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILE 259
           I  V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +  ++ +++I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 260 DLSLLGIKGDRVTYSSD-----YFQ----QMYDMCI-QLIKEGGAYCDDTPTEKM----- 304
            L   GI  D    S +     Y Q    ++Y   I +L+  G AY    P E++     
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 305 REERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYR 364
             +++    +   DR+    L +  +E++N    G+   VR K     P     D +   
Sbjct: 158 SAQKLQPPTTVSYDRNC---LHLNHDEIQNNINNGVSYTVRMKSPEIYP--PFDDLLHGH 212

Query: 365 CNLTPHHRTGDTWKVY-----------PTYDFCVPIVDSVEGVTHALRTIEY 405
            N+ P   + D  + Y           PTY F   I D +  +TH +R  E+
Sbjct: 213 INIQPQINSND--RRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 109/263 (41%), Gaps = 33/263 (12%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     +++I + L 
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 263 LLGIKGDRVTYSSDYFQQMYDMCIQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 316
              I  D         + +YD  ++ L+  G AY      E++ E R   +     + A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 317 RDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPH-----H 371
            DR       +  EE+ +   +G+   VR K     P     D +    NL P       
Sbjct: 165 YDRCCSY---LGEEEVNSKLSQGMPFTVRFKSPEKYP--LFADLLHGEINLQPQVNFNDR 219

Query: 372 RTGDTWKV----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIW 427
           R  D   V     PTY     + D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 428 D---FARVNFVRTL----LSKRK 443
           D   F  +  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 63.9 bits (154), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 102/228 (44%), Gaps = 31/228 (13%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G LHIG  + AL N   A+  +G+ ++R +DT+ ++  +  +++I + L 
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 263 LLGIKGD-------------RVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMRE 306
             GI+ D             R +  ++ +QQ  D    L+K G AY   C     + +RE
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVD---GLLKSGHAYRCFCSKERLDGLRE 157

Query: 307 --ERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKID--YAAPNKTLRDPVI 362
             +R+    +   DR  E    +   E++    + + + +R K    Y A +  L   V 
Sbjct: 158 SAKRLKPPTTVTYDRKCES---LSQGEIEERLAQQIPHTIRLKAPERYPAFHDLLHGTVD 214

Query: 363 YRCNLTPHHRTGDTWKV-----YPTYDFCVPIVDSVEGVTHALRTIEY 405
            +  +  + R  D   +      PTY F   I D +  +TH +R  E+
Sbjct: 215 IQPQVNVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 132/340 (38%), Gaps = 49/340 (14%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G LH+G  + AL N   A+   G+ ++R +DT+  +     +  I + L+
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 263 LLGIKGDRVTYSSDYFQQMYDMCIQ-LIKEGGAYCDDTPTEKMREERMDGI-----ASAR 316
              I+ D         + +YD  ++ L+  G AY      E++ + R   +     + A 
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 317 RDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRCNLTPH-----H 371
            DR       +  EE+ +   +G+   VR K     P     D +    NL P       
Sbjct: 165 YDRCCAH---LKEEEINSNLTQGIPFTVRFKSPEQYP--VFTDLLHGEVNLQPQVNFNDK 219

Query: 372 RTGDTWKV----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVHIW 427
           R  D   V     PTY     + D + G+TH +R  E+     ++  + NA        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 428 ---DFARVNFVRTL----LSKR---------KLQWMVDKGLVE-----NWDDPRFPTXXX 466
               F  +  + T+    LSKR         K Q ++ + L+       W  PR      
Sbjct: 274 VCPKFIHIPLLTTVGDKKLSKRKGDMSISSLKKQGVLPEALINFCALFGWSPPR--DLAS 331

Query: 467 XXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNKKVI 506
                 ++E L N     G ++    ++   +W FNK  +
Sbjct: 332 KRHECFSMEELENLFNLNGLTKGNAKVDDKKLWFFNKHFL 371

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 58/229 (25%), Positives = 95/229 (41%), Gaps = 33/229 (14%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+  +  +  +++I   L 
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 263 LL---------GIKGDRVTYSSDYFQQMYDMCI-QLIKEGGAY---CDDTPTEKMRE--E 307
            L         GI G    Y       +Y   I +L+  G AY   C       ++E  +
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYINELLDNGKAYRCFCSKERLTGLKESAQ 163

