Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H035302.152ON61461429650.0
ZYRO0G06512g2.152ON60453417630.0
SAKL0E10956g2.152ON60053417470.0
Kpol_1048.212.152ON59753617220.0
TDEL0B051402.152ON59953717210.0
KLTH0B05170g2.152ON59353617130.0
Kwal_33.147672.152ON59453917070.0
NCAS0B070102.152ON62553617050.0
Smik_14.2072.152ON61757017020.0
Skud_14.2112.152ON61756317000.0
TBLA0C055302.152ON61053416980.0
KAFR0F007202.152ON60853416910.0
CAGL0L12936g2.152ON60055216870.0
YNL121C (TOM70)2.152ON61756216850.0
Suva_14.2192.152ON61756316710.0
TPHA0I015102.152ON60361216700.0
Ecym_82042.152ON59753416220.0
KLLA0F24046g2.152ON60453416060.0
ABR131W2.152ON59453415980.0
NCAS0G024802.152ON59653215660.0
NDAI0F028102.152ON60953815510.0
Suva_15.3142.152ON64454615200.0
Smik_8.1952.152ON63554015070.0
Skud_8.1782.152ON63854715020.0
YHR117W (TOM71)2.152ON63954514970.0
CAGL0L04048g2.152ON58752513880.0
NDAI0B043402.152ON66454413930.0
KLTH0F14542g3.481ON5131051528e-10
NDAI0B057903.481ON523951456e-09
Ecym_30256.21ON318981364e-08
Kwal_55.211753.481ON511951323e-07
KNAG0A079003.481ON512951313e-07
SAKL0F03102g3.481ON5131271287e-07
NCAS0G008105.617ON584861288e-07
TBLA0E033005.617ON582851262e-06
AEL224W5.617ON580731252e-06
ACR005W6.21ON327941223e-06
NDAI0I022406.21ON350731223e-06
TBLA0A072706.21ON373871214e-06
Ecym_44133.481ON510951199e-06
TBLA0C039503.481ON512951181e-05
KLLA0B10912g3.481ON512971181e-05
CAGL0H08195g5.617ON583731181e-05
SAKL0G07084g5.617ON585671181e-05
TPHA0D028805.617ON585671171e-05
YOR027W (STI1)5.617ON589671172e-05
Kwal_55.199355.617ON593861163e-05
Smik_15.2055.617ON589671153e-05
NCAS0F034903.481ON512971143e-05
TPHA0J003406.21ON338961134e-05
SAKL0E01210g6.21ON323711134e-05
KLLA0A07062g5.617ON581681144e-05
KLTH0E02178g5.617ON5931091144e-05
TPHA0D032203.481ON5131041144e-05
AAR083C3.481ON5381781144e-05
CAGL0D05060g3.481ON510951135e-05
Suva_7.4083.481ON513951126e-05
Kpol_1037.266.21ON342741117e-05
Kpol_513.28.506ON3741021117e-05
Skud_15.1925.617ON589671127e-05
KLLA0D01155g6.21ON335681107e-05
TDEL0B013108.506ON3801201109e-05
KAFR0L004106.21ON331801091e-04
ZYRO0A05676g5.617ON5721131101e-04
Kpol_1032.86.21ON343801072e-04
ZYRO0B04224g3.481ON513951082e-04
Skud_7.4323.481ON513911082e-04
ZYRO0F08624g8.506ON3791331072e-04
Suva_8.805.617ON586851082e-04
YGR123C (PPT1)3.481ON513951072e-04
NCAS0A00490singletonON620861082e-04
Kpol_505.413.481ON513971072e-04
NCAS0A112003.367ON9071161082e-04
AAR054C6.328ON13361993e-04
Smik_6.2153.481ON513951063e-04
Kwal_27.118908.506ON3341531054e-04
Kpol_1018.695.617ON5901271064e-04
TDEL0A048405.617ON576911054e-04
Skud_2.2828.506ON385921045e-04
KAFR0B066103.481ON511971045e-04
KAFR0C058905.617ON575851046e-04
TDEL0C050903.367ON7591161047e-04
KNAG0B032005.617ON579851037e-04
TPHA0M016303.367ON10431161030.001
KAFR0E029808.506ON380891010.001
KLLA0B09966g8.506ON3701031010.001
CAGL0E02739g6.21ON343741000.001
TBLA0H033808.506ON3751021000.001
YBR155W (CNS1)8.506ON385891000.002
CAGL0H07425g8.506ON38089990.002
Smik_2.2958.506ON385126990.002
NDAI0C043205.352ON7061321000.002
Kwal_56.224336.21ON32282980.002
ZYRO0C16522g3.367ON974118990.003
KAFR0H008703.367ON887116990.003
CAGL0D01364g3.367ON1148116980.003
YBR112C (CYC8)3.367ON966116980.003
KNAG0H006103.367ON973116980.003
Suva_4.3613.367ON963116980.004
Smik_2.2543.367ON1020116980.004
TPHA0D038606.328ON12073910.004
AGL268C8.506ON37988960.004
Skud_2.2403.367ON984116970.005
NDAI0F009105.617ON583151960.006
Suva_4.4058.506ON38589950.006
Ecym_25598.506ON370117950.006
NCAS0B024008.506ON38089940.008
KAFR0L018707.412ON712232950.008
Kpol_172.23.367ON418112940.008
Suva_15.1826.21ON34692930.009
Ecym_55825.617ON58491940.009
Ecym_20906.328ON17259900.010
Suva_3.956.328ON11170860.011
NDAI0D008106.21ON34976930.011
KAFR0B002507.546ON1420107940.012
TDEL0G044806.21ON34382920.013
SAKL0A01672g6.328ON12862870.013
NCAS0H008306.21ON33876920.014
KNAG0M011706.21ON33989910.016
NDAI0C052908.506ON37990910.020
NCAS0A153007.546ON1398139910.026
ZYRO0C07788g6.21ON33474890.030
TDEL0E027505.352ON564123900.031
KLLA0E20857g7.412ON71088900.033
TBLA0H015203.367ON689235890.036
Kpol_1006.43.367ON732116890.038
Smik_3.1596.328ON11569820.041
NCAS0E024907.412ON809194890.047
NDAI0G037103.5ON112198890.048
KNAG0H012503.265ON795112880.055
TBLA0I023106.328ON11661810.057
Skud_15.1686.21ON34865870.057
SAKL0F12936g7.412ON632120870.062
NDAI0A051003.367ON1007116880.062
TBLA0F012303.367ON1189113880.065
YCR060W (TAH1)6.328ON11175800.072
TPHA0L014208.506ON374118860.082
TDEL0C027207.412ON700190860.083
YOR007C (SGT2)6.21ON34673850.089
ACR168W2.665ON70797860.092
Smik_15.1766.21ON34576850.096
Kpol_1050.1127.546ON1360107860.10
KLTH0C11220g6.21ON32774840.11
Kpol_1018.1067.412ON753190850.11
Ecym_56372.665ON71797850.11
Kpol_1028.516.328ON11763790.12
Suva_8.1295.689ON741135850.13
Skud_3.1356.328ON11859790.13
KNAG0F040107.546ON1418124840.15
SAKL0B07986g3.367ON880116840.17
KLLA0B09262g3.367ON941116840.18
Suva_2.4895.352ON659111830.19
TBLA0G010506.21ON35074820.20
CAGL0G10087g7.546ON1411107830.21
KLTH0F10428g3.367ON795116830.22
Ecym_34593.367ON1115116830.23
SAKL0F16236g7.546ON1408146830.24
Kwal_23.36703.367ON802116820.25
KLLA0C08910g6.328ON11559760.25
TPHA0M002706.21ON37761810.28
YDR320C (SWA2)5.352ON668111820.29
ADL344W3.367ON910116820.33
KLTH0E11748g8.506ON37889800.36
CAGL0C01903g7.412ON769190800.42
KNAG0A039508.506ON38689790.53
TBLA0H019705.352ON840103800.54
ZYRO0D00836g7.546ON140177790.62
TDEL0D055003.481ON51262790.64
TBLA0B049907.546ON141076790.66
KAFR0C018505.352ON646121780.78
KAFR0F018001.182ON42441770.85
NCAS0D045006.328ON12175721.0
TDEL0A074306.328ON12461721.1
AGL294W7.412ON65655771.1
KAFR0J025706.328ON12159721.1
Skud_2.247.412ON769190761.3
Smik_4.5795.352ON667111761.3
ZYRO0D12364g5.519ON80982761.4
Suva_16.5217.546ON1424107761.5
Smik_16.4537.546ON1417154751.8
KNAG0I025206.328ON11760702.0
NCAS0F028705.352ON70075752.0
TPHA0E007407.412ON746177742.2
YBL084C (CDC27)7.412ON758190742.3
Ecym_71427.412ON67555742.4
ZYRO0G18502g1.182ON39643732.4
KNAG0C055005.352ON585118742.7
KLLA0B03520g7.546ON140158733.5
TBLA0D004607.412ON835183733.6
NCAS0H035402.665ON760104733.6
Smik_2.367.412ON751114733.7
YPR189W (SKI3)7.546ON1432126724.3
Skud_4.5865.352ON642111724.7
KLTH0H14872g5.352ON623135714.8
CAGL0B01375g3.5ON111076724.9
TDEL0H002507.546ON139750725.1
Skud_15.2455.689ON75049715.2
KAFR0B003507.536ON341101705.9
KLTH0F04840g1.182ON38143706.0
Suva_11.1502.618ON88128716.0
Suva_2.347.412ON76378716.4
YOR080W (DIA2)5.689ON73249706.8
TDEL0H024307.204ON55362707.2
AEL281C7.546ON139059707.2
ZYRO0B03828g7.412ON727189707.4
ZYRO0D00572g2.665ON785137707.9
SAKL0G19712g2.665ON72159698.4
CAGL0M08404g1.182ON46243698.6
TBLA0C010102.665ON86459698.8
KAFR0D023405.689ON69743699.4
Kwal_33.138461.182ON37543689.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03530
         (614 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.1...  1146   0.0  
ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {...   683   0.0  
SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} simila...   677   0.0  
Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {O...   667   0.0  
TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {O...   667   0.0  
KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} simila...   664   0.0  
Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {...   662   0.0  
NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON} Anc_2...   661   0.0  
Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {...   660   0.0  
Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {...   659   0.0  
TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa] ...   658   0.0  
KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {O...   655   0.0  
CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON} sim...   654   0.0  
YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON} ...   653   0.0  
Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {...   648   0.0  
TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {O...   647   0.0  
Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}...   629   0.0  
KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} simi...   623   0.0  
ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic ho...   620   0.0  
NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {O...   607   0.0  
NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.1...   602   0.0  
Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117...   590   0.0  
Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W ...   585   0.0  
Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W ...   583   0.0  
YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}  TOM71Mitoc...   581   0.0  
CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} simil...   539   0.0  
NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON} Anc_2...   541   0.0  
KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]...    63   8e-10
NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa] ...    60   6e-09
Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON} si...    57   4e-08
Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {...    55   3e-07
KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa] ...    55   3e-07
SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly...    54   7e-07
NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {O...    54   8e-07
TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {O...    53   2e-06
AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic ho...    53   2e-06
ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic hom...    52   3e-06
NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.2...    52   3e-06
TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa] ...    51   4e-06
Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}...    50   9e-06
TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {O...    50   1e-05
KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} simila...    50   1e-05
CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {...    50   1e-05
SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly...    50   1e-05
TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.6...    50   1e-05
YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90...    50   2e-05
Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027...    49   3e-05
Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027...    49   3e-05
NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {O...    49   3e-05
TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON...    48   4e-05
SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}...    48   4e-05
KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {...    49   4e-05
KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly...    49   4e-05
TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {O...    49   4e-05
AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON} S...    49   4e-05
CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {...    48   5e-05
Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON...    48   6e-05
Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {O...    47   7e-05
Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)...    47   7e-05
Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027...    48   7e-05
KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {...    47   7e-05
TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {O...    47   9e-05
KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}...    47   1e-04
ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly...    47   1e-04
Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON...    46   2e-04
ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly...    46   2e-04
Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON...    46   2e-04
ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} simila...    46   2e-04
Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W (...    46   2e-04
YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}  ...    46   2e-04
NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON}       46   2e-04
Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}...    46   2e-04
NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa] ...    46   2e-04
AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON} Sy...    43   3e-04
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    45   3e-04
Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155...    45   4e-04
Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON} (1971...    45   4e-04
TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.6...    45   4e-04
Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W ...    45   5e-04
KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON} Anc_3...    45   5e-04
KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON} Anc_5...    45   6e-04
TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {O...    45   7e-04
KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {O...    44   7e-04
TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa] ...    44   0.001
KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.5...    44   0.001
KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {...    44   0.001
CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {...    43   0.001
TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.5...    43   0.001
YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}  CNS1TPR-co...    43   0.002
CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly...    43   0.002
Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W ...    43   0.002
NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {O...    43   0.002
Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {O...    42   0.002
ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]...    43   0.003
KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.3...    43   0.003
CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} simil...    42   0.003
YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}  ...    42   0.003
KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.36...    42   0.003
Suva_4.361 Chr4 complement(631697..632812,632933..633154,633188....    42   0.004
Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {O...    42   0.004
TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.32...    40   0.004
AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON} S...    42   0.004
Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON...    42   0.005
NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}     42   0.006
Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W ...    41   0.006
Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar...    41   0.006
NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {O...    41   0.008
KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7....    41   0.008
Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)...    41   0.008
Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {...    40   0.009
Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {O...    41   0.009
Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON} ...    39   0.010
Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W (R...    38   0.011
NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {O...    40   0.011
KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON...    41   0.012
TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.2...    40   0.013
SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {O...    38   0.013
NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {O...    40   0.014
KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {...    40   0.016
NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON} Anc_8...    40   0.020
NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON}            40   0.026
ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} simila...    39   0.030
TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.3...    39   0.031
KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} simi...    39   0.033
TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.3...    39   0.036
Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON...    39   0.038
Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W (...    36   0.041
NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {O...    39   0.047
NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {...    39   0.048
KNAG0H01250 Chr8 (217258..219645) [2388 bp, 795 aa] {ON} Anc_3.2...    39   0.055
TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.32...    36   0.057
Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {...    38   0.057
SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} simi...    38   0.062
NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON} Anc_...    39   0.062
TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {...    39   0.065
YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Compone...    35   0.072
TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8....    38   0.082
TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.4...    38   0.083
YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON} ...    37   0.089
ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic ho...    38   0.092
Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {...    37   0.096
Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..25389...    38   0.10 
KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar...    37   0.11 
Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON} (280...    37   0.11 
Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar...    37   0.11 
Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {...    35   0.12 
Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W ...    37   0.13 
Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W (...    35   0.13 
KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7....    37   0.15 
SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {...    37   0.17 
KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly...    37   0.18 
Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON...    37   0.19 
TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {O...    36   0.20 
CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} simil...    37   0.21 
KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly...    37   0.22 
Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar ...    37   0.23 
SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON} sim...    37   0.24 
Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C...    36   0.25 
KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {O...    34   0.25 
TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON...    36   0.28 
YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}...    36   0.29 
ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic ho...    36   0.33 
KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} simi...    35   0.36 
CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {...    35   0.42 
KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {O...    35   0.53 
TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.3...    35   0.54 
ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {O...    35   0.62 
TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {O...    35   0.64 
TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON} Anc_...    35   0.66 
KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.3...    35   0.78 
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    34   0.85 
NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.32...    32   1.0  
TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6....    32   1.1  
AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic ho...    34   1.1  
KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.3...    32   1.1  
Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON} Y...    34   1.3  
Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {...    34   1.3  
ZYRO0D12364g Chr4 (1037070..1039499) [2430 bp, 809 aa] {ON} simi...    34   1.4  
Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR18...    34   1.5  
Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR18...    33   1.8  
KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON...    32   2.0  
NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {O...    33   2.0  
TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {O...    33   2.2  
YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}  CD...    33   2.3  
Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}...    33   2.4  
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    33   2.4  
KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON} Anc_5...    33   2.7  
KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} simil...    33   3.5  
TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {O...    33   3.6  
NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.6...    33   3.6  
Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON} Y...    33   3.7  
YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski ...    32   4.3  
Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {...    32   4.7  
KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]...    32   4.8  
CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa] ...    32   4.9  
TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON...    32   5.1  
Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080...    32   5.2  
KAFR0B00350 Chr2 complement(80065..81090) [1026 bp, 341 aa] {ON}...    32   5.9  
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    32   6.0  
Suva_11.150 Chr11 (282785..285430) [2646 bp, 881 aa] {ON} YKL073...    32   6.0  
Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 7...    32   6.4  
YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}  DIA2Origi...    32   6.8  
TDEL0H02430 Chr8 (407748..409409) [1662 bp, 553 aa] {ON} Anc_7.2...    32   7.2  
AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON} ...    32   7.2  
ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} simila...    32   7.4  
ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp...    32   7.9  
SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} simi...    31   8.4  
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    31   8.6  
TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.6...    31   8.8  
KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {O...    31   9.4  
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    31   9.5  

>KNAG0H03530 Chr8 (657450..659294) [1845 bp, 614 aa] {ON} Anc_2.152
           YHR117W
          Length = 614

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/614 (93%), Positives = 572/614 (93%)

Query: 1   MSTASDNSVAAFFARNKRAILXXXXXXXXXXXXXXXXXXXXXXLDRDXXXXXXXXXXXXX 60
           MSTASDNSVAAFFARNKRAIL                      LDRD             
Sbjct: 1   MSTASDNSVAAFFARNKRAILATVAAGTAAAGAYYYYTQVQQQLDRDGASAKGSKKKSKK 60

Query: 61  XXXXXXXQEKKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEK 120
                  QEKKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEK
Sbjct: 61  KSGSKKKQEKKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEK 120

Query: 121 AVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA 180
           AVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA
Sbjct: 121 AVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA 180

Query: 181 NTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQP 240
           NTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQP
Sbjct: 181 NTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQP 240

Query: 241 LPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVN 300
           LPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVN
Sbjct: 241 LPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVN 300

Query: 301 QYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSY 360
           QYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSY
Sbjct: 301 QYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSY 360

Query: 361 IYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKEL 420
           IYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKEL
Sbjct: 361 IYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKEL 420

Query: 421 DNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAK 480
           DNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAK
Sbjct: 421 DNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAK 480

Query: 481 QYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQ 540
           QYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQ
Sbjct: 481 QYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQ 540

Query: 541 AKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAK 600
           AKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAK
Sbjct: 541 AKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAK 600

Query: 601 VEEALAEYRAQGMI 614
           VEEALAEYRAQGMI
Sbjct: 601 VEEALAEYRAQGMI 614

>ZYRO0G06512g Chr7 complement(515759..517573) [1815 bp, 604 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121C TOM70 Translocase of Outer Mitochondrial
           membrane 70 kDa mitochondrial specialized import
           receptor of the outer membrane
          Length = 604

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/534 (63%), Positives = 412/534 (77%), Gaps = 10/534 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           YP+   GEP L  +   + EQ+E+++ ALKDKGNE FK+K  + A+KYY +AL  KKDPV
Sbjct: 81  YPVDEKGEPKLDNVAEMSEEQKESWSTALKDKGNEFFKQKDYDNALKYYDYALTLKKDPV 140

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+NISACYVS+N  +KV+EN  KALELKPDYSK LLRRA+  E++EN+ DAMFDLSVLS
Sbjct: 141 FYSNISACYVSMNQLDKVVENSTKALELKPDYSKALLRRASANESLENYPDAMFDLSVLS 200

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260
           LN DF G+SIEPMLERNLNKQAM +LK++L   ++   Q LPSDT++ASFFGIF PETEF
Sbjct: 201 LNGDFGGSSIEPMLERNLNKQAMTVLKDKLGQQKN---QLLPSDTALASFFGIFTPETEF 257

Query: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320
             YDET EAD+ L+ GL  L+  +  G+ KAD  F++AV+ Y +L    SD+  L     
Sbjct: 258 ANYDETSEADQKLKAGLENLYKRSSEGYQKADEFFSQAVDAYAKLREGNSDDAAL----K 313

Query: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380
           EK AIALE+ GIF+FLKND +GA   V +AI L PRVNSYIY+AL  AD G++ EY   F
Sbjct: 314 EKDAIALEHRGIFRFLKNDPLGAHEDVQKAIDLHPRVNSYIYMALIMADKGKAEEYYEFF 373

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           DKA++L+P ++A YYHRGQ+YFIT  Y+KA  DF KAK+L+ +NIF YIQLACL YRE  
Sbjct: 374 DKAIKLDPKNAAVYYHRGQMYFITAQYEKAGQDFDKAKQLNEENIFPYIQLACLAYRENK 433

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
            D+C+ LF EA+ KF  APEVP F+AEILADKGD   A KQYD+AKRLEEA+    GI V
Sbjct: 434 FDDCETLFSEAKRKFATAPEVPNFFAEILADKGDLEKALKQYDIAKRLEEAVD---GIHV 490

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
           G++PLVGKAT+LARQPS ENF EAT L EEAC +DPRSEQ KVGLAQL LQQED+D AIK
Sbjct: 491 GISPLVGKATLLARQPSVENFIEATKLLEEACAKDPRSEQGKVGLAQLKLQQEDIDDAIK 550

Query: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +FEEAA LART DEKLQA TFAEAAKVQK+IRADP++ AK+EE LA Y+AQG+I
Sbjct: 551 LFEEAASLARTVDEKLQATTFAEAAKVQKRIRADPLVSAKIEETLAAYKAQGVI 604

>SAKL0E10956g Chr5 (916623..918425) [1803 bp, 600 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 600

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/534 (63%), Positives = 410/534 (76%), Gaps = 10/534 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           YP+  +GEP L  +D  T EQ+E YA+ LKDKGNE FKEK  ++AIKYY  ALE KKDPV
Sbjct: 77  YPVDENGEPKLDDIDQLTDEQKEKYAMGLKDKGNEFFKEKKFDDAIKYYNLALELKKDPV 136

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+N SACYVS+   EKV+E+   AL+LK DYSK LLRRA+  E++ N+ADAMFDLS LS
Sbjct: 137 FYSNRSACYVSMGQLEKVVEDTTAALKLKSDYSKCLLRRASANESLGNYADAMFDLSALS 196

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260
           L  DF+GASIEPMLERN+NKQAM +LKE+LE  +D     LPS+TS+ASFFGIF+PET F
Sbjct: 197 LYGDFNGASIEPMLERNMNKQAMLVLKEKLEEKKD---HRLPSNTSLASFFGIFEPETSF 253

Query: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320
           + YDE+ EADR L  GL  L+  T  G+  AD  F +A   Y+ L  ++ + E L Q   
Sbjct: 254 ENYDESVEADRLLLQGLTNLYKRTSEGYDTADESFTKAAAAYKTLLEESPENEILKQ--- 310

Query: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380
            K AIALE+ GIFKFLKND + A   + +A++  PRVNSYIYLAL  AD G+++EY  NF
Sbjct: 311 -KAAIALEHVGIFKFLKNDPLSAHDDLKQALEYHPRVNSYIYLALIMADKGQATEYFENF 369

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           DKALEL+PN +A YYHRGQ+YFITQ Y+ A  DF KAKE + +NIF YIQLACL YRE  
Sbjct: 370 DKALELDPNCAAVYYHRGQMYFITQQYENAGKDFDKAKECNENNIFPYIQLACLAYRENK 429

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
            ++C+ LF EAR KFP APEVP FYAEIL+DKGD ++A KQY++A++LE+A+    GI V
Sbjct: 430 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLANAKKQYEIARKLEDALD---GIHV 486

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
           G+APLVGKAT+LAR+P+ ENF EAT  FEEAC++DPRSEQAK+GLAQL LQQE+VD AI 
Sbjct: 487 GIAPLVGKATLLAREPTVENFVEATQNFEEACEKDPRSEQAKIGLAQLKLQQEEVDEAIT 546

Query: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +FEEAADLAR+ DEKLQA TFAEA K+QKKIRADPII AK+EE LA YRAQGMI
Sbjct: 547 LFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIISAKIEETLAAYRAQGMI 600

>Kpol_1048.21 s1048 complement(67975..69768) [1794 bp, 597 aa] {ON}
           complement(67975..69768) [1794 nt, 598 aa]
          Length = 597

 Score =  667 bits (1722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/536 (61%), Positives = 411/536 (76%), Gaps = 10/536 (1%)

Query: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138
           P YPI ++GEPDL    ++T EQ+ETY++ALKDKGN+ FKE+  E+A+KYY +AL+ K+D
Sbjct: 72  PCYPIDSNGEPDLKDSANFTEEQKETYSVALKDKGNQFFKEQKYEDALKYYNYALDLKQD 131

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
           PVFY+NISACYVSL + EKV+E+  KALELKPDYSK LLRRA+  EN+ENFA+AMFDLSV
Sbjct: 132 PVFYSNISACYVSLGNLEKVVESSTKALELKPDYSKALLRRASANENLENFAEAMFDLSV 191

Query: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPET 258
           LSLN DF+ ASIEPMLERNLNKQAM++LK+++ +     +Q LPS+T +ASFFGIF PET
Sbjct: 192 LSLNGDFNEASIEPMLERNLNKQAMRVLKDKMSSDA---KQQLPSNTFLASFFGIFTPET 248

Query: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318
             K +DE+ EAD  L   L+ L+      ++ AD  F++A   Y +      D+E L   
Sbjct: 249 TLKNFDESNEADVELLNALVNLYKRKSESYLIADESFSKAAESYVKQLEANPDDEVL--- 305

Query: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378
             EK A ALEY+GIFKFLKND +G+   +  +I+L PRVN+YIY AL  AD GES  Y  
Sbjct: 306 -KEKTATALEYNGIFKFLKNDPLGSHEDIQRSIELHPRVNAYIYSALIMADKGESKNYFD 364

Query: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438
            FDKAL+++PNS+  YYHRGQ++F++Q Y+KA ADF KAKE D+ NIF YIQLACL Y E
Sbjct: 365 FFDKALDVDPNSAPVYYHRGQMHFLSQQYEKAAADFEKAKESDSSNIFPYIQLACLTYHE 424

Query: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498
           G  D+C+ LF EA+ KFP APEVP FYAE+L DKGDF  A+KQYD+AKRLEE++ A   I
Sbjct: 425 GKFDDCETLFSEAKRKFPTAPEVPNFYAEVLTDKGDFDAASKQYDIAKRLEESLDA---I 481

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
            VGV+PLVGKAT+LARQP+ EN  E+TTL EEACK D RSEQAK+GLAQL LQQE++D A
Sbjct: 482 HVGVSPLVGKATLLARQPTVENLLESTTLLEEACKMDSRSEQAKIGLAQLKLQQEEIDEA 541

Query: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           I +FEEA+DLAR  +EKLQA TFAEA+KVQKKIRADP++ AK++  LA YR QG+I
Sbjct: 542 ITLFEEASDLARNMEEKLQATTFAEASKVQKKIRADPVVNAKIQATLAAYREQGLI 597

>TDEL0B05140 Chr2 complement(904626..906425) [1800 bp, 599 aa] {ON}
           Anc_2.152 YHR117W
          Length = 599

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/537 (62%), Positives = 408/537 (75%), Gaps = 10/537 (1%)

Query: 78  TPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKK 137
           TPVYP+  +GEP L  ++  + E RETYA ALKD+GNE FK+K  + A+KYY +AL  KK
Sbjct: 73  TPVYPVGQNGEPLLENIEELSQELRETYATALKDRGNEFFKKKDYDNALKYYNYALVVKK 132

Query: 138 DPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLS 197
           DPVFY+NISACYVSL   +KV+EN  KALELKPDYSK LLRRA+  E++EN+ADAMFDLS
Sbjct: 133 DPVFYSNISACYVSLGQLDKVVENSTKALELKPDYSKALLRRASANESLENYADAMFDLS 192

Query: 198 VLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPE 257
           VLSLN DF+G+SIEPMLERNLNKQAM +LK++L N      Q LPS+T++ASFFGIF PE
Sbjct: 193 VLSLNGDFNGSSIEPMLERNLNKQAMFVLKDKLGNN---VSQQLPSNTALASFFGIFPPE 249

Query: 258 TEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQ 317
           T F  Y+E  EAD  L+ GL +L+  +  G+  AD  F ++ + +    S+  D+  L  
Sbjct: 250 TTFANYNENDEADVGLKNGLEDLYKRSSEGYKLADEAFVKSASFFTNKLSEFPDDAVL-- 307

Query: 318 NLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYV 377
              EK AIALE++GIFKFLKND + A   + +AI+L PR+NSYIY+AL  AD G++ EY 
Sbjct: 308 --KEKTAIALEHNGIFKFLKNDPLEAHDDIEKAIQLHPRLNSYIYMALIMADKGQAEEYY 365

Query: 378 TNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYR 437
             FDKA+ L+PN    YYHRGQ+Y+IT  Y+KA  DF KAKE D +NIF YIQLACL YR
Sbjct: 366 QYFDKAIALDPNYGPAYYHRGQMYYITGQYEKAGKDFDKAKECDENNIFPYIQLACLAYR 425

Query: 438 EGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTG 497
           E   D+C+ LF EA+ KFP APEVP FYAEIL DKGD   A KQY++AKRLEEA+    G
Sbjct: 426 EDKFDDCETLFSEAKRKFPTAPEVPNFYAEILGDKGDLEAALKQYEIAKRLEEALD---G 482

Query: 498 IRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDS 557
           I VGVAPLVGKAT+LARQPS ENF EAT L EEAC+RDP SEQAKVGLAQL LQQE+VD 
Sbjct: 483 IHVGVAPLVGKATLLARQPSVENFREATLLLEEACRRDPTSEQAKVGLAQLKLQQEEVDE 542

Query: 558 AIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           AI +FEEAA+LART DEKLQA TFAEAAKVQK+I+ADP++ AK+EE LA YRAQGM+
Sbjct: 543 AINLFEEAANLARTVDEKLQATTFAEAAKVQKRIKADPVVSAKIEETLAAYRAQGMM 599

>KLTH0B05170g Chr2 (427608..429389) [1782 bp, 593 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 593

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/536 (61%), Positives = 408/536 (76%), Gaps = 10/536 (1%)

Query: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138
           P YP+   GEPDLS L   + EQ++ YA+ LKDKGNE FK K  +EAI+YY WA+E K+D
Sbjct: 68  PSYPVNEKGEPDLSNLAELSDEQKDKYAMGLKDKGNEFFKNKKYDEAIQYYSWAIEVKED 127

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
           PVFY+N SACYVSL   EKV+E+   AL+LKPDYSK LLRRA+  E++ NFADAMFDLS 
Sbjct: 128 PVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGNFADAMFDLSA 187

Query: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPET 258
           +SL  DFSGASIEP+LERN+NKQ+M +LKE+LE  Q   E  LPS+TS+ASFFGIF+PET
Sbjct: 188 VSLYGDFSGASIEPLLERNMNKQSMLVLKEKLEKQQ---EYKLPSNTSLASFFGIFQPET 244

Query: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318
            F+ YD+  EAD+ L  GL  L+  T  G+  AD  F +A + ++ L  +  ++     +
Sbjct: 245 TFENYDDNSEADKYLLEGLTNLYKRTADGYETADLSFAKARDAFKVLLEQNPED----AD 300

Query: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378
           L  K AIALE+ GIFKFLKND I A   + +A++ FPR N+YIY+AL  AD G+++EY  
Sbjct: 301 LKRKAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATEYFD 360

Query: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438
           NF+KAL+L+P+ +A YYHRGQ+YFITQ +++A  DF KAKEL   NIF YIQLACL YRE
Sbjct: 361 NFEKALKLDPSCAAVYYHRGQMYFITQQFEQAGKDFEKAKELSESNIFPYIQLACLTYRE 420

Query: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498
           G  D+ + LF EAR KFP APEVP FYAE L+DKGD + A KQYD+A +LE+A+    GI
Sbjct: 421 GKFDDSETLFSEARRKFPTAPEVPNFYAETLSDKGDLAGARKQYDIAAKLEDALD---GI 477

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
            VGV+PL+GKAT+L+R+PS ENF EAT LFE+AC+ DPRSEQAK+GLAQL LQQED+D A
Sbjct: 478 HVGVSPLIGKATLLSREPSVENFVEATQLFEKACQNDPRSEQAKIGLAQLKLQQEDIDEA 537

Query: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           I +FEEAADLAR+ DEKLQA TFAEA K+QKKIRADP++ AK+EE LA YRAQGMI
Sbjct: 538 IALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPVVSAKIEETLAAYRAQGMI 593

>Kwal_33.14767 s33 complement(809994..811778) [1785 bp, 594 aa] {ON}
           YHR117W (TOM71) - 71-kDa component of the protein
           translocase of the outer membrane of mitochondria
           [contig 101] FULL
          Length = 594

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/539 (60%), Positives = 410/539 (76%), Gaps = 10/539 (1%)

Query: 76  TETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF 135
           T+ P +P+   GEPDL ++D  + E+++ +A+ LKDKGNE FK K  E+A+KYY  A+E 
Sbjct: 66  TQGPSFPVDEKGEPDLGKVDELSAEEKDKFAMGLKDKGNEFFKNKQFEDALKYYSLAIEV 125

Query: 136 KKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195
           K+DPVFY+N SACYVSL   EKV+E+   AL+LKPDYSK LLRRA+  E++  FADAMFD
Sbjct: 126 KEDPVFYSNRSACYVSLGQQEKVVEDTTAALKLKPDYSKCLLRRASANESLGKFADAMFD 185

Query: 196 LSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFK 255
           LS +SL  DF+G+SIEP+LERN+NKQAM +LKE+LE  Q   E  LPS+TS+ASFFGIF+
Sbjct: 186 LSAVSLYGDFNGSSIEPLLERNMNKQAMLVLKEKLEKQQ---EYKLPSNTSLASFFGIFQ 242

Query: 256 PETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKL 315
           PET F+ YDE  EAD+ L  GL  L+  T  G+  AD  F++A ++Y+ L    S++  L
Sbjct: 243 PETSFENYDENSEADKALLDGLTNLYKRTSGGYEAADAAFSKARDEYKTLLEHNSEDASL 302

Query: 316 AQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE 375
            Q    K AIALE+ GIFKFLKND I A   + +A++ FPR N+YIY+AL  AD G+++E
Sbjct: 303 KQ----KAAIALEHVGIFKFLKNDPISAHEDLKKAVEYFPRPNTYIYMALIMADKGQATE 358

Query: 376 YVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLC 435
           Y  NF+KALEL+PN +A YYHRGQ++FITQ +++A  DF KAKEL+  NIF YIQLACL 
Sbjct: 359 YFDNFEKALELDPNCAAVYYHRGQMHFITQQFEQAGKDFEKAKELNESNIFPYIQLACLT 418

Query: 436 YREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAK 495
           YREG   + + LF EAR KFP +PEVP FYAE L+DKGD + A K+YD+A +LE A+   
Sbjct: 419 YREGKFSDSETLFSEARRKFPTSPEVPNFYAETLSDKGDIAGAKKEYDIAAKLESALD-- 476

Query: 496 TGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDV 555
            GI VGV+PL+GKAT+L+R+PS ENF EAT LFE+AC+ DPRSEQAK+GLAQL LQQED+
Sbjct: 477 -GIHVGVSPLIGKATLLSREPSVENFIEATRLFEQACENDPRSEQAKIGLAQLKLQQEDI 535

Query: 556 DSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           D AI +FEEAADLAR+ DEKLQA TFAEA K+QKKIRADPI+ AK+EE LA YRAQGMI
Sbjct: 536 DEAIALFEEAADLARSFDEKLQATTFAEATKIQKKIRADPIVSAKIEETLAAYRAQGMI 594

>NCAS0B07010 Chr2 (1332351..1334228) [1878 bp, 625 aa] {ON}
           Anc_2.152
          Length = 625

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/536 (62%), Positives = 408/536 (76%), Gaps = 9/536 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           YP   S +PD+ Q+ S   E+++  ++ LKDKGN+ FK K    AIKYY  AL+  KDP+
Sbjct: 97  YPTNDSNDPDMIQITSLPLEEQKKISMQLKDKGNKYFKAKDYTNAIKYYNLALDLNKDPI 156

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+NISACYVSL   +KV+E+  KALEL P+YSK LLRRA+  E++EN++DA+FDLSVLS
Sbjct: 157 FYSNISACYVSLGQLDKVIESSTKALELNPNYSKALLRRASANESLENYSDALFDLSVLS 216

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLE--NTQDKFEQPLPSDTSMASFFGIFKPET 258
           LN D+SGASIEP+LERNLNKQA+K+L ER+      +K +Q LPS TS+ SFFGIF PE 
Sbjct: 217 LNGDYSGASIEPILERNLNKQAIKVLNERMNKMTGSNKEQQLLPSTTSLVSFFGIFDPEL 276

Query: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318
            F+ Y+E  +AD  L TGL  LF  T  G++ AD  F +A + + E  +K   ++ L   
Sbjct: 277 TFQNYNENDQADVELLTGLTNLFKRTDQGYLDADKNFVKASSLFMEELAKNPKDKHLL-- 334

Query: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378
             EK AIALEY+GIF+FLKND++GAQ  + +AI  FPRVNSY+YLAL SAD   S EY  
Sbjct: 335 --EKTAIALEYNGIFRFLKNDLLGAQTDIEKAIGFFPRVNSYLYLALISADKSTSQEYSK 392

Query: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438
            FDKALELNP+S + YYHRGQLYFITQDY KAK +F KAKELD  NIF YIQLACL YRE
Sbjct: 393 YFDKALELNPDSLSVYYHRGQLYFITQDYPKAKVEFEKAKELDETNIFPYIQLACLAYRE 452

Query: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498
            D D C+KLFDE R+KFP  PEVPTFYAEILADKGDF+ A KQYD+A RLE+   A+  I
Sbjct: 453 NDFDRCQKLFDETRQKFPTYPEVPTFYAEILADKGDFALAIKQYDIATRLEK---AQKNI 509

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
            VG+APLVGKATVLARQP+  N  EAT L E+AC+ DPRSEQA VGLAQL LQ E+VD A
Sbjct: 510 HVGIAPLVGKATVLARQPNLLNLKEATQLMEKACEIDPRSEQAIVGLAQLKLQNEEVDLA 569

Query: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           I++FE+AADL+RT DEK+QA+TFAEAAK+QK+IRADP+I AKV+EALA YR+QG+I
Sbjct: 570 IELFEKAADLSRTMDEKIQAMTFAEAAKIQKRIRADPVISAKVDEALASYRSQGVI 625

>Smik_14.207 Chr14 complement(378339..380192) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/570 (59%), Positives = 417/570 (73%), Gaps = 32/570 (5%)

Query: 69  EKKTELATE------TPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAV 122
           +KKT+  +E      TPVYP++++G+PD S   ++T E+++ YALALKDKGN+ F+ K  
Sbjct: 56  QKKTKDGSESTAESNTPVYPVSSNGDPDFSNKANFTAEEKDRYALALKDKGNQFFRNKKY 115

Query: 123 EEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANT 182
           ++AIKYY WALE K DPVFY+N+SACYVS+ D +KV+E   KALELKPDYSKVLLRRA+ 
Sbjct: 116 DDAIKYYNWALELKDDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASA 175

Query: 183 YENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT--------- 233
            E + NFADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +          
Sbjct: 176 NEGLGNFADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTE 235

Query: 234 ---------QDKFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAAT 284
                    +DK E  LPS TSMASFFGIFKPE  F  YDE+ EAD+ L  GL  L+  +
Sbjct: 236 LSTQAPKELKDKTEN-LPSITSMASFFGIFKPELTFANYDESNEADKDLMNGLTNLYKRS 294

Query: 285 HVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQ 344
              + KAD  F +AV  + E   K +++EK      EK AI+LE++GIFKFLKND +GA 
Sbjct: 295 PESYDKADESFTKAVKLFDEQLDKNNEDEKS----KEKLAISLEHTGIFKFLKNDPLGAH 350

Query: 345 AAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFIT 404
             + +AI+LFPRVNSYIY+AL  AD  +S+EY   FDKAL+L+ N+S+ YYHRGQ+ FI 
Sbjct: 351 EDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFIL 410

Query: 405 QDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTF 464
           Q+Y +A  DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F
Sbjct: 411 QNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNF 470

Query: 465 YAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEA 524
           +AEIL DK DF  A KQYD+A  LE  +    GI VG+APLVGKAT+L R P+ ENF EA
Sbjct: 471 FAEILTDKNDFEKALKQYDLAIELENKLD---GIYVGIAPLVGKATLLTRNPTVENFIEA 527

Query: 525 TTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEA 584
           T L EEA K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEA
Sbjct: 528 TNLLEEASKLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEA 587

Query: 585 AKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           AKVQK+IR+DPI+ AK++E LA+ R QG++
Sbjct: 588 AKVQKRIRSDPILAAKIQETLAKLREQGLM 617

>Skud_14.211 Chr14 complement(388749..390602) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/563 (59%), Positives = 416/563 (73%), Gaps = 26/563 (4%)

Query: 70  KKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYY 129
           KKT   ++ PVYP++++GEPD S+  ++T E+++ YALALKDKGN+ F+ K  ++AIKYY
Sbjct: 63  KKTASESKAPVYPVSSNGEPDFSKKANFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYY 122

Query: 130 QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENF 189
            WALE K+DPVFY+N+SACYVS+ D +KV+E   KALE+KPDYSKVLLRRA+  E + NF
Sbjct: 123 NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALEIKPDYSKVLLRRASANEGLGNF 182

Query: 190 ADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT---------------- 233
           ADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +                 
Sbjct: 183 ADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDVDAATATPTELSTQPPK 242

Query: 234 --QDKFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKA 291
             +DK E  LPS TSMASFFGIFKPE  F  YDE  +AD+ L  GL  L+  +   + +A
Sbjct: 243 ERKDKQEN-LPSITSMASFFGIFKPELTFANYDEFNKADKELMDGLANLYKRSPESYDRA 301

Query: 292 DTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAI 351
           D  F +A   + E   K++++EKL     EK AI+LE++GIFKFLKND +GA   + +AI
Sbjct: 302 DESFTKAAKLFEEQLDKSNEDEKL----KEKLAISLEHTGIFKFLKNDPLGAHEDIKKAI 357

Query: 352 KLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAK 411
           +LFPRVNSYIY+AL  AD  +S+EY   FDKAL+LNPN+S+ YYHRGQ+ FI Q+Y +A 
Sbjct: 358 ELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLNPNNSSVYYHRGQMNFILQNYDQAG 417

Query: 412 ADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILAD 471
            DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F+AEIL D
Sbjct: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477

Query: 472 KGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEA 531
           K DF  A KQYD+A  LE  +     I VG+APLVGKAT+L R P+ ENF EAT L E+A
Sbjct: 478 KNDFDKALKQYDLAIELENKLDR---IYVGIAPLVGKATLLTRNPTVENFVEATNLLEKA 534

Query: 532 CKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKI 591
            K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEAAKVQ+KI
Sbjct: 535 SKLDPRSEQAKIGLAQMKLQQEDIDEAIMLFEESADLARTMEEKLQAITFAEAAKVQQKI 594

Query: 592 RADPIIRAKVEEALAEYRAQGMI 614
           R+DPI+ AK++E LA+ R QG++
Sbjct: 595 RSDPILAAKIQETLAKLREQGLM 617

>TBLA0C05530 Chr3 complement(1338666..1340498) [1833 bp, 610 aa]
           {ON} Anc_2.152 YHR117W
          Length = 610

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/534 (61%), Positives = 406/534 (76%), Gaps = 9/534 (1%)

Query: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138
           P+YP+  +GEP+L   D +T E++E Y++ALKDKGN LFK    EEAIKYY WA+E K++
Sbjct: 84  PIYPVRDNGEPNLDNKDQFTEEEKEKYSIALKDKGNSLFKADKFEEAIKYYNWAIELKEN 143

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
           P+FY+N+SACYVSLN  E++++ CNKALELKPDYSKVLLRRAN  E +EN+ADAMFDLSV
Sbjct: 144 PIFYSNLSACYVSLNKLEEIIKYCNKALELKPDYSKVLLRRANANEKLENYADAMFDLSV 203

Query: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPET 258
           LSLN D++GASIEP+LERNLNKQAM +LK++L+N++D     LPSDTS+++FFGIFKPE 
Sbjct: 204 LSLNGDYNGASIEPILERNLNKQAMSVLKDKLKNSKD---DQLPSDTSLSAFFGIFKPEL 260