Query: 308 RMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPN--KTLRDPVIYRC 365
           ++    +A  DR         T   K+  EE LKN V   +   +P+      D +  + 
Sbjct: 164 KLKPPTTASYDRKC-------TNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKL 216

Query: 366 NLTPHHRTGD---------TWKVYPTYDFCVPIVDSVEGVTHALRTIEY 405
           N+ P + + D              PTY F   + D +  ++H +R  E+
Sbjct: 217 NIQPQYNSIDRRFDDPVLMKSDNLPTYHFANVVDDHLMKISHVIRGEEW 265

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 79/350 (22%), Positives = 133/350 (38%), Gaps = 69/350 (19%)

Query: 205 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSLL 264
           TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+ ++     + ++ +    L
Sbjct: 62  TRFAPSPTGFLHLGSLRTALFNYLLAKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWL 121

Query: 265 GIKGD------------RVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERM 309
           GI+ D            R +  ++ +++  D   QLI  G AY   C         +ER+
Sbjct: 122 GIQYDEGPGVNETYGPYRQSDRTEIYKKYSD---QLISTGHAYRCFCS--------KERL 170

Query: 310 DGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKT-LRDPVIY----- 363
            G+  +        N+       K   E+     +R+KI    P    L+ P IY     
Sbjct: 171 KGLRDSAMALKPPTNVTYDRHCAKLSKED-----IRSKIKMGVPYTIRLKSPEIYEPFED 225

Query: 364 ----RCNLTPHHRTGDTW---------KVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNV 410
                 NL P     D              PTY F   I D +  +TH +R  E+     
Sbjct: 226 LLHNEINLQPQINPIDVRYDDPILIKSSGLPTYHFAHVIDDHLMEITHVIRGQEWLPATP 285

Query: 411 QYDWMLNALHLRK---VHIWDFARVNFVRTLLSKRK----LQWMVDKGLVE--------- 454
           ++  +  A        +H+   A  N  +  LSKRK    +Q + +KG++          
Sbjct: 286 KHIVLYKAFGWNPPQFIHLPLLASTNNKK--LSKRKGDTNIQQLREKGILPEALINFCVL 343

Query: 455 -NWDDPRFPTXXXXXXXXMTVEGLRNFVLSQGPSRNVINLEWNLIWAFNK 503
             W  P             ++  L N       ++    L+ + +W FNK
Sbjct: 344 FGWAPPSPEDPDRKQSYRFSLAELENLFNLNHLTKGNAKLDESRLWNFNK 393

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 58.5 bits (140), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 58/215 (26%), Positives = 97/215 (45%), Gaps = 23/215 (10%)

Query: 202 EVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDL 261
            VVTRF P P+G LHIG  + AL N   A++  GK I+R +DT+ ++ K   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 262 SLLGIKGD-RVTYSSDYFQQMYDMCIQLIKEGGAY-CDDTPTEKMREERMDGIASARRDR 319
           +   +K D      SD      +   +L++ G AY C  T      ++R+  + +   DR
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCT------KDRLSTMRAHGYDR 152

Query: 320 SVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNK--TLRDPVIYRCNLTPHH-RTGDT 376
                L +   +++   + G     R  +   +PNK  + +D +    N+     R G  
Sbjct: 153 HC---LHLSDNDVRRLFDAG---HTRPVLRLKSPNKYDSFQDMLHGTVNIQERKDRVGFD 206

Query: 377 WKV------YPTYDFCVPIVDSVEGVTHALRTIEY 405
             +      +PTY F   + D +  VTH +R  E+
Sbjct: 207 DPILMKSDGFPTYHFANVVDDHLMEVTHVIRGDEW 241

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 58.2 bits (139), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 55/226 (24%), Positives = 96/226 (42%), Gaps = 31/226 (13%)

Query: 205 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSLL 264
           TRF P P+G LHIG  + AL N   A++  G  ++R +DT+ ++     + +I E LS  
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 265 GIKGD-------------RVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMRE-- 306
           GI  D             R +  ++ +QQ  +   +L+  G AY   C     + +RE  
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTN---KLLDSGHAYRCFCTKERLDGLRESA 163