Query: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318
            F+ YDET +AD+ L  GL  LF      ++ AD  F  A+    EL+ K  +E     +
Sbjct: 261 SFENYDETNDADKELLNGLTHLFKRQSESYLIADKSFMNAL----ELYIKQLEETPDDTD 316

Query: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378
           L  K +IA EY+GIF FLKND+ GA   ++++IKL PR+NSYIY AL  AD GES +Y+ 
Sbjct: 317 LKVKASIAYEYAGIFNFLKNDLSGATENIDKSIKLNPRINSYIYRALIIADKGESQDYLD 376

Query: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438
            FDKAL+L+  S A YYHR QL F+TQD+ KA  DF KAKE D  NIF YIQLACL YRE
Sbjct: 377 YFDKALKLDDKSCAVYYHRAQLNFVTQDFAKAAVDFEKAKECDPTNIFPYIQLACLTYRE 436

Query: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498
              D+C+ LF EA+ KFP  PEVP FYAE+L DKGDF +A K Y+ A+RLEEA  +K GI
Sbjct: 437 NKFDDCETLFSEAKRKFPTLPEVPNFYAEVLTDKGDFDNAMKNYETARRLEEA--SKDGI 494

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
            VGVAPL+GKAT+LAR+P+ EN A A  L EEA + DPRSEQAK+GLAQL LQ+E++D +
Sbjct: 495 HVGVAPLIGKATLLAREPTLENLAAADKLLEEANRIDPRSEQAKIGLAQLKLQKEEIDES 554

Query: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQG 612
           I++FEE+ADLART +EKLQA TFAEAAKVQK IRADPII  K+EE LA YRAQ 
Sbjct: 555 IRLFEESADLARTMEEKLQATTFAEAAKVQKMIRADPIISKKIEETLAAYRAQN 608

>KAFR0F00720 Chr6 complement(141181..143007) [1827 bp, 608 aa] {ON}
           Anc_2.152 YHR117W
          Length = 608

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/534 (60%), Positives = 410/534 (76%), Gaps = 8/534 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           +P   +GEPD + +D+ T +Q++ +A+ LKDKGNE FKEK  E A+K+Y +AL  KKDPV
Sbjct: 83  FPAKENGEPDFTGVDNLTADQKDKWAIELKDKGNEYFKEKDYENALKFYDFALILKKDPV 142

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+N+SACYVSLN+ +KV+E   KALELKPDYSK LLRRA   E +EN++DAMFDLSVLS
Sbjct: 143 FYSNMSACYVSLNELDKVIEMSTKALELKPDYSKALLRRATANEQLENYSDAMFDLSVLS 202

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260
           LNNDF+GA+IEPMLERNLNKQA+K+L ++ +N   K E  LPS+TSMASFF IF PE  F
Sbjct: 203 LNNDFNGATIEPMLERNLNKQAIKVLDQKSKNPS-KNESELPSNTSMASFFSIFTPEISF 261

Query: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320
             YDE  +AD+ L  GL EL++A    +  A++ FN+++  Y+ L     D+E +++   
Sbjct: 262 DSYDEESDADKELLNGLKELYSAKTGCYEIAESSFNKSMELYKILLESTEDKETISK--- 318

Query: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380
            KFAIALEY GIF FL+ND++ AQ   N++I   PRVNSYIYLAL SAD  E  E    F
Sbjct: 319 -KFAIALEYVGIFNFLRNDLVTAQDLFNQSISASPRVNSYIYLALISADKNEKDESNKYF 377

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           D+AL+L+PN S  YYHRGQL F+TQDY  AK DFLKAKELD +NIF YIQLACL YREGD
Sbjct: 378 DEALKLDPNCSPIYYHRGQLNFVTQDYVNAKNDFLKAKELDENNIFPYIQLACLSYREGD 437

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
            ++C+  F+ AR+KFPVAPE+PTF  EILADKGD   AAKQY+   RLE   + +  I V
Sbjct: 438 FEDCQNQFELARKKFPVAPEIPTFLGEILADKGDLDLAAKQYEFGIRLE---NTQKSIHV 494

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
           G+APL+GKAT LARQP+PENF+EA+ L ++A ++DPRSEQA VGLAQL LQ+EDVD+AI+
Sbjct: 495 GIAPLIGKATALARQPTPENFSEASKLLQDAVEKDPRSEQAIVGLAQLKLQEEDVDTAIE 554

Query: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +FE+A+D +R+ DEKLQA TFAEAAKVQK+IRADP+I+AKVEE LA+Y AQG +
Sbjct: 555 LFEKASDYSRSMDEKLQATTFAEAAKVQKRIRADPVIKAKVEETLAQYHAQGFM 608

>CAGL0L12936g Chr12 (1382623..1384425) [1803 bp, 600 aa] {ON}
           similar to uniprot|P07213 Saccharomyces cerevisiae
           YNL121c TOM70 or uniprot|P38825 Saccharomyces cerevisiae
           YHR117w TOM7
          Length = 600

 Score =  654 bits (1687), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/552 (60%), Positives = 414/552 (75%), Gaps = 19/552 (3%)

Query: 72  TELATETPVYPITASGE---PDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKY 128
           +E AT    Y +T +G+   PD++ + + + +Q++ YA ALKDKGN LFKEK  E+AI++
Sbjct: 57  SEPATSDKAY-LTINGDEEKPDMAAMLASSEDQKKVYATALKDKGNALFKEKRFEDAIEF 115

Query: 129 YQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN 188
           Y  A++  +DPVF++NISACYVSL D +KV+E+  +ALELKPDYSK LLRRA+ YENM  
Sbjct: 116 YNHAIKLHEDPVFHSNISACYVSLGDLDKVVESSTRALELKPDYSKALLRRASAYENMGR 175

Query: 189 FADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERL-------ENTQDKFEQPL 241
           + DAMFD+SVLSLN DF+G+SIEPMLERNLNKQA+++LKE +       +  Q +  Q L
Sbjct: 176 YQDAMFDISVLSLNGDFNGSSIEPMLERNLNKQALRVLKEDMGIDASVPQAEQPRERQEL 235

Query: 242 PSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQ 301
           PS+TS++SFFGIFKPETE   YDE+ EAD TL  GL  L+ AT  G+  AD CF +A   
Sbjct: 236 PSNTSLSSFFGIFKPETEIPAYDESNEADVTLVRGLKALYGATSDGYQLADECFAKAAKL 295

Query: 302 YRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYI 361
           YRE  +  +D         EK A ALEY GIF FLKND+  ++  + EA+ L PRVN+YI
Sbjct: 296 YREQLANNNDAA-----FKEKAATALEYLGIFDFLKNDLDNSEKNLKEALALHPRVNTYI 350

Query: 362 YLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELD 421
           YLALT AD G+S +Y + F+KA+ L+PN++A YYHRGQ+YFITQ+Y+KA  DF K+KE D
Sbjct: 351 YLALTMADRGQSEDYFSYFEKAIALDPNNAAVYYHRGQMYFITQNYEKAGEDFKKSKESD 410

Query: 422 NDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQ 481
             NIF YIQLACL YRE  M EC+KLF+EAR+ FP APEVP FYAEILADKGD  +A KQ
Sbjct: 411 PKNIFPYIQLACLAYRENKMAECEKLFEEARKTFPTAPEVPNFYAEILADKGDIDEAVKQ 470

Query: 482 YDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQA 541
           Y++A RLE   S +  I VG+APLVGKAT+LARQP+PENFA  + L E+ACK DPRSEQA
Sbjct: 471 YNIAYRLE---SLQKQIHVGIAPLVGKATILARQPTPENFATISQLLEDACKADPRSEQA 527

Query: 542 KVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKV 601
           KVGLAQL LQQE VD AI++FEEAA +ART DEKLQA+TFAEA KVQK+IRADP++  KV
Sbjct: 528 KVGLAQLRLQQEKVDEAIELFEEAAKMARTVDEKLQAITFAEATKVQKRIRADPVVSKKV 587

Query: 602 EEALAEYRAQGM 613
           EE LA Y+AQ M
Sbjct: 588 EETLAAYQAQNM 599

>YNL121C Chr14 complement(398684..400537) [1854 bp, 617 aa] {ON}
           TOM70Component of the TOM (translocase of outer
           membrane) complex responsible for recognition and
           initial import steps for all mitochondrially directed
           proteins; acts as a receptor for incoming precursor
           proteins
          Length = 617

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/562 (58%), Positives = 409/562 (72%), Gaps = 24/562 (4%)

Query: 70  KKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYY 129
           KK+   +  P+YP++++GEPD S   ++T E+++ YALALKDKGN+ F+ K  ++AIKYY
Sbjct: 63  KKSTAPSNPPIYPVSSNGEPDFSNKANFTAEEKDKYALALKDKGNQFFRNKKYDDAIKYY 122

Query: 130 QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENF 189
            WALE K+DPVFY+N+SACYVS+ D +KV+E   KALELKPDYSKVLLRRA+  E +  F
Sbjct: 123 NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKF 182

Query: 190 ADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQP--------- 240
           ADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +       P         
Sbjct: 183 ADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSKLKEKFGDIDTATATPTELSTQPAK 242

Query: 241 --------LPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKAD 292
                   LPS TSMASFFGIFKPE  F  YDE+ EAD+ L  GL  L+  +   + KAD
Sbjct: 243 ERKDKQENLPSVTSMASFFGIFKPELTFANYDESNEADKELMNGLSNLYKRSPESYDKAD 302

Query: 293 TCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIK 352
             F +A   + E   K +++EKL     EK AI+LE++GIFKFLKND +GA   + +AI+
Sbjct: 303 ESFTKAARLFEEQLDKNNEDEKL----KEKLAISLEHTGIFKFLKNDPLGAHEDIKKAIE 358

Query: 353 LFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKA 412
           LFPRVNSYIY+AL  AD  +S+EY   FDKAL+L+ N+S+ YYHRGQ+ FI Q+Y +A  
Sbjct: 359 LFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRGQMNFILQNYDQAGK 418

Query: 413 DFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADK 472
           DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F+AEIL DK
Sbjct: 419 DFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTDK 478

Query: 473 GDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEAC 532
            DF  A KQYD+A  LE  +    GI VG+APLVGKAT+L R P+ ENF EAT L E+A 
Sbjct: 479 NDFDKALKQYDLAIELENKLD---GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKAS 535

Query: 533 KRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIR 592
           K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEAAKVQ++IR
Sbjct: 536 KLDPRSEQAKIGLAQMKLQQEDIDEAITLFEESADLARTMEEKLQAITFAEAAKVQQRIR 595

Query: 593 ADPIIRAKVEEALAEYRAQGMI 614
           +DP++  K++E LA+ R QG++
Sbjct: 596 SDPVLAKKIQETLAKLREQGLM 617

>Suva_14.219 Chr14 complement(395316..397169) [1854 bp, 617 aa] {ON}
           YNL121C (REAL)
          Length = 617

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/563 (58%), Positives = 413/563 (73%), Gaps = 26/563 (4%)

Query: 70  KKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYY 129
           KK+   ++ P+YP+ A+GEPD S+   +T E+++ YALALKDKGN+ F+ K  ++AIKYY
Sbjct: 63  KKSAGESKPPIYPVAANGEPDFSKKADFTAEEKDKYALALKDKGNQYFRNKKYDDAIKYY 122

Query: 130 QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENF 189
            WALE K+DPVFY+N+SACYVS+ D +KV+E   KALELKPDYSKVLLRRA+  E + NF
Sbjct: 123 NWALELKEDPVFYSNLSACYVSVGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGNF 182

Query: 190 ADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT---------------- 233
           ADAMFDLSVLSLN DF+ ASIEPMLERNLNKQAM  LKE+  +                 
Sbjct: 183 ADAMFDLSVLSLNGDFNDASIEPMLERNLNKQAMSRLKEKFGDIDAATATPTELSTQPPK 242

Query: 234 --QDKFEQPLPSDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKA 291
             +DK ++ LPS TSMASFFGIFKPE  F   DE+ EAD+ L  GL  L+  +   + +A
Sbjct: 243 ERKDK-QESLPSVTSMASFFGIFKPELTFANCDESNEADKELMNGLANLYKRSPDSYDRA 301

Query: 292 DTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAI 351
           D  F +AV  + +   K +++EK+     EK AI+LE++GIFKFLKND +GA   + +AI
Sbjct: 302 DESFTKAVKLFEDQLDKDNEDEKV----KEKLAISLEHTGIFKFLKNDPLGAHEDITKAI 357

Query: 352 KLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAK 411
            LFPRVNSYIY+AL  AD  +S+EY   FDKAL+L+ N+S+ YYHRGQ+ FI Q+Y +A 
Sbjct: 358 DLFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDLNNSSVYYHRGQMNFILQNYDQAG 417

Query: 412 ADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILAD 471
            DF KAKELD +NIF YIQLACL YRE   D+C+ LF EA+ KFP APEVP F+AEIL D
Sbjct: 418 KDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPNFFAEILTD 477

Query: 472 KGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEA 531
           K DF  A KQYD+A  LE  +    GI VG+APLVGKAT+L R P+ ENF EAT L E+A
Sbjct: 478 KNDFDKALKQYDLAIELENKLE---GIYVGIAPLVGKATLLTRNPTVENFIEATNLLEKA 534

Query: 532 CKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKI 591
            K DPRSEQAK+GLAQ+ LQQED+D AI +FEE+ADLART +EKLQA+TFAEAAKVQ++I
Sbjct: 535 SKLDPRSEQAKIGLAQMKLQQEDIDEAIALFEESADLARTMEEKLQAITFAEAAKVQQRI 594

Query: 592 RADPIIRAKVEEALAEYRAQGMI 614
           R+DP++  K++E LA+ R QG++
Sbjct: 595 RSDPVLATKIQETLAKLREQGLM 617

>TPHA0I01510 Chr9 complement(342661..344472) [1812 bp, 603 aa] {ON}
           Anc_2.152 YHR117W
          Length = 603

 Score =  647 bits (1670), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/612 (53%), Positives = 427/612 (69%), Gaps = 10/612 (1%)

Query: 3   TASDNSVAAFFARNKRAILXXXXXXXXXXXXXXXXXXXXXXLDRDXXXXXXXXXXXXXXX 62
           +ASD SV  F ARNK AI+                      +D                 
Sbjct: 2   SASDGSVGGFIARNKTAIIATVAAGSAALGAYYYYTQLQRQIDDSSSSKKKKKKHSKKKK 61

Query: 63  XXXXXQEKKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAV 122
                ++  ++  T   +YP+ ++GEPDLS  DS++ E +E YA+ALKDKGN+ FK++  
Sbjct: 62  STSTDEKSNSKNETAKVIYPVASNGEPDLSGKDSFSDELKEKYAMALKDKGNDYFKKQDF 121

Query: 123 EEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANT 182
           E A+KYY +AL  K+DPVFY+NISACYVSL   EKV+E+  +AL+LK DYSK LLRRA+ 
Sbjct: 122 ENALKYYNYALTLKQDPVFYSNISACYVSLGQLEKVVESSTEALKLKHDYSKALLRRASA 181

Query: 183 YENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLP 242
           YE++ N+ DAM DLSVLSLN DF+GASIEPMLERNLNKQAM++LKE++   +    Q LP
Sbjct: 182 YESLANYVDAMVDLSVLSLNGDFNGASIEPMLERNLNKQAMQVLKEKIAENK---PQLLP 238

Query: 243 SDTSMASFFGIFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQY 302
           S+TS+ASFFG+FKPE     ++E  E+++ L  GL  L++ T+ G++ AD  F +AV   
Sbjct: 239 SNTSLASFFGVFKPEVSLNNFNENSESEKELLNGLTNLYSRTNDGYLVADESFQKAV--- 295

Query: 303 RELFSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIY 362
            +L  K  +E K   ++ EK+AIALEY+GI KFLKND + A   + +AI +FPRVNSYIY
Sbjct: 296 -KLLEKEYEENKENNDIKEKYAIALEYNGILKFLKNDPLDAHNDIQKAIFIFPRVNSYIY 354

Query: 363 LALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDN 422
            +L  AD GE+ E + NFD A+ L+  ++ATYYHRGQLYF+TQ Y+KA  DF KAKELD 
Sbjct: 355 NSLILADKGETEESIKNFDAAINLDATNAATYYHRGQLYFLTQQYEKAGIDFDKAKELDE 414

Query: 423 DNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQY 482
            NI  YIQLACL Y+E   ++C+ LF EAR KFP APEVP FYA++L ++ +F  A KQY
Sbjct: 415 SNILPYIQLACLAYKENKFNDCETLFSEARRKFPTAPEVPNFYADVLLERNEFDKALKQY 474

Query: 483 DMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAK 542
           D++K+LEEA+    GI VG+AP++GKAT+LAR P  EN  E+T LFEEACK DPRSEQAK
Sbjct: 475 DISKKLEEAVE---GIHVGIAPMIGKATLLARNPIVENLLESTELFEEACKLDPRSEQAK 531

Query: 543 VGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVE 602
           +GLAQL LQQE+VD AI +FEEAA LAR  DEKLQA TFAEA+KVQKK+R+DP+I  K++
Sbjct: 532 IGLAQLKLQQEEVDEAIALFEEAAFLARNMDEKLQATTFAEASKVQKKVRSDPVINQKIQ 591

Query: 603 EALAEYRAQGMI 614
           E LA Y+ QG++
Sbjct: 592 ETLAAYQQQGLM 603

>Ecym_8204 Chr8 complement(419900..421693) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii ABR131W
          Length = 597

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/534 (60%), Positives = 393/534 (73%), Gaps = 10/534 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           YP+ ++GEPDLS +DS+T EQ+E Y++A+KDKGNE FKEK  EEAIKYY  AL  KKDPV
Sbjct: 73  YPVDSNGEPDLSGVDSFTEEQKERYSMAMKDKGNECFKEKKYEEAIKYYSCALRLKKDPV 132

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+N SAC+V LN  EKV+E+   ALELKPDYSK LLRRA   E++ NFADAM DLS +S
Sbjct: 133 FYSNRSACWVPLNKLEKVVEDTTAALELKPDYSKCLLRRATANESLGNFADAMLDLSAVS 192

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260
           L   ++  SIEP+LERN+NKQAM++LK +L    D  +  LPS+TS+ASFFGIF  ET F
Sbjct: 193 LYGGYNSQSIEPVLERNMNKQAMQVLKRKL---ADGSKHQLPSNTSLASFFGIFPSETSF 249

Query: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320
             YDE  EAD  L  GL  L       +  +D  FN+A +      S  +D E  A  L 
Sbjct: 250 ANYDEQSEADNFLLKGLRCLSERKTGSYEMSDEYFNKAADLLS--LSHQADSEDPA--LR 305

Query: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380
            K AIALE+ GIFKFLKN+ + A   + +A+ L PR NSYIY+AL  AD G++ EY+  F
Sbjct: 306 MKLAIALEHVGIFKFLKNEPLEAYKLLQKAVDLHPRPNSYIYMALIMADKGQTDEYLQYF 365

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           DKALEL PNSSA YYHRGQ+YF+TQ ++K+  DF KAKE + DNIF YIQLACL YRE  
Sbjct: 366 DKALELAPNSSAVYYHRGQMYFVTQQFEKSGKDFDKAKECNPDNIFPYIQLACLAYRENK 425

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
            ++C+ LF EAR KFP APEVP FYAEIL+DKGD   A K+Y+ A++LE+   A+ GI V
Sbjct: 426 FEDCETLFSEARRKFPTAPEVPNFYAEILSDKGDLESALKEYEFARKLED---AQEGIHV 482

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
           GVAPLVGKATVLARQ    +FAEAT LFEEACK+DPRSEQAK+GLAQL LQQE VD AI+
Sbjct: 483 GVAPLVGKATVLARQSHSGDFAEATALFEEACKKDPRSEQAKIGLAQLKLQQEQVDEAIQ 542

Query: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +FEEA DLAR  +EKLQA TFAEAAK+QK+IRADPI+ AK++E L  YR QG++
Sbjct: 543 LFEEATDLARAFEEKLQATTFAEAAKIQKRIRADPIMSAKIQETLEAYRVQGVV 596

>KLLA0F24046g Chr6 (2240454..2242268) [1815 bp, 604 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121C TOM70
           Translocase of Outer Mitochondrial membrane 70 kDa
           mitochondrial specialized import receptor of the outer
           membrane
          Length = 604

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/534 (58%), Positives = 399/534 (74%), Gaps = 8/534 (1%)

Query: 80  VYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP 139
           VYP+ A+G+PDLS+ D +TPEQ + YALALKDKGNE FK K  E+AI+YY  A+  K+DP
Sbjct: 78  VYPVDANGQPDLSKKDEFTPEQVDKYALALKDKGNEFFKAKDFEKAIEYYTLAISLKEDP 137

Query: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           VFY+N SA YVS+N+FEKV+E+   AL+LKPDYSK  LRRA+ YEN+  F+DAMFDLS +
Sbjct: 138 VFYSNRSAAYVSINNFEKVVEDTTAALKLKPDYSKCWLRRASAYENLGQFSDAMFDLSAV 197

Query: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETE 259
           SL  ++SG S+E +LERN+NKQA K+L E+L+  Q K E PLPS+TS+ASFFGIF PET 
Sbjct: 198 SLLGEYSGQSVEQLLERNMNKQATKVLGEKLKENQGK-ESPLPSNTSLASFFGIFNPETS 256

Query: 260 FKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNL 319
           F  YD   EAD  L+ GL  L+      +  AD  F +A   Y++    + D E    +L
Sbjct: 257 FDDYDGENEADVELKKGLENLYKCQTGCYELADEEFTKAAELYKKELESSPDNE----SL 312

Query: 320 NEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTN 379
            +K AIA E+ GIFKF KND I A   + E++ L PR ++YIY+AL  AD GE+++Y   
Sbjct: 313 KKKAAIAFEHVGIFKFFKNDPITAHINLEESLSLNPRPSTYIYMALIMADKGEANQYKEY 372

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           FDKALEL+PN SA YYHRGQ++F+ +++++A ADF KAKEL+ +NIFAYIQ ACL +R+ 
Sbjct: 373 FDKALELDPNCSAVYYHRGQMHFVVENFKEAGADFDKAKELNPENIFAYIQCACLAFRDD 432

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIR 499
             D+C+ LF EAR KFP APEVP FYAEILA K     A KQYD+A +LE+A+    GI 
Sbjct: 433 RFDDCETLFSEARRKFPTAPEVPNFYAEILAAKNSLDAAIKQYDIAIKLEDAL---PGIH 489

Query: 500 VGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAI 559
           VG+AP++GKAT L R P+ ENF EA+ LFEEACK DPRSEQAK+GLAQL LQQE++D AI
Sbjct: 490 VGIAPMIGKATALIRNPTVENFVEASELFEEACKIDPRSEQAKIGLAQLKLQQEEIDDAI 549

Query: 560 KMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGM 613
           ++FE+AADL+R+ DEKLQA TFAEA KVQKKIRADP I+ K++EA+A YRAQG+
Sbjct: 550 QLFEDAADLSRSFDEKLQATTFAEATKVQKKIRADPFIKGKIDEAIAAYRAQGL 603

>ABR131W Chr2 (641631..643415) [1785 bp, 594 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL121C (TOM70) and
           YHR117W (TOM71)
          Length = 594

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/534 (58%), Positives = 392/534 (73%), Gaps = 10/534 (1%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV 140
           YP+  +GEPDLS + ++T EQ+E YA+ALKDKGNE FK++  EEAIK+Y  AL+ K+DPV
Sbjct: 70  YPVDQNGEPDLSGMATFTEEQKEKYAMALKDKGNECFKDQRYEEAIKFYDCALKLKEDPV 129

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLS 200
           FY+N SACYV LN  EKV+E+   AL+LKPDYSK LLRRA   E++ N+ADAM DLS +S
Sbjct: 130 FYSNRSACYVPLNKLEKVVEDTTAALKLKPDYSKCLLRRATANESLGNYADAMLDLSAVS 189

Query: 201 LNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEF 260
           L   +S  +IEP+LERN+NKQAM++LK++L   +   +  LPS+TS+ASFF IF  ET  
Sbjct: 190 LYGGYSSQTIEPVLERNMNKQAMQVLKQKLSGGE---KHELPSNTSLASFFRIFPSETSL 246

Query: 261 KGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLN 320
           + YDET EADR L  GL  L A     +  AD  F +AV    E F+ A +       L 
Sbjct: 247 ENYDETSEADRILLKGLCALHARQAGSYEIADEAFTDAV----EKFTAAHEANPDNAALK 302

Query: 321 EKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNF 380
           +K AIALE+ GI KFLKN+ + A   + +AI LFPR NSYIY+ L  AD G++ EY  NF
Sbjct: 303 QKLAIALEHVGILKFLKNEPLEAHNLLQKAIDLFPRPNSYIYMGLIMADKGQADEYAQNF 362

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           +KALEL+P SSA YYHR Q+ F+ Q + +A  DF KAKE D   ++ YIQLACL YRE  
Sbjct: 363 EKALELDPKSSAAYYHRAQMNFVIQQFDQAGKDFDKAKECDPSRVYPYIQLACLAYREKK 422

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
            D+C+ LF EAR +FP APEVP FYAEIL+DKGDF +A K+YD A++LE+   A+ GI V
Sbjct: 423 FDDCETLFSEARRRFPTAPEVPNFYAEILSDKGDFENALKEYDFARKLED---AQEGIHV 479

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
           GVAPLVGKA +LARQPS  NFAEAT LFE AC++DPRSEQAK+GLAQL LQQE+VD AIK
Sbjct: 480 GVAPLVGKAALLARQPSASNFAEATKLFELACEKDPRSEQAKIGLAQLKLQQEEVDEAIK 539

Query: 561 MFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +FE AADL+R  +EKLQA TFAEAAK+QK+IRADP++ AK++E L  YRAQGM+
Sbjct: 540 LFEAAADLSRAFEEKLQATTFAEAAKIQKRIRADPVMSAKIQETLDAYRAQGMV 593

>NCAS0G02480 Chr7 complement(440105..441895) [1791 bp, 596 aa] {ON}
           Anc_2.152
          Length = 596

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/532 (58%), Positives = 388/532 (72%), Gaps = 9/532 (1%)

Query: 79  PVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD 138
           P+YPI A+GEP L  +D    + +E +A ALK+KGN LFK+K  E AIKYY +AL  K+D
Sbjct: 68  PIYPIDANGEPVLGDVDLLNDKTKEEWAGALKEKGNALFKKKDFENAIKYYTFALSLKED 127

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
           PV+Y+NISACY SL ++EKV+E   KAL L+PDYSKVL+RRAN YE + NF DAMFDLSV
Sbjct: 128 PVYYSNISACYSSLLNYEKVIEMATKALALRPDYSKVLVRRANAYEKLGNFGDAMFDLSV 187

Query: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPET 258
            SLN D S ASIEP+LERNLN+QAM +L  +L  T  K +  LPS+T++ SFFGIFKPE 
Sbjct: 188 CSLNTDMSDASIEPILERNLNQQAMFVLNTKLGVTDKKSQ--LPSNTALTSFFGIFKPEL 245

Query: 259 EFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQN 318
            F  YD+TCE D+ L  GL  L+  T  G+  AD  F +A   + +  S+  D+E     
Sbjct: 246 SFANYDDTCEGDKELLNGLKNLYRCTAEGYETADLSFTKATEYFLKQLSETPDDE----T 301

Query: 319 LNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVT 378
           + EK AIALE+ GIFKFLKN+ + A   + +A++L PR+NSYIY+AL  AD G++  Y  
Sbjct: 302 VKEKTAIALEHQGIFKFLKNNPLEAHEDIKKALELHPRINSYIYMALILADKGDTDNYFA 361

Query: 379 NFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYRE 438
           N++KA++L+  ++A YYHRGQ+YFITQ Y+KA  DF KAKELD +NIF YIQLACL YRE
Sbjct: 362 NYEKAMKLDDKNAALYYHRGQMYFITQQYEKAGEDFDKAKELDPENIFPYIQLACLSYRE 421

Query: 439 GDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGI 498
              D+C+ LF EAR KFP + EVP FYAEILADKGDF  A K+Y+ A  LE+   A   +
Sbjct: 422 NKFDDCETLFSEARRKFPNSSEVPNFYAEILADKGDFDAALKEYERAIELEKKQDA---V 478

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
            VG+APLVGKAT+L R P+ ENF EAT+L EEA K DPRSEQAK+ L QL LQQED+D A
Sbjct: 479 HVGIAPLVGKATLLVRTPTVENFVEATSLLEEAVKEDPRSEQAKISLGQLKLQQEDIDEA 538

Query: 559 IKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRA 610
           I++FE AA LART +EKLQA TFAEAAK+QK+IRADP + AK++E +A  RA
Sbjct: 539 IELFESAATLARTFEEKLQATTFAEAAKIQKRIRADPKMSAKIQETIAALRA 590

>NDAI0F02810 Chr6 (690977..692806) [1830 bp, 609 aa] {ON} Anc_2.152
           YHR117W
          Length = 609

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/538 (56%), Positives = 390/538 (72%), Gaps = 13/538 (2%)

Query: 76  TETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF 135
           T+ P+Y + ++GEP+LS +DS T E +  +A+ALKDKGNELFK    E+AIKYY +AL+ 
Sbjct: 80  TKKPIYLVDSNGEPNLSDIDSLTEETKNEWAMALKDKGNELFKTSKFEDAIKYYHYALKL 139

Query: 136 KKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195
           K DP++Y+NISACY SL  +EKV+E   KAL+L+P +SKVL+RRA  YE M NF DAMFD
Sbjct: 140 KDDPIYYSNISACYASLLQYEKVIEYATKALKLRPTFSKVLMRRALAYEAMGNFGDAMFD 199

Query: 196 LSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFK 255
           +S  SLN D + ASIEP+LER LNKQA  +LKE++   +   EQ LPS T +ASFF +FK
Sbjct: 200 ISACSLNGDMNDASIEPILERILNKQAEFVLKEKISANK---EQNLPSSTPLASFFRVFK 256

Query: 256 PETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKL 315
           PET F  Y+E+ EADR L  GL  L+  +  GF  AD  F +A   +++  S+  D E +
Sbjct: 257 PETSFANYEESNEADRELMNGLTNLYKNSEEGFQIADKSFLKAAELFKDQLSQNKDNEAI 316

Query: 316 AQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE 375
                EK AIALEYSGI  ++KN+ + A  ++  AI+L PRVNSYIY +L  +D+  +SE
Sbjct: 317 ----KEKTAIALEYSGILYYMKNETLKAHDSIKSAIELHPRVNSYIYQSLIGSDSTTTSE 372

Query: 376 YVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLC 435
           Y+ NFDKALEL PN+ A YYHRGQ YFI Q Y+KA  DF K KELD +NIFAYIQLACL 
Sbjct: 373 YLQNFDKALELEPNNPAIYYHRGQSYFIAQQYEKAGKDFDKVKELDENNIFAYIQLACLA 432

Query: 436 YREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAK 495
           YRE   D+C+ LF EAR KFP APEVP F+AE+LAD+G+   A K++D A  LE    AK
Sbjct: 433 YRESKFDDCETLFSEARRKFPTAPEVPNFFAEVLADRGESEKAMKEFDKAIELE----AK 488

Query: 496 TG--IRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQE 553
           T   I VG+APL+GKAT+L  +P+ ENF E   L +EAC +DPRSEQA++GLAQL LQQE
Sbjct: 489 TPEEIHVGIAPLIGKATLLISKPTVENFVEGIQLLQEACDKDPRSEQARLGLAQLKLQQE 548

Query: 554 DVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQ 611
           D+D AI++FEEAA+LA++ +EKLQA TFAEAAK+QK+IRADP + AK+ + + + R+Q
Sbjct: 549 DIDEAIQLFEEAAELAKSYEEKLQATTFAEAAKIQKRIRADPAMDAKIRQTIEQMRSQ 606

>Suva_15.314 Chr15 (544646..546580) [1935 bp, 644 aa] {ON} YHR117W
           (REAL)
          Length = 644

 Score =  590 bits (1520), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/546 (55%), Positives = 386/546 (70%), Gaps = 19/546 (3%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139
           YP+   GEPD+ +L   +  QR+ +A+ LKDKGN  F  K+  +AIKYYQ+A+E    DP
Sbjct: 106 YPLLPHGEPDMDRLRGLSAPQRQAFAVQLKDKGNHFFTAKSFGDAIKYYQYAIELDPNDP 165

Query: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           VFY+NISACY+S  D +KV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 166 VFYSNISACYISTGDLDKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 225

Query: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERL-ENTQDKFEQPLPSDTSMASFFGIFKPET 258
           SLN DF G SIEPMLERNLNKQAMK+L E L +N  DK  Q LPS+TS+ASFFGIF P+ 
Sbjct: 226 SLNGDFDGTSIEPMLERNLNKQAMKVLNESLLKNGDDKSSQILPSNTSLASFFGIFDPDL 285

Query: 259 EFKGYDETC---EADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKL 315
           E    +       A  TL   L  L++AT  G++ AD    +A ++Y  L  +A+ E+++
Sbjct: 286 ETSRVNTGSLLDSASATLSEALQSLYSATSEGYLIADDLLTKATDEYHSLL-RANKEDRV 344

Query: 316 AQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSE 375
              + E  A+A  Y+GIF+FLKND++ AQA + E+I L P  NSY+++ALT AD   S E
Sbjct: 345 ---IRENAALAFCYAGIFQFLKNDLLDAQALLQESINLHPTPNSYVFMALTVADKENSQE 401

Query: 376 YVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLC 435
           +   F  A++L+P    TYYHRGQ+YFI QDY  AK+DF KA+ L+  N++ YIQLACL 
Sbjct: 402 FFKFFQNAIDLDPEYPPTYYHRGQMYFILQDYINAKSDFQKAQSLNPGNVYPYIQLACLL 461

Query: 436 YREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAK 495
           Y++    E + LF+EA+ KFP+ PEVPTFYAEIL DKGDF+ A KQYD+AKRLEE    +
Sbjct: 462 YKQDKFSEAESLFNEAKLKFPILPEVPTFYAEILTDKGDFNPAIKQYDIAKRLEE---VQ 518

Query: 496 TGIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQL 548
             I VG+ PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL
Sbjct: 519 KKIHVGIGPLIGKATILARQSSQDPTQLDEEKFNMAIELLTKACELDPRSEQAKIGLAQL 578

Query: 549 LLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEY 608
            LQ E +D AIK+F+E+A LART DEKLQA TFAEAAK+QK++RADPII AK+E+ LA Y
Sbjct: 579 ELQMEKIDVAIKLFQESATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLANY 638

Query: 609 RAQGMI 614
           RAQGMI
Sbjct: 639 RAQGMI 644

>Smik_8.195 Chr8 (318688..320595) [1908 bp, 635 aa] {ON} YHR117W
           (REAL)
          Length = 635

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/540 (56%), Positives = 373/540 (69%), Gaps = 19/540 (3%)

Query: 86  SGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYAN 144
           +GEPD+SQL   T  Q++TYA+ LK+KGN  F  K   EAIKYYQ A+E    DPVFY+N
Sbjct: 104 NGEPDISQLKGLTLSQKQTYAVQLKNKGNHFFTTKNFTEAIKYYQCAIELDPNDPVFYSN 163

Query: 145 ISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNND 204
           ISACY+S  D  KVLE   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVLSLN D
Sbjct: 164 ISACYISTGDLNKVLEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVLSLNGD 223

Query: 205 FSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEFKGYD 264
           F GASIEPMLERNLNKQAMK+L E L     +  Q LPS+TS+ SFFGIF P+ E    +
Sbjct: 224 FDGASIEPMLERNLNKQAMKVLNENLSKGDGRGSQLLPSNTSLTSFFGIFDPDLEISRVN 283

Query: 265 ETCEADRT---LQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNE 321
            +   D     L   L +L++AT+ G++ AD  F  A + Y  L +   D       L E
Sbjct: 284 NSSHFDTAYALLSDALQKLYSATNEGYLTADKLFTSATDAYHSLLASQVDGP-----LKE 338

Query: 322 KFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFD 381
             A+A  Y+GIF FLKN+++GAQA + E+I L P  NSYI+LALT AD   S E+   F 
Sbjct: 339 NAALAFCYTGIFHFLKNNLLGAQALLQESINLHPTPNSYIFLALTLADKENSQEFFKYFQ 398

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           KA++L+     TYYHRGQ+YFI QDY  AKADF KA+ L  +NI+ YIQLACL Y++G  
Sbjct: 399 KAIDLDSEYPPTYYHRGQMYFILQDYVNAKADFQKAQNLYPENIYPYIQLACLLYKQGKF 458

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVG 501
            E + LF+E + KFP  PEVP F+AEIL DKGDFS A KQYD+AKRLEE    +  I VG
Sbjct: 459 TESEALFNETKLKFPTLPEVPAFFAEILTDKGDFSTAIKQYDIAKRLEE---VQEKIHVG 515

Query: 502 VAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQED 554
           + PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL LQ E 
Sbjct: 516 IGPLIGKATILARQSSQDPTQLDEEKFNTAIALLTKACELDPRSEQAKIGLAQLKLQMEK 575

Query: 555 VDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQGMI 614
           +D AI++F+++A LART DEKLQA TFAEAAK+QK++RADPII AK+E  LA YRA+GMI
Sbjct: 576 IDDAIELFQDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEMTLASYRAKGMI 635

>Skud_8.178 Chr8 (316128..318044) [1917 bp, 638 aa] {ON} YHR117W
           (REAL)
          Length = 638

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/547 (55%), Positives = 381/547 (69%), Gaps = 21/547 (3%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139
           YP+ + GEPD++QL      QR+ YA+ LKDKGN  F  K  ++AIKYYQ A+E    DP
Sbjct: 100 YPLLSDGEPDMAQLRGLPLSQRQEYAVQLKDKGNHFFTSKNFDDAIKYYQHAIELDPNDP 159

Query: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           VFY+N+SACY+S  D  KV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 160 VFYSNMSACYISTGDLNKVVEYTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 219

Query: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERL-ENTQDKFEQPLPSDTSMASFFGIFKPET 258
           SLN DF GASIEPMLERNLNKQAMK+L   L +N+ D+  + LPS+TS+ASFFGIF P+ 
Sbjct: 220 SLNGDFDGASIEPMLERNLNKQAMKVLNANLSKNSGDRGSEILPSNTSLASFFGIFDPDL 279

Query: 259 EFKGYDETCEADRTLQTGLLE----LFAATHVGFVKADTCFNEAVNQYRELFSKASDEEK 314
           E          D T    LLE    L++AT  G++ A+  F +A + Y  L S +  +  
Sbjct: 280 EISRVSSISPPD-TAHDMLLEALQRLYSATSEGYLIANALFTKATDAYHSLLSASRVDGA 338

Query: 315 LAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESS 374
           +  N     A+A  Y GIF+FLKND++ AQA + E+I L P  NSYI++ALT AD   S 
Sbjct: 339 IRGNA----ALAFCYKGIFQFLKNDLLDAQALLQESINLHPTPNSYIFMALTLADKENSQ 394

Query: 375 EYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACL 434
           E+ + F KA++L+P  S TYYHRGQ+YFI QDY  AK DF KA+ L+  NI+ YIQLACL
Sbjct: 395 EFFSFFQKAIDLDPEYSPTYYHRGQMYFILQDYVNAKMDFQKAQSLNPGNIYPYIQLACL 454

Query: 435 CYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISA 494
            Y++G   E +KLF+E + KFP  PEVPTF+AEIL DKGD++ A KQYD+AKRL+E    
Sbjct: 455 LYKQGKFSESEKLFNETKLKFPTLPEVPTFFAEILTDKGDYNTAIKQYDIAKRLQE---V 511

Query: 495 KTGIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQ 547
           +  I VG+ PL+GKAT+LARQ +        E F  A  L  EAC  DPRSEQAK+GLAQ
Sbjct: 512 QRKIHVGIGPLIGKATILARQSTQDPTQLDEEKFNMAIELLTEACDLDPRSEQAKIGLAQ 571

Query: 548 LLLQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAE 607
           L LQ E +D AI++F+++A LART DEKLQA TFAEAAK+QK++RADPII AK+E+ LA 
Sbjct: 572 LKLQMEKIDDAIELFQDSATLARTMDEKLQATTFAEAAKIQKRLRADPIISAKMEQTLAS 631

Query: 608 YRAQGMI 614
           YRA GMI
Sbjct: 632 YRANGMI 638

>YHR117W Chr8 (342349..344268) [1920 bp, 639 aa] {ON}
           TOM71Mitochondrial outer membrane protein with
           similarity to Tom70p; probable minor component of the
           TOM (translocase of outer membrane) complex responsible
           for recognition and import of mitochondrially directed
           proteins
          Length = 639

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/545 (54%), Positives = 378/545 (69%), Gaps = 18/545 (3%)

Query: 81  YPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDP 139
           YP   +GEPD++QL   +P QR+ YA+ LK++GN  F  K   EAIKYYQ+A+E    +P
Sbjct: 102 YPSLPNGEPDIAQLKGLSPSQRQAYAVQLKNRGNHFFTAKNFNEAIKYYQYAIELDPNEP 161

Query: 140 VFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           VFY+NISACY+S  D EKV+E   KALE+KPD+SK LLRRA+  E++ NF DAMFDLSVL
Sbjct: 162 VFYSNISACYISTGDLEKVIEFTTKALEIKPDHSKALLRRASANESLGNFTDAMFDLSVL 221

Query: 200 SLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETE 259
           SLN DF GASIEPMLERNLNKQAMK+L E L   + +  Q LPS+TS+ASFFGIF    E
Sbjct: 222 SLNGDFDGASIEPMLERNLNKQAMKVLNENLSKDEGRGSQVLPSNTSLASFFGIFDSHLE 281

Query: 260 FKGYDETCEADRT---LQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLA 316
               + +   D     L   L  L++AT  G++ A+    ++ + Y  L S  + ++ L 
Sbjct: 282 VSSVNTSSNYDTAYALLSDALQRLYSATDEGYLVANDLLTKSTDMYHSLLSANTVDDPLR 341

Query: 317 QNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEY 376
           +N     A+AL Y+GIF FLKN+++ AQ  + E+I L P  NSYI+LALT AD   S E+
Sbjct: 342 ENA----ALALCYTGIFHFLKNNLLDAQVLLQESINLHPTPNSYIFLALTLADKENSQEF 397

Query: 377 VTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCY 436
              F KA++LNP    TYYHRGQ+YFI QDY+ AK DF KA+ L+ +N++ YIQLACL Y
Sbjct: 398 FKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLY 457

Query: 437 REGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKT 496
           ++G   E +  F+E + KFP  PEVPTF+AEIL D+GDF  A KQYD+AKRLEE    + 
Sbjct: 458 KQGKFTESEAFFNETKLKFPTLPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEE---VQE 514

Query: 497 GIRVGVAPLVGKATVLARQPSP-------ENFAEATTLFEEACKRDPRSEQAKVGLAQLL 549
            I VG+ PL+GKAT+LARQ S        E F  A  L  +AC+ DPRSEQAK+GLAQL 
Sbjct: 515 KIHVGIGPLIGKATILARQSSQDPTQLDEEKFNAAIKLLTKACELDPRSEQAKIGLAQLK 574

Query: 550 LQQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYR 609
           LQ E +D AI++FE++A LART DEKLQA TFAEAAK+QK++RADPII AK+E  LA YR
Sbjct: 575 LQMEKIDEAIELFEDSAILARTMDEKLQATTFAEAAKIQKRLRADPIISAKMELTLARYR 634

Query: 610 AQGMI 614
           A+GM+
Sbjct: 635 AKGML 639

>CAGL0L04048g Chr12 (476407..478170) [1764 bp, 587 aa] {ON} similar
           to uniprot|P07213 Saccharomyces cerevisiae YNL121c TOM70
           or uniprot|P38825 Saccharomyces cerevisiae YHR117w TOM7
          Length = 587

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/525 (53%), Positives = 361/525 (68%), Gaps = 9/525 (1%)

Query: 88  EPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISA 147
           EPD+  +      ++  YA  LK +GN  FK K  E AI YY++AL+ K DPVFY+N++A
Sbjct: 68  EPDIELMKLAETAEKNEYASELKKRGNAYFKVKDYENAINYYKFALQLKNDPVFYSNMAA 127

Query: 148 CYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSG 207
           CY+SL   ++ +E C+KALEL PDYSKVLL+RA  YEN+  FADA+ DL+ +SLN D++ 
Sbjct: 128 CYISLEHNKEAIEACSKALELNPDYSKVLLKRAAVYENIGKFADALLDLTAVSLNGDYND 187