Query: 307 ERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAP--NKTLRDPVIYR 364
           +++    +A  DR       +   E++   ++ +   +R K     P     L   +  +
Sbjct: 164 QKLQPPTTASYDRHCSH---LSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQ 220

Query: 365 CNLTPHHRTGD-----TWKVYPTYDFCVPIVDSVEGVTHALRTIEY 405
             + P+ R  D          PTY F   + D +  +TH +R  E+
Sbjct: 221 PQVNPNDRRYDDPILVKSDALPTYHFANVVDDHLMDITHVVRGEEW 266

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 57.8 bits (138), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 97/235 (41%), Gaps = 50/235 (21%)

Query: 205 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSLL 264
           TRF P P+GYLH+G  + AL N   A+   G+ ++R +DT+  +   + + +I + L  L
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 265 GIKGD------------RVTYSSDYFQQMYDMCIQLIKEGGAY---CDDTPTEKMREERM 309
           GI+ D            R +  S  ++   D   +L+  G AY   C     E +R   M
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHAD---KLLASGHAYRCFCSKERLENLRTSAM 161

Query: 310 --------------DGIASARRDRSVEENLKIFTEEMKN-GTEEGLKNCVRAKIDYAA-- 352
                           ++    D  +++N+  FT   K+    E  ++ +  ++D     
Sbjct: 162 ALQPPTNVSYDRECANLSQEHIDHKLDQNVP-FTLRFKSPAVYEPFEDLLHGRVDLQPQT 220

Query: 353 -PNKT-LRDPVIYRCNLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEY 405
            PN     DPV+ + +              PTY F   + D +  +TH +R  E+
Sbjct: 221 NPNDIRYDDPVLMKSD------------GLPTYHFANVVDDHLMKITHVIRGEEW 263

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 97/242 (40%), Gaps = 32/242 (13%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G LH+G  + AL N   A+   G+ I+R +DT+ S+  E  +++I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 263 LLGIKGDR--------VTYSSDYFQQMYDMCIQLIKEGG----AYCDDTPTEKMRE--ER 308
              +  D           Y      ++Y   I  + E G     +C     E +RE   +
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRESARK 159

Query: 309 MDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNK--TLRDPVIYRCN 366
           +    +A  DR       +   E+K    + L N V   I   AP K   ++D +    +
Sbjct: 160 LQPPTTASYDRHCAH---MSPHEIK----QNLDNDVAYTIRLRAPEKYPIIQDLLHGTLD 212

Query: 367 LTPHHRTGDTW---------KVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLN 417
           + P     D              PTY F   I D +  +TH +R  E+     ++  + N
Sbjct: 213 IQPQVNANDVRYDDPILVKSDNLPTYHFANVIDDHLMEITHVIRGEEWLPSTQKHLAIYN 272

Query: 418 AL 419
           A 
Sbjct: 273 AF 274

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/244 (23%), Positives = 99/244 (40%), Gaps = 35/244 (14%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G LH+G  + AL N   A++  G+ ++R +DT+  +     + +I + L 
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 263 LLGIKGDR---------VTYSSDYFQQMYDMCI-QLIKEGGAY---CDDTPTEKMREERM 309
             G++ D            Y      ++Y   I QL+  G AY   C         +ER+
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCS--------KERL 172

Query: 310 DGIASARRDR---SVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNK--TLRDPVIYR 364
           DG+ S+ +     +     +  TE  ++   E LK  V   +   AP K     D +  +
Sbjct: 173 DGLRSSAQQLQPPTTASYDRHCTELTEDEIAENLKKGVPCTVRLKAPKKYPPFEDLLHGQ 232

Query: 365 CNLTPHHRTGDT---------WKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWM 415
            ++       D              PTY F   + D +  +TH +R  E+     ++  +
Sbjct: 233 LDMQIQINMNDIRYDDPILMKSDGLPTYHFANVVDDHLMRITHVIRGEEWLPSTPKHIAL 292

Query: 416 LNAL 419
            NA 
Sbjct: 293 YNAF 296

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 96/234 (41%), Gaps = 44/234 (18%)