Query: 208 ASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFGIFKPETEFKGYDETC 267
           A+I+P++ER LNKQAM  LK+ LE ++    + LPS TSMA+FFG+F  ET+  G+D T 
Sbjct: 188 ATIQPIVERVLNKQAMMALKDHLEASEKN--KVLPSYTSMAAFFGVFDAETDIPGHDATE 245

Query: 268 EADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRELFSKASDEEKLAQNLNEKFAIAL 327
           E+D+ L   L  L++ T  G+ + D+ F +A     EL+    + ++     NEK AIA 
Sbjct: 246 ESDKILSDALTHLYSQTKEGYDRCDSEFTKAT----ELYKAKLENDRTNSVTNEKAAIAF 301

Query: 328 EYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALELN 387
           E++ I  FLKND + A+  V+EAIKL PR  SYIYL L  AD G   EY +NF KA++L+
Sbjct: 302 EHTAILSFLKNDPLTARELVDEAIKLHPRPKSYIYLGLLMADKGLDEEYYSNFQKAIDLD 361

Query: 388 PNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447
           PN +A YYHRGQ+ FI Q Y+KA  DF KAKE D  NIF YIQLAC+ YREG  D+C+ L
Sbjct: 362 PNMAAIYYHRGQMNFIIQKYEKAGEDFDKAKECDPTNIFPYIQLACMSYREGHFDDCETL 421

Query: 448 FDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVG 507
           F EAR KFP APEVP F+AEIL+DKG+   AA +YD A  LE   S    I VG+APLVG
Sbjct: 422 FSEARRKFPDAPEVPNFFAEILSDKGEIEKAAAEYDKAIELE---SKSENIHVGIAPLVG 478

Query: 508 KATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAAD 567
           KAT L + P+ ENF EA  LFE+A   DPRSE+AK+GLAQ  LQQED+D AI++FEEAA 
Sbjct: 479 KATTLLKYPTVENFIEADDLFEQANNEDPRSEKAKMGLAQCKLQQEDLDDAIRLFEEAAI 538

Query: 568 LARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRAQG 612
           L RT DEKLQA TFAEA KVQ ++RAD  ++AK  +AL E R  G
Sbjct: 539 LCRTLDEKLQATTFAEATKVQMRVRADERLQAKTMKALDEIRRNG 583

>NDAI0B04340 Chr2 (1087851..1089845) [1995 bp, 664 aa] {ON}
           Anc_2.152 YHR117W
          Length = 664

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/544 (52%), Positives = 373/544 (68%), Gaps = 15/544 (2%)

Query: 79  PVYPITASGEPDLSQLDSYTPEQ---RETYALALKDKGNELFKEKAVEEAIKYYQWALEF 135
           P YP+ +  +PD ++++         +  +A  LK+KGN+ FK K  E AIKYY++AL  
Sbjct: 128 PSYPLDSQNDPDFNEINKLIANNENLKSKFAKELKNKGNQYFKSKDNENAIKYYEYALRL 187

Query: 136 KKDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195
            +DPVFY+NISACY ++N  +KV+E+ NKALELKPDYSK LLRRAN YE + N  +A++D
Sbjct: 188 DQDPVFYSNISACYFAMNQLDKVIESSNKALELKPDYSKALLRRANAYEALGNNKEALYD 247

Query: 196 LSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQ-DKFEQPLPSDTSMASFFGIF 254
            S+LSL  ++SG  +EP+L R L+K +  +L+ +L+N + D F   L SD+++ SFFGIF
Sbjct: 248 FSILSLFGEYSGQYLEPLLNRILDKVSTDVLRAKLDNKKTDNF--ILLSDSALVSFFGIF 305

Query: 255 KPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADTCFNEAVNQYRE-LFSKASDEE 313
            PET    Y+   EAD+ L  GL  L   T  GF+ AD  F +A   + E L S   ++E
Sbjct: 306 PPETTITNYNPDDEADKELVQGLEALAKKTSEGFLDADKHFIKANELFMEKLLSSEDNDE 365

Query: 314 KLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGES 373
                L EK AIALEYSG+FKFLK D++G++  + +AI L+PR NSYIY+A+  AD    
Sbjct: 366 N--SGLLEKVAIALEYSGVFKFLKFDLLGSETDLQKAIDLYPRPNSYIYMAMLVADKNND 423

Query: 374 S---EYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQ 430
               +Y   FDKA  LNPN + TYYHRGQL  + Q + +A+  FLKAKELD+ N++ YIQ
Sbjct: 424 KNDLDYFKYFDKATTLNPNFAPTYYHRGQLLLVNQKFDEAETFFLKAKELDDSNVYPYIQ 483

Query: 431 LACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEE 490
           LAC+ Y      +C++LFDEAR KFP  PEVPTFYAEILADKG+   A KQYD+A RLE 
Sbjct: 484 LACVAYYNSTFKKCQELFDEARTKFPTLPEVPTFYAEILADKGELEAAMKQYDIAYRLE- 542

Query: 491 AISAKTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLL 550
             +A   I VG+APL+GKA  LAR P+ ENF   T L E+AC+ DPRSEQAK+ LAQL L
Sbjct: 543 --TAYKYIHVGIAPLIGKAAALARIPTQENFDTMTELLEKACELDPRSEQAKISLAQLKL 600

Query: 551 QQEDVDSAIKMFEEAADLARTTDEKLQAVTFAEAAKVQKKIRADPIIRAKVEEALAEYRA 610
           Q ED+D+AI +FEE ADLART  +KLQA TFAEAAK+QK+I+ +PI  AK+EE LA YRA
Sbjct: 601 QTEDIDTAIALFEETADLARTYQDKLQATTFAEAAKIQKRIKENPIYAAKIEETLATYRA 660

Query: 611 QGMI 614
            G+I
Sbjct: 661 DGII 664

>KLTH0F14542g Chr6 complement(1191800..1193341) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123C
          Length = 513

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 57/105 (54%), Gaps = 1/105 (0%)

Query: 96  SYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLND 154
           S   E+    AL  K++GN   KEK   EA++YY  A+E      +F++N +   + L++
Sbjct: 2   SIVSEEAAQKALEFKNQGNAFIKEKKYPEAVEYYSKAIELDDTQSIFFSNRAFSRLKLDN 61

Query: 155 FEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           F   LE+CNK++EL P   K + RR  +Y  +  F+ A  DL  +
Sbjct: 62  FLTALEDCNKSIELDPKNIKAIHRRGLSYVGLLEFSKARKDLKTI 106

>NDAI0B05790 Chr2 complement(1406039..1407610) [1572 bp, 523 aa]
           {ON} Anc_3.481
          Length = 523

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 33/95 (34%), Positives = 56/95 (58%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           A+ LK++GN+  KEK   +A++YY  A+E      +F++N +   + L++F+  L++CN 
Sbjct: 13  AIDLKNEGNKYIKEKKYTKAVEYYTKAIELDSTQSIFFSNRALAQLKLDNFQSCLDDCNS 72

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           ALEL P   K   RR  +   + +F  A  DLS++
Sbjct: 73  ALELDPKNIKAYHRRGLSQLGLLHFKKAKNDLSIV 107

>Ecym_3025 Chr3 complement(50289..51245) [957 bp, 318 aa] {ON}
           similar to Ashbya gossypii ACR005W
          Length = 318

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 82  PITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPV 140
           P  +S EP  +  D++ PE  E  A  LK +GN+ F  K  E A+K Y  A+E    + V
Sbjct: 73  PTLSSSEPTGNNTDAHAPEVAER-AENLKLEGNKAFAAKDFEGAVKKYTEAIELMPNNAV 131

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178
           FY N +A Y S   FE+ + +   A+ + P YS+   R
Sbjct: 132 FYGNRAAAYSSFKKFEEAVRDAESAVRINPSYSRGYSR 169

>Kwal_55.21175 s55 complement(716457..717992) [1536 bp, 511 aa] {ON}
           YGR123C (PPT1) - serine/threonine phosphatase [contig
           295] FULL
          Length = 511

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   KEK  +EA++YY  A+E      ++++N +   + L++F    E+C+K
Sbjct: 10  ALEFKNQGNAYVKEKKYQEAVEYYSKAIELDDTQSIYFSNRAFSRLRLDNFLTAQEDCDK 69

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           A+ L P   K + RR  +Y  +  F  A  DL V+
Sbjct: 70  AIALDPKNIKAIHRRGLSYVGLLEFFKARKDLRVV 104

>KNAG0A07900 Chr1 complement(1258164..1259702) [1539 bp, 512 aa]
           {ON} Anc_3.481 YGR123C
          Length = 512

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 52/95 (54%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  KD+GN   K +  ++AI+ Y  A+E      +FY+N +  ++ L++F+  L +CN 
Sbjct: 12  ALKFKDEGNVYIKSQDYQKAIELYTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCND 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           A++L  +  K   RR   Y  +  F  A  DL++L
Sbjct: 72  AIKLDNNNIKAYHRRGLAYVGLLEFRKAKNDLTIL 106

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAY 428
           + KA+EL+  SS  Y +R   +    ++Q A  D   A +LDN+NI AY
Sbjct: 35  YTKAIELDSTSSIFYSNRALAHLKLDNFQSALHDCNDAIKLDNNNIKAY 83

>SAKL0F03102g Chr6 (258266..259807) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 6/127 (4%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   K K   +A + Y  A+E      ++++N +  ++ L++F+  L +CNK
Sbjct: 12  ALEFKNQGNVFIKGKNFSKAAELYSKAIELDGTQSIYFSNRAFAHLKLDNFQTALNDCNK 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMK 224
           A+EL P   K   RR  +Y  +  F  A  DL ++           EP+  R L+     
Sbjct: 72  AIELDPKNVKAYHRRGLSYIGLLEFNKARKDLKIV-----LRAKPNEPVATRALDVCERV 126

Query: 225 MLKERLE 231
           + KE+ E
Sbjct: 127 IRKEKFE 133

>NCAS0G00810 Chr7 complement(138192..139946) [1755 bp, 584 aa] {ON}
           Anc_5.617
          Length = 584

 Score = 53.9 bits (128), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 30/86 (34%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKAL 166
           LK KGN  F  K    AI+Y+  A+     P  V Y+N SACY SL  F++ L +  + +
Sbjct: 7   LKQKGNAAFASKDFTGAIEYFTEAIAASTTPNHVLYSNRSACYTSLKQFQEALNDAQQCV 66

Query: 167 ELKPDYSKVLLRRANTYENMENFADA 192
           ++ PD+SK   R    +  + +  DA
Sbjct: 67  KINPDWSKGYNRMGAAHLGLGDLDDA 92

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 41/88 (46%), Gaps = 7/88 (7%)

Query: 113 GNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL----EL 168
           GN+L+K    +EAI  Y  A +  KD  +  N SA      DFE  +   N+A+    EL
Sbjct: 263 GNKLYKSHKFDEAIAEYNKAWDLHKDITYLNNRSAAEFEKGDFETAMNTLNEAVEQGREL 322

Query: 169 KPDY---SKVLLRRANTYENMENFADAM 193
           + DY   +K   R  N Y   +N   A+
Sbjct: 323 RADYKLIAKSFARMGNAYSKQKNLKKAI 350

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 67/139 (48%), Gaps = 11/139 (7%)

Query: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + +++C KA+E  P+
Sbjct: 397 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIKDCEKAIEKDPN 456

Query: 172 YSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLE 231
           + +  LR+A     +++F  A+  L      +D          E N    + +++K +++
Sbjct: 457 FVRAYLRKATAQIAIKDFVKALETLEEAKKKDD----------EVNNGASSNEIMKLQMK 506

Query: 232 NTQDKFEQPLPSDTSMASF 250
            TQ++F+ P  ++T   ++
Sbjct: 507 ATQERFQAPTGNETPEETY 525

>TBLA0E03300 Chr5 complement(827677..829425) [1749 bp, 582 aa] {ON}
           Anc_5.617 YOR027W
          Length = 582

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 2/85 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           KD+GN  F  K  +EAI+ +  A+E  + P  V Y+N SACY S   F K LE+ N+ ++
Sbjct: 9   KDQGNAAFVAKNYDEAIEKFTKAIEVSETPNHVLYSNRSACYTSKKQFVKGLEDANECVK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADA 192
           + P +SK   R    +  M +  +A
Sbjct: 69  INPTWSKGYNRVGAAHFGMGDLDEA 93

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 54/107 (50%), Gaps = 8/107 (7%)

Query: 95  DSYTPEQRETYAL-ALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLN 153
           ++ TPE     A  A K +GN+L+K    +EAI++Y  A E   D  +  N SA      
Sbjct: 243 EASTPEDESKIAADAEKAEGNKLYKAHKFDEAIEHYNKAWELHNDITYLNNRSAAEFEKG 302

Query: 154 DFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
           D++  +E  ++A+    E++ DY   +K   R AN+Y  + +   A+
Sbjct: 303 DYQTAIETLHEAVEKGREMRADYKLVAKSFTRIANSYMKLNDIKSAI 349

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 42/87 (48%), Gaps = 5/87 (5%)

Query: 113 GNELFKEKAVEEAIKYYQWALEFKKDPV---FYANISACYVSLNDFEKVLENCNKALELK 169
           G E F +     A+K Y   +   +DP     Y+N +A    L  F + + +CN A+E  
Sbjct: 396 GKEYFTKGDWPNAVKAYTEMI--ARDPSDARGYSNRAAALSKLMSFPEAITDCNTAIEKD 453

Query: 170 PDYSKVLLRRANTYENMENFADAMFDL 196
           P++ +  +R+A     +++F  A+  L
Sbjct: 454 PNFIRAYIRKATAQIAIKDFVPAIETL 480

>AEL224W Chr5 (207712..209454) [1743 bp, 580 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR027W (STI1)
          Length = 580

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 104 TYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLEN 161
           T A   K +GN  F  K  E+AI+ +  A+E  + P  V Y+N SACY S+  F + L +
Sbjct: 2   TTAEEYKKEGNSAFAAKDFEKAIELFGKAIEVSEQPNHVLYSNRSACYASMRKFREALAD 61

Query: 162 CNKALELKPDYSK 174
             + + +KPD+SK
Sbjct: 62  AQECVRIKPDWSK 74

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K KGNEL+K++  +EAI  Y+ A +  KD  +  N +A      D+E  ++   KA+   
Sbjct: 258 KAKGNELYKKRQFDEAIANYEKAWDLHKDITYLNNRAAAEYEKGDYESAIKTLEKAVEEG 317

Query: 167 -ELKPDY---SKVLLRRANTYENMENFADAM 193
            EL+ DY   +K   R  N +  + +   A+
Sbjct: 318 RELRADYKVIAKSFARLGNAHYKLADLKKAI 348

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 54/116 (46%), Gaps = 10/116 (8%)

Query: 91  LSQLDSYTPEQRETYALALKD---------KGNELFKEKAVEEAIKYYQWALE-FKKDPV 140
           L++L S   EQ++  A A  D         +G E F       A+K Y   ++   +D  
Sbjct: 364 LNKLRSLEKEQKKREAEAYIDPEKAEEARLQGKEYFTNADWPNAVKAYTEMIKRAPEDAR 423

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDL 196
            Y+N +A    L  F   +++C+ A++  P++ +  +R+A     ++ +A A+  L
Sbjct: 424 GYSNRAAALAKLMSFPDAIKDCDMAIQKDPNFVRAYIRKATAQIAVQEYAAAIETL 479

>ACR005W Chr3 (363355..364338) [984 bp, 327 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR007C (SGT2)
          Length = 327

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 50/94 (53%), Gaps = 7/94 (7%)

Query: 86  SGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYAN 144
           +GEP ++       E+ +  A ALK +GN     K  E AI+ Y  A+E    D V+YAN
Sbjct: 76  AGEPKVA------AEELKKEAEALKLEGNRAMAAKDYETAIQKYTAAIEVLPTDAVYYAN 129

Query: 145 ISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178
            +A Y SL  +EK +E+  KA ++   YSK   R
Sbjct: 130 RAAAYSSLQQYEKAVEDAEKATKVDSSYSKGFSR 163

>NDAI0I02240 Chr9 (512140..513192) [1053 bp, 350 aa] {ON} Anc_6.21
           YOR007C
          Length = 350

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (54%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKA 165
           A ALK +GNE   E   EEAIK Y  A++F K+  +Y+N S  Y  L  +E  + +   A
Sbjct: 82  AEALKKEGNEAMIEGQYEEAIKKYTEAIQFSKNVAYYSNRSLAYSKLGRYEDAVNDATLA 141

Query: 166 LELKPDYSKVLLR 178
           + + P +SK   R
Sbjct: 142 INIDPSFSKAYSR 154

>TBLA0A07270 Chr1 complement(1811640..1812761) [1122 bp, 373 aa]
           {ON} Anc_6.21 YOR007C
          Length = 373

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 49/87 (56%), Gaps = 1/87 (1%)

Query: 108 ALKDKGNELFKEKAVEEAIKYYQWAL-EFKKDPVFYANISACYVSLNDFEKVLENCNKAL 166
             KD+GN L   +  ++AI+ Y  A+ ++  DP++Y+N S  Y+ +ND+E  + + N  +
Sbjct: 139 TFKDEGNRLMFSEDYKKAIECYTNAISKYPCDPIYYSNRSVAYLKVNDYESAINDANFCI 198

Query: 167 ELKPDYSKVLLRRANTYENMENFADAM 193
            +  ++SK  +R AN       + DA+
Sbjct: 199 SIDANFSKAYIRLANIKVQQHQYIDAL 225

>Ecym_4413 Chr4 complement(856330..857862) [1533 bp, 510 aa] {ON}
           similar to Ashbya gossypii AAR083C
          Length = 510

 Score = 50.4 bits (119), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKK-DPVFYANISACYVSLNDFEKVLENCNK 164
           AL  KD+GN+    K   +AI+ Y  A+E      +F++N +   + L+ F+  LE+ +K
Sbjct: 9   ALEYKDQGNKFVASKDYGQAIEAYTKAIELDGCQSIFFSNRALANLKLDRFQSALEDSSK 68

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           A+EL     K   RR   Y  +++F  A  DL V+
Sbjct: 69  AIELDSSNVKGYHRRGMAYAGLQDFISAKRDLEVV 103

>TBLA0C03950 Chr3 complement(950339..951877) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKD-PVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN+  K +    AI+ Y  A++      ++++N +  ++ +++F+  + +C+K
Sbjct: 12  ALEFKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSGINDCDK 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           ALE+ P   K   RR  +Y  +  F +A  DL ++
Sbjct: 72  ALEIDPKNIKAYHRRGMSYIGLLEFKNAQKDLKIV 106

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 11/91 (12%)

Query: 333 FKFLKNDVI------GAQAAVNEAIKLFPRVNSYIY---LALTSADNGESSEYVTNFDKA 383
           FK   ND I      GA     EAIKL   V+ Y     +     DN +S   + + DKA
Sbjct: 15  FKNRGNDAIKTQDYPGAIELYTEAIKLDDTVSIYFSNRAMGHLKMDNFQSG--INDCDKA 72

Query: 384 LELNPNSSATYYHRGQLYFITQDYQKAKADF 414
           LE++P +   Y+ RG  Y    +++ A+ D 
Sbjct: 73  LEIDPKNIKAYHRRGMSYIGLLEFKNAQKDL 103

>KLLA0B10912g Chr2 (955948..957486) [1539 bp, 512 aa] {ON} similar
           to uniprot|P53043 Saccharomyces cerevisiae YGR123C
          Length = 512

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 55/97 (56%), Gaps = 5/97 (5%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP---VFYANISACYVSLNDFEKVLENC 162
           AL LK++GN+  KEK   +A +YY  A+E   DP   + Y+N +   + L++F+  L++ 
Sbjct: 13  ALELKNEGNKFVKEKLYAKAAEYYTKAIE--HDPENTILYSNRAFTNLKLDNFQSSLDDA 70

Query: 163 NKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
            +A+EL  +  K   RRA +Y  +  F  A  DL ++
Sbjct: 71  KRAIELDNNNLKAYHRRAMSYIGLLEFRKARKDLIIV 107

>CAGL0H08195g Chr8 complement(804418..806169) [1752 bp, 583 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027w STI1
          Length = 583

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 2/73 (2%)

Query: 104 TYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLEN 161
           T A   K +GN  F  K  E+AI  +  A+E  + P  VFY+N SACY SL  F + L +
Sbjct: 2   TTADEYKQQGNAAFVAKDYEKAIDLFSKAIEVSETPNHVFYSNRSACYASLKKFPEALND 61

Query: 162 CNKALELKPDYSK 174
             + +++ P +SK
Sbjct: 62  AEECVKINPTWSK 74

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 9/101 (8%)

Query: 99  PEQRETYALALKD---KGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDF 155
           PE+ E   L  KD   KG+     KA  E IK         +D   Y+N +A    L  F
Sbjct: 387 PEKAEEARLEGKDYFTKGDWPNAVKAYTEMIK------RAPEDARGYSNRAAALSKLMSF 440

Query: 156 EKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDL 196
            + +E+CNKA+E  P++ +  +R+A     ++ FA A+  L
Sbjct: 441 PEAIEDCNKAIEKDPNFIRAYIRKATAQIAVKEFAAAIETL 481

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 40/88 (45%), Gaps = 7/88 (7%)

Query: 113 GNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL----EL 168
           GN+ +K +  +EAI +Y  A    +D  +  N SA      D E  L+  ++A+    E+
Sbjct: 263 GNKAYKARQFDEAIAHYDAAWNLHQDITYLNNRSAAEFEKGDAETALKTLDEAVEKGREM 322

Query: 169 KPDY---SKVLLRRANTYENMENFADAM 193
           + DY   +K   R  N +    N   A+
Sbjct: 323 RTDYKLIAKSFARMGNVHHKTNNLKKAI 350

>SAKL0G07084g Chr7 (580004..581761) [1758 bp, 585 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 585

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  E+AI+ +  A+E  + P  V Y+N SACY S   F K LE+  + + 
Sbjct: 7   KQQGNAAFAAKDFEKAIELFTKAIEVSEKPNHVLYSNRSACYTSTKQFNKALEDAKQCVN 66

Query: 168 LKPDYSK 174
           + P +SK
Sbjct: 67  INPAWSK 73

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 60/134 (44%), Gaps = 8/134 (5%)

Query: 68  QEKKTELATETP-VYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAI 126
           +EK    +T+ P   P  +  EP          E  +  A A K +GN+ +K +  +EAI
Sbjct: 220 EEKPNVSSTQIPKAAPSESKPEPMEVDEPEQEEESSKAKADAEKAEGNKFYKARKFDEAI 279

Query: 127 KYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRR 179
           ++Y  A E  KD  +  N +A      ++E  ++   +A+    EL+ DY   SK   R 
Sbjct: 280 EHYSKAWELHKDITYLNNRAAAEYEKGEYETAIKTLTEAVEQGRELRADYKVISKSFARI 339

Query: 180 ANTYENMENFADAM 193
            N+Y  +     A+
Sbjct: 340 GNSYHKLNELKKAI 353

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 112 KGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKP 170
           +G E F +     A+K Y   ++   +D   Y+N +A    L  F + +++CN A+   P
Sbjct: 399 QGKEYFTKGDWPNAVKSYTEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCNVAISKDP 458

Query: 171 DYSKVLLRRA 180
           ++ +  +R+A
Sbjct: 459 NFIRAYIRKA 468

>TPHA0D02880 Chr4 (599288..601045) [1758 bp, 585 aa] {ON} Anc_5.617
           YOR027W
          Length = 585

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  E+A+  +  A+E   +P  V Y+N SACY SL  F   L + N+  +
Sbjct: 9   KQQGNTAFSAKEYEKAVDLFSKAIEVSPEPNHVLYSNRSACYTSLKKFTDALNDANECTK 68

Query: 168 LKPDYSK 174
           + P +SK
Sbjct: 69  INPTWSK 75

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/92 (34%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 108 ALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFE---KVLENC-N 163
           A KD+GN+L+K    +EAI++Y  A E   D  +  N +A      D+E   K LE+   
Sbjct: 260 AEKDEGNKLYKAHKFDEAIEHYDKAWELHNDITYLNNKAAAQYEKGDYETTIKTLEDAIE 319

Query: 164 KALELKPDY---SKVLLRRANTYENMENFADA 192
           K  EL+ DY   +K   R  N YE + +   A
Sbjct: 320 KGRELRADYKIIAKAFTRMGNAYEKLNDLKKA 351

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 14/126 (11%)

Query: 112 KGNELFKEKAVEEAIK-YYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKP 170
           +G + F +    +A+K Y +       D   Y+N +A    L  F + + +C KALE  P
Sbjct: 398 QGKDFFNKGQWPDAVKAYTEMIARAPDDARAYSNRAAALSKLMSFPEAISDCEKALEKDP 457

Query: 171 DYSKVLLRRANTYENMENFADAMFDLSV-----LSLNNDFSGASIEPMLERNLNKQAMKM 225
           ++ K  +R+A     ++ ++ A+  L +       LNN   G++I     R +N+   K 
Sbjct: 458 NFVKAYIRKATAQIAIKEYSSALETLDIARSKDTELNN---GSNI-----REINQLYAKA 509

Query: 226 LKERLE 231
            ++R E
Sbjct: 510 TQQRFE 515

>YOR027W Chr15 (381053..382822) [1770 bp, 589 aa] {ON}  STI1Hsp90
           cochaperone, interacts with the Ssa group of the
           cytosolic Hsp70 chaperones and activates Ssa1p ATPase
           activity; interacts with Hsp90 chaperones and inhibits
           their ATPase activity; homolog of mammalian Hop
          Length = 589

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  ++AI+ +  A+E  + P  V Y+N SACY SL  F   L + N+ ++
Sbjct: 9   KQQGNAAFTAKDYDKAIELFTKAIEVSETPNHVLYSNRSACYTSLKKFSDALNDANECVK 68

Query: 168 LKPDYSK 174
           + P +SK
Sbjct: 69  INPSWSK 75

 Score = 40.4 bits (93), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K +GN+ +K +  +EAI++Y  A E  KD  +  N +A      ++E  +   N A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHKDITYLNNRAAAEYEKGEYETAISTLNDAVEQG 325

Query: 167 -ELKPDY---SKVLLRRANTYENM 186
            E++ DY   SK   R  N Y  +
Sbjct: 326 REMRADYKVISKSFARIGNAYHKL 349

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + + +CNKA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKVLLRRANTYENMENFADAMFDLSV-----LSLNNDFSGASIEPM 213
           + +  +R+A     ++ +A A+  L         +NN  S   I+ +
Sbjct: 463 FVRAYIRKATAQIAVKEYASALETLDAARTKDAEVNNGSSAREIDQL 509

>Kwal_55.19935 s55 (182767..184548) [1782 bp, 593 aa] {ON} YOR027W
           (STI1) - Heat shock protein also induced by canavanine
           and entry into stationary phase [contig 159] FULL
          Length = 593

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKAL 166
            K +GN  F  K  E+A + +  A+E  + P  V Y+N SACY SL  F++ LE+  + +
Sbjct: 6   FKKQGNAAFVAKDFEKAAELFSKAIESSETPNHVLYSNRSACYTSLKKFKEALEDAEECV 65

Query: 167 ELKPDYSKVLLRRANTYENMENFADA 192
           ++ P +SK   R       + N  DA
Sbjct: 66  KINPTWSKGYNRVGAAQYGLGNLDDA 91

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 59/116 (50%), Gaps = 8/116 (6%)

Query: 86  SGEPDLSQLDSYTPEQ-RETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYAN 144
           S + D  ++D   PEQ  +  A A K +GN+ +K +  +EAI++Y  A +  +D  +  N
Sbjct: 246 SADADKMEVDEPEPEQDSKAKADAEKAEGNKYYKARKFDEAIEHYNKAWDLHRDVTYLNN 305

Query: 145 ISACYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
            SA      D+E+ ++   +A+    E++ DY   SK   R  N Y  M++   A+
Sbjct: 306 RSAAEYEKGDYEQAIKTLTEAVDQGREMRADYKLISKSFARIGNAYLKMDDLKKAI 361

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 56/128 (43%), Gaps = 11/128 (8%)

Query: 91  LSQLDSYT-PEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISAC 148
           L +  SY  PE+ E   L    +G E F +     A+  Y   ++   +D   Y+N +A 
Sbjct: 389 LREAKSYIDPEKAEEARL----QGKEFFTKGDWPSAVSAYTEMIKRAPEDARGYSNRAAV 444

Query: 149 YVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV-----LSLNN 203
              L  F   +++C+ A+   P++ +  +R+A+    +  FA AM  L       L +N 
Sbjct: 445 LAKLMSFPDAIKDCDVAISKDPNFVRAYIRKASAQIAVREFAPAMETLDAARAKDLEINK 504

Query: 204 DFSGASIE 211
             +   IE
Sbjct: 505 GANAREIE 512

>Smik_15.205 Chr15 (346899..348668) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 37/67 (55%), Gaps = 2/67 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  ++AI+ +  A+E  K P  V Y+N SACY SL  F   L +  + + 
Sbjct: 9   KQQGNSAFTAKDYDKAIELFTKAIEVSKTPNHVLYSNRSACYASLKKFSDALNDAKECIN 68

Query: 168 LKPDYSK 174
           + P +SK
Sbjct: 69  INPSWSK 75

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 41/84 (48%), Gaps = 7/84 (8%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K +GN+ +K +  +EAI++Y  A E  +D  +  N +A      +++  +   N A+   
Sbjct: 266 KAEGNKFYKARQFDEAIEHYNKAWELHRDITYLNNRAAAEYEKGEYKTAIATLNDAVEQG 325

Query: 167 -ELKPDY---SKVLLRRANTYENM 186
            E++ DY   S+   R  N Y  +
Sbjct: 326 REMRADYKVISRSFARIGNAYHKL 349

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G + F +     A+K Y   ++   +D   Y+N +A    L  F + + +CNKA+E  P+
Sbjct: 403 GKDYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKVLLRRANTYENMENFADAMFDLSV-----LSLNNDFSGASIEPM 213
           + +  +R+A     ++ +A A+  L         +NN  S   I+ +
Sbjct: 463 FVRAYIRKATAQIAVQEYAAALETLDAARTKDADVNNGASSREIDQL 509

>NCAS0F03490 Chr6 complement(698757..700295) [1539 bp, 512 aa] {ON}
           Anc_3.142 YDL047W
          Length = 512

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP---VFYANISACYVSLNDFEKVLENC 162
           A+A K++GN   KE+   +AI+ Y  A+E   DP   +F++N +   + L++F+  + +C
Sbjct: 12  AVAFKNEGNTYIKEQNYMKAIELYSQAIEL--DPTQSIFFSNRALAQLKLDNFQSCMNDC 69

Query: 163 NKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           + AL L P   K   RR  ++  +     A  DL V+
Sbjct: 70  DVALRLDPKNIKAYHRRGLSHLGLLQCKKARNDLQVV 106

>TPHA0J00340 Chr10 complement(76166..77182) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 1/96 (1%)

Query: 84  TASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFY 142
           +A+ +  ++  D    E+++  A  LK +GN+    K  E AIK Y  A+E    + V+Y
Sbjct: 71  SATNDIQVNIADDAADEEQKATAEGLKLEGNKAMATKDYESAIKKYSEAIEVLPTNAVYY 130

Query: 143 ANISACYVSLNDFEKVLENCNKALELKPDYSKVLLR 178
           AN +A Y SL  ++  + +   A+++ P YSK   R
Sbjct: 131 ANRAAAYSSLKKYDDAVNDAESAIKVNPTYSKGYSR 166

>SAKL0E01210g Chr5 complement(93267..94238) [972 bp, 323 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 323

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167
           LK +GN+    K  E AIK Y  A+E    + V+YAN +A Y SL  +E+ +++   A++
Sbjct: 100 LKLQGNKAMASKDFETAIKKYTEAIEVLPSNAVYYANRAAAYSSLKKYEESVQDAESAIK 159

Query: 168 LKPDYSKVLLR 178
           + P YSK   R
Sbjct: 160 VNPSYSKGYSR 170

>KLLA0A07062g Chr1 complement(636546..638291) [1746 bp, 581 aa] {ON}
           highly similar to uniprot|P15705 Saccharomyces
           cerevisiae YOR027W STI1 Heat shock protein also induced
           by canavanine and entry into stationary phase
          Length = 581

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKAL 166
            K +GN+ F  K   +AI+ +  A+E  + P  V ++N SACY S  DF K L++ N+ +
Sbjct: 6   FKQEGNQAFASKDYAKAIELFTKAIEVSEQPNHVLFSNRSACYASNKDFVKALDDANECV 65

Query: 167 ELKPDYSK 174
           ++ P ++K
Sbjct: 66  KINPSWAK 73

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 57/117 (48%), Gaps = 12/117 (10%)

Query: 84  TASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYA 143
           T   EP+  ++D       ++ A A K +GN+L+K++  +EAI+ Y  A E   D  +  
Sbjct: 238 TKKPEPEPMEVDD-----DKSKAEAAKAEGNKLYKQRKFDEAIEKYNEAWETHNDITYLN 292

Query: 144 NISACYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
           N +A      D+E  +E   KA+    EL+ DY   SK   R  N+Y  + +   A+
Sbjct: 293 NRAAAEYEKGDYEAAIETLTKAVEQGRELRADYKVISKSFARMGNSYHKLGDLKKAI 349

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 1/86 (1%)

Query: 112 KGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKP 170
           +G E F +    +A++ Y   ++    D   Y+N +A    L  F   + +C+KA+E  P
Sbjct: 395 QGKEYFTKADWPKAVEAYTEMIKRNPNDARGYSNRAAALSKLMSFADAIRDCDKAIEKDP 454

Query: 171 DYSKVLLRRANTYENMENFADAMFDL 196
           ++ +  +R+A     ++++A A+  L
Sbjct: 455 NFVRAYIRKATGQIAIKDYAGAIETL 480

>KLTH0E02178g Chr5 (194914..196695) [1782 bp, 593 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 593

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 57/109 (52%), Gaps = 8/109 (7%)

Query: 93  QLDSYTPEQ-RETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVS 151
           ++D   PEQ  +  A A K +GN+ +K +  +EAI++Y  A +  KD  +  N SA    
Sbjct: 253 EVDEPQPEQDSKKNADAEKAEGNKFYKARKFDEAIEHYNKAWDLHKDVTYLNNRSAAEYE 312

Query: 152 LNDFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
             D+E+ ++   +A+    E++ DY   SK   R  N Y  +E+F  A+
Sbjct: 313 KGDYEQAIKTLTEAVEQGREMRADYKLISKSFARIGNAYLKLEDFKKAI 361

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 2/77 (2%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKAL 166
            K +GN  F  K  E+A + +  A+E  + P  V Y+N SAC+ SL  F + L + N+ +
Sbjct: 6   FKKQGNAAFVAKDYEKASELFTKAIEASEAPNHVLYSNRSACFTSLKKFNEALNDANECV 65

Query: 167 ELKPDYSKVLLRRANTY 183
           ++ P +SK   R    Y
Sbjct: 66  KINPAWSKGYNRVGAAY 82

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 33/135 (24%), Positives = 62/135 (45%), Gaps = 15/135 (11%)

Query: 112 KGNELFKEKAVEEAIK-YYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKP 170
           +G E F +     A+K Y +      +D   Y+N +A    L  F + +++C+ A+   P
Sbjct: 407 QGKEYFTKGDWPNAVKAYTEMTKRAPEDARGYSNRAAALAKLMSFPEAIKDCDMAISKDP 466

Query: 171 DYSKVLLRRANTYENMENFADAMFDLSV-----LSLNNDFSGASIEPMLERNLNKQAMKM 225
           ++ +  +R+A     +  FA A+  L         LNN   GA++     R +++  +K 
Sbjct: 467 NFIRAYIRKATAQIAVREFASAIETLDAARAKDTELNN---GANV-----REIDQLYIKA 518

Query: 226 LKERLENTQDKFEQP 240
            ++R +  QD  E P
Sbjct: 519 SQQRFQ-PQDPNETP 532

>TPHA0D03220 Chr4 complement(662868..664409) [1542 bp, 513 aa] {ON}
           Anc_3.481 YGR123C
          Length = 513

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 55/104 (52%), Gaps = 2/104 (1%)

Query: 98  TPEQRET-YALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDF 155
           +P Q +   AL  K+KGNE  K+   + AI++Y  A+       ++++N +  ++  ++F
Sbjct: 3   SPSQEDIATALDFKNKGNEYIKKSDYDSAIEFYSKAIALDSTQSIYFSNRALAHLKQDNF 62

Query: 156 EKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
              + +C+ AL+L P   K   RR  +Y  +  F  A  DL+V+
Sbjct: 63  YSAVVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVV 106

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 33/62 (53%), Gaps = 5/62 (8%)

Query: 363 LALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADF---LKAKE 419
           LA    DN  S+  V + D AL+L+P +   Y+ RG  Y    +++KAK D    LKAK 
Sbjct: 54  LAHLKQDNFYSA--VVDCDNALKLDPKNIKAYHRRGLSYVGILEFRKAKNDLNVVLKAKP 111

Query: 420 LD 421
            D
Sbjct: 112 ND 113

>AAR083C Chr1 complement(492375..493991) [1617 bp, 538 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR123C
           (PPT1)
          Length = 538

 Score = 48.5 bits (114), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 76/178 (42%), Gaps = 14/178 (7%)

Query: 80  VYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEF-KKD 138
           V  +  SG P   + DS T       AL  K++GNE  K K    A++ Y  A+E     
Sbjct: 16  VRTVAGSGHPSPPRRDSMTAAT----ALDYKNEGNEWVKAKDYARAVEAYTRAIEADGTQ 71

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
            +F++N +   + L+ F+  LE+  +A+EL     K   RR   +  +  +  A  DL V
Sbjct: 72  SIFFSNRALANLKLDRFQSALEDSARAIELDAGNVKAYHRRGLAHCGLLEWGPAKRDLEV 131

Query: 199 LSLNNDFSGASIEPMLERNLNKQAMKMLKERLENT----QDKFEQPLPSDTSMASFFG 252
           +           +  + R L      + +ER E       D+ ++ L    S+ASF G
Sbjct: 132 V-----VRAKPGDEAVRRALEVCERMLRRERFERAIRADGDEEQRRLCKTLSLASFAG 184

>CAGL0D05060g Chr4 complement(486065..487597) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|P53043 Saccharomyces
           cerevisiae YGR123c PPT1 protein ser/thr phosphatase
          Length = 510

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 51/95 (53%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   K +   +AI+ Y  A+E      V+++N + C++ L++F+   ++C+K
Sbjct: 9   ALEYKNEGNACVKVQDYAKAIEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDK 68

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           AL L P   K   RR      +  F  A  DL+V+
Sbjct: 69  ALALDPKNVKAYHRRGLACVGLLEFKKARADLTVV 103

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 32/60 (53%), Gaps = 2/60 (3%)

Query: 377 VTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQ--LACL 434
           +  +DKA+EL+   S  + +R   +    ++Q A  D  KA  LD  N+ AY +  LAC+
Sbjct: 29  IEKYDKAIELDDTQSVYFSNRALCHLKLDNFQCASQDCDKALALDPKNVKAYHRRGLACV 88

>Suva_7.408 Chr7 complement(706942..708483) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/95 (31%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   KEK   +AI+ Y  A++      ++++N +  +  +++F+  L +C++
Sbjct: 12  ALERKNEGNVFIKEKHFLKAIEKYTQAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           AL+L P   K   RRA +   +  F  A  DL+VL
Sbjct: 72  ALKLDPKNIKAYHRRALSCMALLEFKKAKKDLTVL 106

>Kpol_1037.26 s1037 complement(59590..60618) [1029 bp, 342 aa] {ON}
           complement(59590..60618) [1029 nt, 343 aa]
          Length = 342

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 43/74 (58%), Gaps = 1/74 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWAL-EFKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A ALK +GN+    K  E AIK Y  A+     + V++AN +A Y SL  +++ +E+ N 
Sbjct: 100 AEALKLEGNKAMAGKDYELAIKKYTEAIATLPTNAVYFANRAAAYSSLKKYDEAVEDANS 159

Query: 165 ALELKPDYSKVLLR 178
           A+++ P YSK   R
Sbjct: 160 AIKINPTYSKGYSR 173

>Kpol_513.2 s513 (1962..3086) [1125 bp, 374 aa] {ON} (1962..3086)
           [1125 nt, 375 aa]
          Length = 374

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 6/102 (5%)

Query: 96  SYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD-----PVFYANISACYV 150
           +Y  E  E  A   K++GN+L+K K   +A + Y  A++ K D        YAN +AC +
Sbjct: 65  AYEGEPHEI-AGNFKNQGNDLYKVKRFRDARELYNKAIDVKCDDDKINESLYANRAACEL 123

Query: 151 SLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADA 192
            L ++ + + +C  AL L P   K   R A  +  +E F D 
Sbjct: 124 ELKNYRRCINDCKMALSLNPKNIKCYFRMAKAFLAIEKFDDC 165

>Skud_15.192 Chr15 (340847..342616) [1770 bp, 589 aa] {ON} YOR027W
           (REAL)
          Length = 589

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  + AI+ +  A+E  + P  V ++N SACY SL  F   L + N+ ++
Sbjct: 9   KQQGNAAFTAKNYDGAIELFTKAIEVSETPSHVLFSNRSACYTSLKKFSDALNDANECVK 68

Query: 168 LKPDYSK 174
           + P +SK
Sbjct: 69  INPSWSK 75

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 54/126 (42%), Gaps = 16/126 (12%)

Query: 77  ETPVYPITA--SGEPDLSQLDSYTPEQRET-------YALALKDKGNELFKEKAVEEAIK 127
           E+P  P T   S      Q D+  PE  E         A   K +GN+ +K    +EAI+
Sbjct: 224 ESPAVPTTKNESSSTAPQQKDAEEPEPMEVDEDNSKAEADNEKAEGNKFYKAHQFDEAIE 283

Query: 128 YYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALE----LKPDY---SKVLLRRA 180
           +Y  A E  KD  +  N +A      D+E V+   N A+E    ++ DY   SK   R  
Sbjct: 284 HYNRAWELHKDITYLNNRAAAEYEKGDYETVIATLNDAVEKGRDMRADYKVISKSFARIG 343

Query: 181 NTYENM 186
           N Y  +
Sbjct: 344 NAYHKL 349

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + + +CNKA+E  P+
Sbjct: 403 GKEYFTKSDWPNAVKAYTEMIKRAPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 462

Query: 172 YSKVLLRRANTYENMENFADAMFDLSV 198
           + +  +R A     ++ FA A+  L V
Sbjct: 463 FVRAYIRMAAAQIAVKEFAAALETLDV 489

>KLLA0D01155g Chr4 complement(104847..105854) [1008 bp, 335 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007C SGT2 Glutamine-rich cytoplasmic protein of
           unknown function contains tetratricopeptide (TPR)
           repeats which often mediate protein-protein interactions
           conserved in human and C. elegans
          Length = 335

 Score = 47.0 bits (110), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 112 KGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKP 170
           +GN+    K  +EAI+ Y  A+E    + V+Y+N +A Y SL  +E+ +++  +A+E+ P
Sbjct: 101 QGNKAMAAKKFDEAIEKYTAAIEVSPSNAVYYSNRAAAYSSLKQYEQAVKDAEQAIEVDP 160

Query: 171 DYSKVLLR 178
            YSK   R
Sbjct: 161 TYSKGFSR 168

>TDEL0B01310 Chr2 complement(234307..235449) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 57/120 (47%), Gaps = 6/120 (5%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPV-----FYANISACYVSLNDFEKVLENCNK 164
           K++GN+L+K K  ++A + Y   +E K D        YAN +AC + + ++ + L +C  
Sbjct: 82  KNQGNDLYKAKRFKDARELYNKGIEIKCDDTSINESLYANRAACELEIKNYRRCLNDCKT 141

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMK 224
           AL+  P   K   R    +  +E   +A   +    L  D S   ++ +L+  L KQ  K
Sbjct: 142 ALQYNPKNLKCYYRMGKAFLALELLEEAQKSVE-FGLQVDSSNKPLQSLLDIVLKKQEAK 200

>KAFR0L00410 Chr12 complement(75459..76454) [996 bp, 331 aa] {ON}
           Anc_6.21 YOR007C
          Length = 331

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 1/80 (1%)