Query: 203 VVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLS 262
           V TRF P P+G+LH+G  + AL N   A+   G+ ++R +DT+  +     + S+ + L 
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 263 LLGIKGDR--------VTYSSDYFQQMYDMCIQ-LIKEGGAY---CDDTPTEKMREE--- 307
              IK D           Y      ++Y   I  L+++G AY   C     + +RE    
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 308 -------RMDGIASARRDRSVEENLKI---FTEEMKNGTE-EGLKNCVRAKIDYAAPNKT 356
                    D   S   D+ VE NLK    FT   K+  +    ++ +  K+D       
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 357 L----RDPVIYRC-NLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEY 405
           L     DP++ +  NL             PTY F   I D +  +TH +R  E+
Sbjct: 231 LDIRYDDPILMKSDNL-------------PTYHFANVIDDHLMKITHVIRGEEW 271

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/241 (21%), Positives = 97/241 (40%), Gaps = 33/241 (13%)

Query: 205 TRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEFQDSILEDLSLL 264
           TRF P P+G LHIG  + AL N   A++  G+ ++R +DT+  +     ++SI E L   
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 265 GI-----------------KGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMRE- 306
           G+                 + DR      Y  ++ D+ +        +C     + +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 307 -ERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAP--NKTLRDPVIY 363
            +++    +   DR    +    TE+++   ++ +   VR K     P     L   +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHH---STEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDM 226

Query: 364 RCNLTPHHRTGDTWKV-----YPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNA 418
           +  + P+    D   +      PTY F   + D +  +TH +R  E+     ++  + NA
Sbjct: 227 QPQVNPNDMRYDDPILMKSDGLPTYHFANVVDDHLMKITHVVRGEEWLPSTPKHIALYNA 286

Query: 419 L 419
            
Sbjct: 287 F 287

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 33.1 bits (74), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 3/65 (4%)

Query: 174 LKKASTAGKK--KESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQ 231
           +KK    GKK  +++ +   E D P      ++ +FP  PSG LHIGH +  +++    +
Sbjct: 21  VKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLNR 79

Query: 232 AYKGK 236
            YK +
Sbjct: 80  FYKQR 84

>TPHA0C00680 Chr3 complement(128269..130368) [2100 bp, 699 aa] {ON}
           Anc_8.347 YLR141W
          Length = 699

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 26/75 (34%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 164 HEFLTKSMQE-LKKASTAGKKKESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKA 222
           ++ L K++ E LK+  TA  K+E     +E+D    K+ E +TR  P+      IGHAK 
Sbjct: 130 YDLLKKNLDEMLKENKTALIKREDIPIAYEMDEFYIKVEERITRIIPD-----RIGHAKK 184

Query: 223 ALLNQYFAQAYKGKL 237
            ++N  F +  K KL
Sbjct: 185 VVVNP-FVEKPKRKL 198

>Skud_5.238 Chr5 (383121..383657) [537 bp, 178 aa] {ON} YER134C
           (REAL)
          Length = 178

 Score = 30.8 bits (68), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 217 IGHAKAALLNQYFAQAYKGKLIIRFDDTNPSKEKEEF 253
           IGH K  L N Y     K K I  FDD N ++E E++
Sbjct: 115 IGHLKDGLKNLYNISDLKSKRICLFDDENRNREVEKY 151

>TDEL0B00870 Chr2 (165444..167102) [1659 bp, 552 aa] {ON} Anc_8.810
           YMR258C
          Length = 552

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%), Gaps = 3/50 (6%)

Query: 403 IEYRDRNVQ---YDWMLNALHLRKVHIWDFARVNFVRTLLSKRKLQWMVD 449
           +E RD+ +    YD +LN  HL K+ I D   +   ++L S   L+W+ D
Sbjct: 137 LEIRDKTLFDEFYDEILNLSHLTKIKILDLKSLEKTKSLSSLETLEWVCD 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,994,109
Number of extensions: 3537479
Number of successful extensions: 10647
Number of sequences better than 10.0: 70
Number of HSP's gapped: 10847
Number of HSP's successfully gapped: 70
Length of query: 707
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 590
Effective length of database: 40,065,477
Effective search space: 23638631430
Effective search space used: 23638631430
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)