Query: 100 EQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKV 158
           E+ +  A  LK +GN+    K  + AI  Y  A+     + ++YAN +A Y SL DFEK 
Sbjct: 93  EETKVKAEKLKLEGNKAMAMKDFDLAIAKYSEAISISPNNAIYYANRAAAYSSLKDFEKA 152

Query: 159 LENCNKALELKPDYSKVLLR 178
            E+   A+ + P+YSK   R
Sbjct: 153 TEDAESAIRVDPNYSKGYSR 172

>ZYRO0A05676g Chr1 (459999..461717) [1719 bp, 572 aa] {ON} highly
           similar to uniprot|P15705 Saccharomyces cerevisiae
           YOR027W STI1 Heat shock protein also induced by
           canavanine and entry into stationary phase
          Length = 572

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 9/113 (7%)

Query: 88  EPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISA 147
           EP+  ++D   P  R   A A K +GN+L+K +  EEAI++Y  A E  KD  +  N SA
Sbjct: 230 EPEAMEVDE-EPNSR-VAAEAEKAEGNKLYKARQFEEAIEHYNKAWELHKDITYLNNRSA 287

Query: 148 CYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
                 D++  ++  N A+    EL+ DY   +K   R  N Y  +++   A+
Sbjct: 288 AEFEKGDYDTAIKTLNDAVEQGRELRADYKTIAKSFARIGNAYYKLKDLRKAI 340

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 65/145 (44%), Gaps = 19/145 (13%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKAL 166
            K +GN  F  K   +AI  +  A+E  + P  V Y+N SACY S   FE+ L++  + +
Sbjct: 6   FKQQGNAAFLAKDYVKAIDLFTKAIEVSETPNHVLYSNRSACYASNKKFEEALKDAEECV 65

Query: 167 ELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKML 226
           ++ P +SK   R             A F LS L    D +  S +  LE + + +A    
Sbjct: 66  KISPSWSKGYNR----------VGAAQFGLSQL----DEAEKSYKRALELDSSNKAA--- 108

Query: 227 KERLENTQDKFEQPLPSDTSMASFF 251
           K+ LE+ Q     P   D  ++  F
Sbjct: 109 KDGLEHVQSAKAGPQMPDLGLSQMF 133

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 51/102 (50%), Gaps = 5/102 (4%)

Query: 98  TPEQRETYALALKDKGNELFKEKAVEEAIK-YYQWALEFKKDPVFYANISACYVSLNDFE 156
            PE+ E   L    +G E F +     A+K Y +      +D   ++N +A    L  F 
Sbjct: 376 NPEKAEEARL----QGKEFFTKGDWPNAVKAYTEMVKRAPQDARGFSNRAAALAKLMSFP 431

Query: 157 KVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSV 198
           + +E+CNKA+ + P++ +  +R+A     ++ FA A+  L++
Sbjct: 432 EAIEDCNKAVSIDPNFVRAYIRKATAQIAVKEFAAAIETLNI 473

>Kpol_1032.8 s1032 complement(15762..16793) [1032 bp, 343 aa] {ON}
           complement(15762..16793) [1032 nt, 344 aa]
          Length = 343

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 1/80 (1%)

Query: 100 EQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKV 158
           E ++  A ALK +GN+    K  + AI  Y  A+E +  +P +Y+N +A Y  + DF   
Sbjct: 92  EDKKKEAEALKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFYYSNRAAAYQMIEDFTNA 151

Query: 159 LENCNKALELKPDYSKVLLR 178
           + + N A++L P YSK   R
Sbjct: 152 VLDANTAIKLDPTYSKAYSR 171

>ZYRO0B04224g Chr2 (350069..351610) [1542 bp, 513 aa] {ON} highly
           similar to uniprot|P53043 Saccharomyces cerevisiae
           YGR123C
          Length = 513

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 50/95 (52%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  KD+GN+  K++   +A + Y  A+E      +F++N +  ++  ++F+  L +C+K
Sbjct: 12  ALEYKDQGNDFVKKQDFIKAAELYTKAIELDDTKSIFFSNRALAHLKQDNFQLSLNDCDK 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           ALEL     K   RR  +Y  +  F  A  DL  +
Sbjct: 72  ALELDSKNIKAYHRRGLSYVGLLEFKKARTDLKTV 106

>Skud_7.432 Chr7 complement(715852..717393) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K++GN L KEK   +AI+ Y  A++      ++++N +  +  +++F+  L +C++A++L
Sbjct: 16  KNEGNVLVKEKHFLKAIEKYTEAIDLDSTQTIYFSNRALSHFKVDNFQSALNDCDEAIKL 75

Query: 169 KPDYSKVLLRRANTYENMENFADAMFDLSVL 199
            P   K   RRA +   +  F  A  DL+VL
Sbjct: 76  DPKNIKAYHRRALSCMALLEFKKAKRDLNVL 106

>ZYRO0F08624g Chr6 (691992..693131) [1140 bp, 379 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 379

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 69/133 (51%), Gaps = 14/133 (10%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDPV---FYANISACYVSLNDFEKVLENCN 163
            K++ N+L+K K  +EA + Y+  +E K   D V    +AN++AC + + +F + +  C 
Sbjct: 81  FKNQANDLYKAKRFKEAREVYKKGIEIKCNDDKVNESLFANLAACELEIKNFRRCINLCQ 140

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA----MFDLSVLSLNNDFSGASIEPMLERN-- 217
           KAL+  P   K   R A  +  +    +A     F L++ S N   S  ++E +++R   
Sbjct: 141 KALQFNPKNMKCYYRIAKAFYQLNKLDEAKESVKFGLTIDSENK--SLQTLEGVIDRKQQ 198

Query: 218 -LNKQAMKMLKER 229
            L++  +K L+E+
Sbjct: 199 ELHEAEVKRLEEK 211

>Suva_8.80 Chr8 (142691..144451) [1761 bp, 586 aa] {ON} YOR027W
           (REAL)
          Length = 586

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K   +AI  +  A+E  + P  V Y+N SACY SL  F   L +  + ++
Sbjct: 9   KQQGNAAFTAKDYGKAIDLFTKAIEVSEAPNHVLYSNRSACYTSLKKFTDALNDATECVK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADA 192
           + P +SK   R    +  + +  DA
Sbjct: 69  INPSWSKGYNRLGAAHLGLGDLDDA 93

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 14/127 (11%)

Query: 68  QEKKTELATETPVYPITASGEP-DLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAI 126
           Q  K+E +++ P    T   EP ++ + DS     +E      K +GN+ +K +  EEAI
Sbjct: 226 QTTKSESSSKAPQQEETKEAEPMEVDEDDSKVEADKE------KAEGNKFYKARQFEEAI 279

Query: 127 KYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRR 179
           ++Y  A E  +D  +  N +A      D+E  +     A+    E++ DY   SK   R 
Sbjct: 280 EHYNKAWELHRDITYLNNRAAAEYEKGDYETAIATLTDAVEQGREMRADYKVISKSFARI 339

Query: 180 ANTYENM 186
            N Y  +
Sbjct: 340 GNAYHKL 346

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 113 GNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + + +CNKA+E  P+
Sbjct: 400 GKEYFTKSDWPNAVKAYTEMIKRSPEDARGYSNRAAALAKLMSFPEAIADCNKAIEKDPN 459

Query: 172 YSKVLLRRANTYENMENFADAMFDLSV-----LSLNNDFSGASIEPM 213
           + +  +R+A     ++ FA A+  L         +NN  S   I+ +
Sbjct: 460 FVRAYIRKATAQIAVQEFAGALETLDAARTKDAEVNNGASAKEIDQL 506

>YGR123C Chr7 complement(736662..738203) [1542 bp, 513 aa] {ON}
           PPT1Protein serine/threonine phosphatase, regulates
           Hsp90 chaperone by affecting its ATPase and cochaperone
           binding activities; has similarity to human phosphatase
           PP5; present in both the nucleus and cytoplasm;
           expressed during logarithmic growth
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   KEK   +AI+ Y  A++      ++++N +  +  +++F+  L +C++
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDSTQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           A++L P   K   RRA +   +  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKARKDLNVL 106

>NCAS0A00490 Chr1 complement(76652..78514) [1863 bp, 620 aa] {ON} 
          Length = 620

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 45/86 (52%), Gaps = 2/86 (2%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALE--FKKDPVFYANISACYVSLNDFEKVLENCNKAL 166
           LK+ GN+ +KEK  E+A+ Y+  AL        + Y+N +A ++ L  + + LE+    +
Sbjct: 11  LKELGNKTYKEKGYEQAVHYFTSALSQPSTNKHILYSNRAAAHIGLKHYAEALEDGKNCV 70

Query: 167 ELKPDYSKVLLRRANTYENMENFADA 192
           EL P++ K   R    Y  ++   +A
Sbjct: 71  ELAPNWDKGYSRVGVAYLGLQKLDEA 96

 Score = 35.4 bits (80), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 9/105 (8%)

Query: 98  TPEQRETYALALKDK--GNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDF 155
           +PE+ E    A ++K  GN+L+K++  +EAI +Y  A    +D  +  NI A      D+
Sbjct: 285 SPEETEKKRRADEEKRIGNDLYKKRNFKEAIIHYTKAWNTFQDITYLNNIGAAQFERGDY 344

Query: 156 EKVLENCNKAL----ELKPD---YSKVLLRRANTYENMENFADAM 193
             VL++  +A+       P+    +K  +R  N Y  + +   A+
Sbjct: 345 GNVLKSLGQAVFFAEHTNPEPQVLAKSYIRMGNAYHRIWDHEHAI 389

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/42 (30%), Positives = 25/42 (59%)

Query: 139 PVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRA 180
           PV + N +A +  L    +V+++C+KA+ + P Y K  +R+ 
Sbjct: 463 PVGWCNRAAVFEKLLTCPQVIDDCDKAISVDPSYIKAYVRKG 504

>Kpol_505.41 s505 complement(91130..92671) [1542 bp, 513 aa] {ON}
           complement(91130..92671) [1542 nt, 514 aa]
          Length = 513

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 5/97 (5%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP---VFYANISACYVSLNDFEKVLENC 162
           A+  K++GN   KE+   +AI+ Y  A+E   DP   +FY+N +   + L++F+    +C
Sbjct: 12  AVEFKNEGNVFIKEQNYSKAIELYTKAIEL--DPNQSIFYSNRALAQLKLDNFQSAYNDC 69

Query: 163 NKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           N+AL L     K   RR      +  F  A  DL+V+
Sbjct: 70  NEALTLDSKNVKAYHRRGLANVGLLEFKRARNDLNVV 106

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 27/49 (55%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAY 428
           + KA+EL+PN S  Y +R        ++Q A  D  +A  LD+ N+ AY
Sbjct: 35  YTKAIELDPNQSIFYSNRALAQLKLDNFQSAYNDCNEALTLDSKNVKAY 83

>NCAS0A11200 Chr1 complement(2220419..2223142) [2724 bp, 907 aa]
           {ON} Anc_3.367
          Length = 907

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++PN S T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 297 KSLEVDPNDSTTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQ- 355

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
                 + +A + +  A  +  + +E+  D G          +DA   Y  A RL+
Sbjct: 356 ------YRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 405

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 27/59 (45%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +   D
Sbjct: 338 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALD 396

>AAR054C Chr1 complement(440706..441107) [402 bp, 133 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR060W
          Length = 133

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWA-LEFKKDPVFYANISACYVSLNDFEKVLENCNKALE 167
           L+ KGN+L+ +   E A+ YY+ A L    +PV  AN+S   + L  +E  L  C++ALE
Sbjct: 11  LRSKGNDLYSKGEYETAVLYYKNASLAEPSNPVHLANMSMALLKLERWEDALSACDRALE 70

Query: 168 L 168
           +
Sbjct: 71  I 71

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 53/95 (55%), Gaps = 1/95 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNK 164
           AL  K++GN   KEK   +AI+ Y  A++      ++++N +  +  +++F+  L +C++
Sbjct: 12  ALERKNEGNVFVKEKHFLKAIEKYTEAIDLDATQSIYFSNRAFAHFKVDNFQSALNDCDE 71

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
           A++L P   K   RRA +   +  F  A  DL+VL
Sbjct: 72  AIKLDPKNIKAYHRRALSCMALLEFKKAKKDLNVL 106

>Kwal_27.11890 s27 (990685..991689) [1005 bp, 334 aa] {ON} YBR155W
           (CNS1) - component of Hsp90p chaperone machinery [contig
           27] FULL
          Length = 334

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 78/153 (50%), Gaps = 8/153 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP-----VFYANISACYVSLNDFEKVLENCN 163
            K++GNEL+K K  ++A + Y   +E K D        ++N +AC + L ++ + + +C 
Sbjct: 81  FKNQGNELYKVKRYKDAREIYNKGIEIKCDSNKINESLFSNRAACELELKNYRRCVNDCR 140

Query: 164 KALELKPDYSKVLLRRANTYENMENFADAMFDLSV-LSLNNDFSG--ASIEPMLERNLNK 220
           +AL+  P   K   R A  +  ++   DA   +   L L+++ +   A ++ +++R  +K
Sbjct: 141 QALQFNPTNIKCFYRIARAFFLLDKCEDAKEAIEFGLKLDSESAALKALLQKVIKREEDK 200

Query: 221 QAMKMLKERLENTQDKFEQPLPSDTSMASFFGI 253
           +A +  + R E  ++K +  L +   + ++  I
Sbjct: 201 KAHEAKRLREETEKEKLKTLLEASLILRNYKSI 233

>Kpol_1018.69 s1018 (197149..198921) [1773 bp, 590 aa] {ON}
           (197149..198921) [1773 nt, 591 aa]
          Length = 590

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 10/127 (7%)

Query: 77  ETPVY---PITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWAL 133
           ETPV    P+  + EP+   +DS   E  +  A A K +GN+L+K +  +EA+  Y  A 
Sbjct: 231 ETPVKKEEPVVQADEPEQMDVDSNEDENAKKRAEAAKAEGNKLYKARQFDEAVAKYNEAW 290

Query: 134 EFKKDPVFYANISACYVSLNDFE---KVLEN-CNKALELKPDY---SKVLLRRANTYENM 186
           E   D  +  N SA      D+E   K LE    K  E++ DY   +K   R  N Y  +
Sbjct: 291 EAHNDITYLNNRSAAEFEKGDYETSIKTLEEAVEKGREMRADYKVIAKSFARMGNCYTKL 350

Query: 187 ENFADAM 193
            +   A+
Sbjct: 351 NDLKKAI 357

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 44/85 (51%), Gaps = 2/85 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  ++AI  +  A++  + P  V Y+N SACY SL  F   L++  + ++
Sbjct: 9   KQQGNAAFVAKDYDKAIDLFSKAIDVSEQPNHVLYSNRSACYTSLKKFVNALKDAEECVK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADA 192
           + P +SK   R    +  M +  +A
Sbjct: 69  INPSWSKGYNRVGAAHFGMGDLDEA 93

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 9/102 (8%)

Query: 95  DSYTPEQRETYALALKD---KGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVS 151
           D   PE+ E   L  KD   KG+     KA  E IK         +D   Y+N +A    
Sbjct: 390 DYINPEKAEEARLEGKDYFTKGDWPNAVKAYTEMIK------RAPEDARGYSNRAAVLSK 443

Query: 152 LNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAM 193
           L  F + +++CNKA+E  P++ +  +R+A     +  F+ A+
Sbjct: 444 LMSFPEAIDDCNKAIEKDPNFVRAYIRKATAQIAVREFSSAL 485

>TDEL0A04840 Chr1 (851520..853250) [1731 bp, 576 aa] {ON} Anc_5.617
           YOR027W
          Length = 576

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 104 TYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLEN 161
           T A   K +GN  F  K  E+A + +  A++  + P  V Y+N SACY SL  F + L++
Sbjct: 2   TSADEYKQQGNAAFVAKDYEKAAELFGKAIDVSEQPNHVLYSNRSACYTSLKKFAEGLKD 61

Query: 162 CNKALELKPDYSKVLLRRANTYENMENFADA 192
             + +++ P +SK   R       + N  DA
Sbjct: 62  AEECVKINPGWSKGYNRVGAAQFGLNNLEDA 92

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 57/124 (45%), Gaps = 13/124 (10%)

Query: 70  KKTELATETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYY 129
           K+ E  TE P   +  + EP+  ++D   P+     A   K +GN+ +K +  +EAI++Y
Sbjct: 218 KQAEAKTEEP---LKENNEPEPMEVDEKGPQ---VAAEEEKAEGNKFYKARKFDEAIEHY 271

Query: 130 QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRRANT 182
             A E  KD  +  N +A      D+E  +     A+    E++ DY   +K   R  N 
Sbjct: 272 NKAWELHKDITYLNNRAAAEYEKGDYETAIATLTNAVDEGREMRADYKVIAKSFARIGNA 331

Query: 183 YENM 186
           Y  +
Sbjct: 332 YHKL 335

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 6/107 (5%)

Query: 113 GNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + + +C++A+E  P+
Sbjct: 389 GKEYFSKADWPNAVKAYTEMIKRSPQDARGYSNRAAALAKLMSFPEAIADCDRAIEKDPN 448

Query: 172 YSKVLLRRANTYENMENFADAMFDLSVL-----SLNNDFSGASIEPM 213
           + +  +R+A+    ++ FA A+  L  +      LNN  +   I+ +
Sbjct: 449 FIRAYIRKASAQIAVKEFAAAVETLDTVRTKDSELNNGANAREIDQL 495

>Skud_2.282 Chr2 (517201..518358) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 48/92 (52%), Gaps = 5/92 (5%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVF-----YANISACYVSLNDFEKVLE 160
           A   K +GNEL+K K  ++A + Y   L  + +  F     +AN +AC + L ++ + +E
Sbjct: 83  AGGFKKQGNELYKAKRFKDARELYIKGLNVECEDKFINESLFANKAACELELKNYRRCIE 142

Query: 161 NCNKALELKPDYSKVLLRRANTYENMENFADA 192
           +C+KAL + P  +K   R +  +  +    +A
Sbjct: 143 DCSKALSINPKNTKCYYRTSKAFFQLNKLEEA 174

>KAFR0B06610 Chr2 (1372434..1373969) [1536 bp, 511 aa] {ON}
           Anc_3.481 YGR123C
          Length = 511

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 49/97 (50%), Gaps = 5/97 (5%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP---VFYANISACYVSLNDFEKVLENC 162
           A + KD+GN+  K++  + A + Y  A+E   DP   +FY+N +   + L++F   L +C
Sbjct: 9   ATSYKDEGNKFLKQQDFQRANELYTKAIE--TDPTQSIFYSNRALANLKLDNFMNALNDC 66

Query: 163 NKALELKPDYSKVLLRRANTYENMENFADAMFDLSVL 199
             A+EL     K   RR      + NF  A  D +++
Sbjct: 67  TNAIELNSSNLKAYHRRGLANIGLLNFKSARNDFNIV 103

>KAFR0C05890 Chr3 (1165932..1167659) [1728 bp, 575 aa] {ON}
           Anc_5.617 YOR027W
          Length = 575

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (52%), Gaps = 2/85 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  ++AI  +  A+E  + P  V Y+N SA Y S   +E+ L + ++ ++
Sbjct: 9   KQEGNTAFVAKDYQKAIDAFTKAIEVSETPNHVLYSNRSAAYTSSKQYEQALSDADECIK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADA 192
           + P ++K   R+    + +  + +A
Sbjct: 69  INPSWAKGYTRKGAALQGLHKYEEA 93

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K +GN+ +K +  +EAI +Y  A E  KD  +  N SA      D+E  ++   +A+   
Sbjct: 255 KAEGNKAYKARQFDEAISHYNQAWETFKDITYLNNRSAAEYEKGDYETCIKTLTEAVENA 314

Query: 167 -ELKPDY---SKVLLRRANTYENMENFADAM 193
            EL+ DY   +K   R  N Y  +++   A+
Sbjct: 315 RELRTDYKIVAKSFARMGNAYAKLDDLKKAI 345

 Score = 40.4 bits (93), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 56/122 (45%), Gaps = 8/122 (6%)

Query: 87  GEPDLSQLDS---YTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV-FY 142
            E DL Q ++    +PE+ E   L    +G E F +     A+K Y   ++   D    Y
Sbjct: 367 AEKDLKQQEAEAYLSPEKAEEARL----EGKEYFTKADWPNAVKSYTEMIKRAPDDARGY 422

Query: 143 ANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLN 202
           +N +A    L  F   + +CNKA+E  P + +  LR+A     ++ FA A+  L +    
Sbjct: 423 SNRAAALAKLMSFPDAISDCNKAIEKDPSFIRAYLRKATCQIAVKEFAGAIETLDLARER 482

Query: 203 ND 204
           +D
Sbjct: 483 DD 484

>TDEL0C05090 Chr3 complement(908033..910312) [2280 bp, 759 aa] {ON}
           Anc_3.367 YBR112C
          Length = 759

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE+NP+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 267 KSLEVNPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 326

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 327 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 375

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N   DA+
Sbjct: 308 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 365

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 23/79 (29%), Positives = 36/79 (45%), Gaps = 2/79 (2%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKA-KELDNDNIFAYIQLACLCY-R 437
           ++KAL +NP  S  +   G  Y +  D QKA   + +A   L N N+        + Y R
Sbjct: 83  YEKALAVNPELSDVWATLGHCYLMLDDLQKAYNAYQQALYHLSNPNVPKLWHGIGILYDR 142

Query: 438 EGDMDECKKLFDEAREKFP 456
            G +D  ++ F +  E  P
Sbjct: 143 YGSLDYAEEAFAKVLELDP 161

>KNAG0B03200 Chr2 complement(619530..621269) [1740 bp, 579 aa] {ON}
           Anc_5.617 YOR027W
          Length = 579

 Score = 44.3 bits (103), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 2/85 (2%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K  +EA+  +  A+E  + P  V Y+N SA Y S   F + L++  +  +
Sbjct: 9   KQQGNSAFAAKKYDEAVDLFTKAIEVSETPNHVLYSNRSASYASEQKFNEALKDALECTK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADA 192
           + P ++K   R    +  M N  DA
Sbjct: 69  INPSWAKGYTREGAAHFGMGNLDDA 93

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 50/103 (48%), Gaps = 5/103 (4%)

Query: 95  DSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLN 153
           D   PE+ E   L    +G E F +     A+K Y   ++   +D   Y+N +A    L 
Sbjct: 378 DYINPEKAEEARL----EGKEYFTKGDWPSAVKAYTEMIKRAPEDARGYSNRAAALSKLM 433

Query: 154 DFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDL 196
            F   + +CNKA+E  P++ +  +R+A     +++F+ A+  L
Sbjct: 434 SFPDAISDCNKAIEKDPNFVRAYIRKATAQIAVKDFSYAIETL 476

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 51/113 (45%), Gaps = 8/113 (7%)

Query: 88  EPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISA 147
           EP+   +D    E +   A   K +GN+ +K +  +EAI  Y  A E   +  +  N SA
Sbjct: 234 EPEAESMDVDQDESK-VAAEEAKVEGNKAYKARNFDEAIACYNKAWELDNNITYLNNRSA 292

Query: 148 CYVSLNDFEKVLENCNKAL----ELKPDY---SKVLLRRANTYENMENFADAM 193
                 +++  +   N+A+    E++ DY   +K   R  N Y  M N  +A+
Sbjct: 293 AEFEKGEYDTAINTLNEAIEKGREMRADYKIIAKSFARIGNAYVKMGNLKEAI 345

>TPHA0M01630 Chr13 complement(340500..343631) [3132 bp, 1043 aa]
           {ON} Anc_3.367 YBR112C
          Length = 1043

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++P+ +AT+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 296 KSLEIDPSDAATWYHLGRVHMIRADYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 355

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 356 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNKQLNDALDAYKQAARLD 404

>KAFR0E02980 Chr5 (596891..598033) [1143 bp, 380 aa] {ON} Anc_8.506
           YBR155W
          Length = 380

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 40/89 (44%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDPV-----FYANISACYVSLNDFEKVLENCN 163
            K++GN+L+K K   +A + Y   +E K D        YAN +AC + L +F   + +C 
Sbjct: 81  FKNQGNDLYKVKRFRDAREIYTKGIEMKCDVAKINESLYANRAACQLELKNFRSCISDCK 140

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
            AL   P   K   R    +  +  F  A
Sbjct: 141 TALTYNPKNIKCYFRMGKAFTAINKFESA 169

>KLLA0B09966g Chr2 complement(872760..873872) [1113 bp, 370 aa] {ON}
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155W CNS1 cyclophilin seven suppressor component of
           Hsp90p chaperone machinery
          Length = 370

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 50/103 (48%), Gaps = 6/103 (5%)

Query: 96  SYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDPV-----FYANISACYV 150
           +Y  E  E  A   K++GN+L+K K  ++A   Y  AL+ K D +      Y N++AC +
Sbjct: 61  AYEGEPHEI-ATNFKNQGNDLYKGKRFKDARAMYLKALDVKCDVLSINESLYLNLAACEL 119

Query: 151 SLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAM 193
            + ++   +  C +AL+L     K   R    Y  +  F D++
Sbjct: 120 EIKNYRSCINYCREALKLNAKNVKAFFRIGKAYLELGRFEDSL 162

>CAGL0E02739g Chr5 complement(259023..260054) [1032 bp, 343 aa] {ON}
           similar to uniprot|Q12118 Saccharomyces cerevisiae
           YOR007c SGT2
          Length = 343

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A ALK +GN+    K  E AI  Y  A+E    + ++YAN +A + SL  +++ + +  K
Sbjct: 93  AEALKLEGNKAMAGKDFELAIAKYSEAIEVLPTNAIYYANRAAAHSSLKQYDEAVVDAEK 152

Query: 165 ALELKPDYSKVLLR 178
           A+E+ P YSK   R
Sbjct: 153 AIEIDPAYSKGYSR 166

>TBLA0H03380 Chr8 (829314..830441) [1128 bp, 375 aa] {ON} Anc_8.506
           YBR155W
          Length = 375

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 6/102 (5%)

Query: 96  SYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFKKD-----PVFYANISACYV 150
           +Y  E  E  A   K++GNE +K K   +A + Y   ++ K D        YAN +AC +
Sbjct: 65  AYEGEPHEI-AGNFKNRGNEFYKLKQYRDAREVYTKGIDVKCDDDKINESLYANRAACEL 123

Query: 151 SLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADA 192
            L +F K +E+C KAL       K   R    + +++ F ++
Sbjct: 124 ELKNFRKCIEDCKKALSFNVKNIKCYYRMGKAFLSVDRFDES 165

>YBR155W Chr2 (549771..550928) [1158 bp, 385 aa] {ON}
           CNS1TPR-containing co-chaperone; binds both Hsp82p
           (Hsp90) and Ssa1p (Hsp70) and stimulates the ATPase
           activity of SSA1, ts mutants reduce Hsp82p function
           while over expression suppresses the phenotypes of an
           HSP82 ts allele and a cpr7 deletion
          Length = 385

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQ--WALEFKKDPV---FYANISACYVSLNDFEKVLENCN 163
            K +GNEL+K K  ++A + Y    A+E +   +    YAN +AC + L ++ + +E+C+
Sbjct: 86  FKKQGNELYKAKRFKDARELYSKGLAVECEDKSINESLYANRAACELELKNYRRCIEDCS 145

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
           KAL + P   K   R +  +  +    +A
Sbjct: 146 KALTINPKNVKCYYRTSKAFFQLNKLEEA 174

>CAGL0H07425g Chr8 (725307..726449) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P33313 Saccharomyces cerevisiae
           YBR155w CNS1
          Length = 380

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 46/89 (51%), Gaps = 5/89 (5%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFK-----KDPVFYANISACYVSLNDFEKVLENCNK 164
           K +GN+L+K K   +A + Y   ++ K      +   YAN +AC + + ++ + + +C +
Sbjct: 85  KKQGNDLYKVKRFRDARELYSKGIDVKCQVNTINESLYANRAACELEIKNYRRCINDCKQ 144

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAM 193
           AL+L P   K   R A  +  +E   +A+
Sbjct: 145 ALQLNPKNIKCYYRIAKAFTALERLDEAL 173

>Smik_2.295 Chr2 (535786..536943) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 59/126 (46%), Gaps = 23/126 (18%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQ--WALEFKKDPV---FYANISACYVSLNDFEKVLENCN 163
            K +GNEL+K K  ++A + Y    A+E +   +    +AN +AC + L ++ + +E+C+
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGIAVECEDKSINESLFANRAACELELKNYRRCIEDCS 145

Query: 164 KALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNND---FSGASIEPMLERNLNK 220
           KAL + P   K   R +           A F LS L        F+  SIEP      NK
Sbjct: 146 KALTINPKNIKCYYRTSK----------AFFSLSKLEEAKSAAIFANQSIEPE-----NK 190

Query: 221 QAMKML 226
             + ML
Sbjct: 191 SILNML 196

>NDAI0C04320 Chr3 complement(983914..986034) [2121 bp, 706 aa] {ON}
           Anc_5.352 YDR320C
          Length = 706

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 63/132 (47%), Gaps = 29/132 (21%)

Query: 107 LALKDKGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLEN 161
           +  K +G+ELFK      A++ Y+ +L    +  P   + Y+NI A  + + ++ K +E+
Sbjct: 415 IEFKTRGSELFKNGDYVSALQEYEKSLNTLPQYHPLRIISYSNIIATQLKIGEYSKSIED 474

Query: 162 CNKALELKPD-----------------------YSKVLLRRANTYENMENFADAMFDLSV 198
           C  AL L P                        +SK+++R+A +YE++EN+  A+     
Sbjct: 475 CKIALSLFPKGKVTSAWNQIIPDSTPQRSFKDIWSKLIMRQAESYEHLENYKLALDSYQK 534

Query: 199 LSLNNDFSGASI 210
           L + N F+ + I
Sbjct: 535 L-IENGFTNSKI 545

>Kwal_56.22433 s56 complement(124778..125746) [969 bp, 322 aa] {ON}
           YOR007C (SGT2) - small glutamine-rich tetratricopeptide
           repeat containing protein [contig 185] FULL
          Length = 322

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 3/82 (3%)

Query: 100 EQRETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFE 156
           E  ET A A  LK +GN+    K  E+A+  Y  A++    + V+YAN +A + SL  +E
Sbjct: 89  EDAETKAKAESLKLEGNKAMAAKDFEQAVLKYSEAIQVLPTNAVYYANRAAAHSSLKKYE 148

Query: 157 KVLENCNKALELKPDYSKVLLR 178
           + +++   A+++ P YSK   R
Sbjct: 149 EAVKDAEDAIKVNPSYSKGYSR 170

>ZYRO0C16522g Chr3 complement(1281166..1284090) [2925 bp, 974 aa]
           {ON} highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 974

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 15/118 (12%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
             K+LE++P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+  
Sbjct: 293 LSKSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ-- 350

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + + +   D       + P    + +E+  D G          +DA   Y  A RL+
Sbjct: 351 -ISQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 403

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N   DA+
Sbjct: 336 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 393

>KAFR0H00870 Chr8 (162118..164781) [2664 bp, 887 aa] {ON} Anc_3.367
           YBR112C
          Length = 887

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 295 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 354

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 355 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYRQASRLD 403

 Score = 31.2 bits (69), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N   DA+
Sbjct: 336 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 393

>CAGL0D01364g Chr4 (152033..155479) [3447 bp, 1148 aa] {ON} similar
           to uniprot|P14922 Saccharomyces cerevisiae YBR112c CYC8
           general repressor of transcription
          Length = 1148

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 289 KSLEVDPSDATTWYHLGRVHMIRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 345

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 346 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 397

>YBR112C Chr2 complement(462870..465770) [2901 bp, 966 aa] {ON}
           CYC8General transcriptional co-repressor, acts together
           with Tup1p; also acts as part of a transcriptional
           co-activator complex that recruits the SWI/SNF and SAGA
           complexes to promoters; can form the prion [OCT+]
          Length = 966

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE +P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 287 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 343

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 344 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 395

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 328 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 385

>KNAG0H00610 Chr8 (99931..102852) [2922 bp, 973 aa] {ON} Anc_3.367
           YBR112C
          Length = 973

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++P+ + T+YH G+++ +  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 306 KSLEVDPSDATTWYHLGRVHMVRSDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQY 365

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 366 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 414

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N   DA+
Sbjct: 347 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 404

>Suva_4.361 Chr4
           complement(631697..632812,632933..633154,633188..634741)
           [2892 bp, 963 aa] {ON} YBR112C (REAL)
          Length = 963

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE +P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 291 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 347

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 348 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 399

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 332 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 389

>Smik_2.254 Chr2 complement(447517..450579) [3063 bp, 1020 aa] {ON}
           YBR112C (REAL)
          Length = 1020

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE +P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 289 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 345

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 346 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 397

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 330 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 387

>TPHA0D03860 Chr4 (807913..808275) [363 bp, 120 aa] {ON} Anc_6.328
           YCR060W
          Length = 120

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K++GN  FKE + + A + YQ  ++ + ++P+ Y+N +   + L  + +V+E C K L  
Sbjct: 7   KEEGNRNFKEGSYKVAAELYQKCVDIEPENPIGYSNKAMALIKLGRYTEVVELCRKGLTF 66

Query: 169 KPDYSKVLLRRAN 181
            P+ +  + ++ N
Sbjct: 67  TPNTTDTVYKKLN 79

>AGL268C Chr7 complement(205872..207011) [1140 bp, 379 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR155W
           (CNS1)
          Length = 379

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 43/88 (48%), Gaps = 5/88 (5%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKD-----PVFYANISACYVSLNDFEKVLENCNK 164
           K++GN+L+K K   +A   Y   +E K D      +   N +AC + L ++ + + +C +
Sbjct: 81  KNQGNDLYKVKRFRDARVMYNKGIEVKCDDAGISELLLLNRAACELELKNYRRCINDCRE 140

Query: 165 ALELKPDYSKVLLRRANTYENMENFADA 192
           AL+L P   K   R    +  ++   +A
Sbjct: 141 ALKLNPKNPKAFFRIGKAFLQLDKLEEA 168

>Skud_2.240 Chr2 complement(431507..434461) [2955 bp, 984 aa] {ON}
           YBR112C (REAL)
          Length = 984

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE +P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 281 KSLEADPSDATTWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 337

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 338 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAARLD 389

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 322 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 379

>NDAI0F00910 Chr6 complement(223205..224956) [1752 bp, 583 aa] {ON}
          Length = 583

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 62/151 (41%), Gaps = 32/151 (21%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN  F  K   +AI+ +  A+E    P  V Y+N SA Y S   F++ L +  + ++
Sbjct: 9   KQQGNAAFTSKDFNKAIELFTKAIEVSPTPNHVLYSNRSAAYTSAKQFQEALNDATECVK 68

Query: 168 LKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQAMKMLK 227
           + P +SK   R             A F L  L               E+N  K+A+K+  
Sbjct: 69  INPTWSKGYNR----------LGAAEFGLGNLE------------EAEKNY-KEALKLDN 105

Query: 228 ERLENTQDKFEQ-------PLPSDTSMASFF 251
              +  QD  +Q       P P+D  + S F
Sbjct: 106 NNNKAAQDGLDQIERAKNAPPPNDFGLTSMF 136

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 39/82 (47%), Gaps = 7/82 (8%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K +GN+L+K    +EAI+ Y  A    KD  +  N SA      DFE  +   N+A+   
Sbjct: 259 KVEGNKLYKAHKFDEAIEQYNKAWALNKDITYLNNRSAAEFEKGDFETAIATLNEAVDQG 318

Query: 167 -ELKPDY---SKVLLRRANTYE 184
            EL+ DY   +K   R  N Y 
Sbjct: 319 RELRADYKIIAKSFARIGNAYH 340

 Score = 34.7 bits (78), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 30/139 (21%), Positives = 69/139 (49%), Gaps = 21/139 (15%)

Query: 113 GNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y   ++   +D   Y+N +A    L  F + +++C+ A++  P+
Sbjct: 396 GKEYFTKGDWPNAVKAYSEMIKRAPEDARGYSNRAAALSKLMSFPEAIKDCDNAIKKDPN 455

Query: 172 YSKVLLRRANTYENMENFADAMFDLSVL-----SLNNDFSGASIEPMLERNLNKQAMKML 226
           + +  +R+A     ++ +A+A+  L        S+NN   GA+            + +++
Sbjct: 456 FVRAYIRKATAQIAIKEYANALDTLEEAKSKDSSVNN---GAN------------SNEIM 500

Query: 227 KERLENTQDKFEQPLPSDT 245
           + +++ TQ++F+ P  ++T
Sbjct: 501 RLQMKATQERFQAPTGNET 519

>Suva_4.405 Chr4 (719015..720172) [1158 bp, 385 aa] {ON} YBR155W
           (REAL)
          Length = 385

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQ--WALEFKKDPV---FYANISACYVSLNDFEKVLENCN 163
            K +GNEL+K K  ++A + Y    A+E +   +    +AN +AC + L ++ K +E+C 
Sbjct: 86  FKKQGNELYKAKRFKDARELYTKGVAVECEDKSINESLFANRAACELELKNYRKCVEDCG 145

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
           KAL + P   K   R + ++  +    +A
Sbjct: 146 KALTINPKNIKCYYRISKSFFQLRKLEEA 174

>Ecym_2559 Chr2 (1089202..1090314) [1113 bp, 370 aa] {ON} similar to
           Ashbya gossypii AGL268C
          Length = 370

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 10/117 (8%)

Query: 96  SYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALEFK--KDPV---FYANISACYV 150
           +Y  E  E  A   K++GN+L+K K  ++A   Y   +E K   D +    Y N +AC +
Sbjct: 70  AYEGEPHEV-AANFKNQGNDLYKVKRYKDARTMYSKGIEVKCEDDSINGSLYLNRAACEL 128

Query: 151 SLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADA----MFDLSVLSLNN 203
            L +F   + +C KAL       K   R    Y  ++   +A    +F L + S NN
Sbjct: 129 ELRNFRSCINDCKKALNFNAKCVKAFYRMGQAYFKLKKLEEAKGSVLFGLKLDSQNN 185

>NCAS0B02400 Chr2 complement(402763..403905) [1143 bp, 380 aa] {ON}
           Anc_8.506 YBR155W
          Length = 380

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 41/89 (46%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDPV---FYANISACYVSLNDFEKVLENCN 163
            K++GN+LF  K   EA   Y   +E K   D +    +AN +AC + L ++   + +C 
Sbjct: 83  FKNQGNDLFTVKRFREARDIYNKGIEIKCENDKINEALFANRAACQLELKNYRSCINDCK 142

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
            AL L P   K   R    +  + N  +A
Sbjct: 143 HALTLNPKNIKCYYRMGKAFYLLNNIEEA 171

>KAFR0L01870 Chr12 (345757..347895) [2139 bp, 712 aa] {ON} Anc_7.412
           YBL084C
          Length = 712

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 92/232 (39%), Gaps = 13/232 (5%)

Query: 338 NDVIGAQAAVNEAIKLFPRV-NSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYH 396
           +D +      NE I  FP    ++  L    +   +  E +  F+KA EL+P  +  Y  
Sbjct: 474 HDKVKLSNLANELIDNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELDPRFAYAYTL 533

Query: 397 RGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFP 456
           +G  Y   + +  A+  + KA   D+ +  AY  L     + G+ D     F++AR   P
Sbjct: 534 QGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKARMINP 593

Query: 457 VAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQP 516
           V   +       L    ++  A K YD A +L+   SA    R        KA +L    
Sbjct: 594 VNIVLICCCGVELEKVRNYELALKYYDFASKLQPN-SALAKYR--------KAELLF--- 641

Query: 517 SPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
           S   ++ A  LFE+  K D  +      L ++         A+K +  A +L
Sbjct: 642 SLGRYSLAVELFEDLIKLDSENPNLHYMLGKIYQTMGRKKDAVKEYTVAMNL 693

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 39/175 (22%), Positives = 69/175 (39%), Gaps = 26/175 (14%)

Query: 398 GQLYFITQDYQKAKADF-----LKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAR 452
           G+L++  Q+Y+ A + F     ++   L++  IF     + L +   D  +   L +E  
Sbjct: 433 GKLHYEIQNYKMALSHFERLRIIQPTRLNDLEIF-----STLLWHLHDKVKLSNLANELI 487

Query: 453 EKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVL 512
           + FP A +         + + D  +A K ++ A  L+              P    A  L
Sbjct: 488 DNFPEAAQTWCVLGNHFSLQKDHDEAIKAFNKATELD--------------PRFAYAYTL 533

Query: 513 ARQ--PSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEA 565
                 S E+F  A T + +A   D +   A  GL     Q  + D ++  FE+A
Sbjct: 534 QGHEYASNESFDTARTFYRKALACDSQHYNAYYGLGTCDSQNGNHDRSLLFFEKA 588

>Kpol_172.2 s172 (4270..5523) [1254 bp, 418 aa] {ON} (4270..5523)
           [1254 nt, 418 aa]
          Length = 418

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 50/112 (44%), Gaps = 15/112 (13%)

Query: 385 ELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDEC 444
           E++P+ +AT+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+       
Sbjct: 307 EIDPSDAATWYHLGRVHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQ---- 362

Query: 445 KKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRL 488
              + +A + +  A  +  + +E+  D G          SDA   Y  A RL
Sbjct: 363 ---YRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDALDAYKQAARL 411

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 345 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 402

>Suva_15.182 Chr15 complement(313413..314453) [1041 bp, 346 aa] {ON}
           YOR007C (REAL)
          Length = 346

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/92 (32%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 86  SGEPDLSQ-LDSYTPEQ-RETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPV 140
           SG+ D +Q ++   PE+  ET A A  LK +GN+    K  E AIK Y  A++    + +
Sbjct: 78  SGKKDDAQNVEVNIPEEDAETKAKAEELKIQGNKAMANKEYELAIKKYTEAIDVLPTNAI 137

Query: 141 FYANISACYVSLNDFEKVLENCNKALELKPDY 172
           +YAN +A + SL ++++ +++   A+ + P Y
Sbjct: 138 YYANRAAAHSSLKEYDEAIKDAESAISVDPSY 169

>Ecym_5582 Chr5 complement(1195544..1197298) [1755 bp, 584 aa] {ON}
           similar to Ashbya gossypii AEL224W
          Length = 584

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 47/91 (51%), Gaps = 2/91 (2%)

Query: 104 TYALALKDKGNELFKEKAVEEAIKYYQWALEFKKDP--VFYANISACYVSLNDFEKVLEN 161
           T A   K +GN  F  K  + A++ +  A++  ++P  V Y+N S  Y SL  F++ L +
Sbjct: 2   TSAEEYKKEGNAAFVAKDFKRAVELFTNAIQESEEPNHVLYSNRSGAYASLKKFDEALSD 61

Query: 162 CNKALELKPDYSKVLLRRANTYENMENFADA 192
             + +++K D+SK   R    +  + N  +A
Sbjct: 62  ATECVKIKADWSKGHNRLGAAHFGLGNLDEA 92

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 46/91 (50%), Gaps = 7/91 (7%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKAL--- 166
           K +GN+L+K++  +EAI  Y+ A   +KD  +  N +A      D+   ++  N+A+   
Sbjct: 262 KAEGNQLYKQRKFDEAIAKYEEAWNLQKDITYLNNRAAAEYEKGDYNSAIKTLNEAVEQG 321

Query: 167 -ELKPDY---SKVLLRRANTYENMENFADAM 193
            EL+ DY   +K   R  N Y  ++    A+
Sbjct: 322 RELRADYKVIAKSFARLGNAYYKLDEVKKAV 352

 Score = 38.1 bits (87), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 1/87 (1%)

Query: 113 GNELFKEKAVEEAIK-YYQWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALELKPD 171
           G E F +     A+K Y +  +    D   Y+N +A    L  F   +++C+KA+E+ P 
Sbjct: 399 GKEYFTKGDWPSAVKAYSEMIMRAPHDARGYSNRAAALSKLMSFPDAIKDCDKAIEIDPS 458

Query: 172 YSKVLLRRANTYENMENFADAMFDLSV 198
           + +  +R+A     ++ ++ A+  L V
Sbjct: 459 FVRAYIRKATAQIAVQEYSAAIETLDV 485

>Ecym_2090 Chr2 complement(163340..163858) [519 bp, 172 aa] {ON}
           similar to Ashbya gossypii AAR054C
          Length = 172

 Score = 39.3 bits (90), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNKAL 166
           LK KGN  FK    E AI YY+ A      +P++++N++   + L  +++ +  C+K L
Sbjct: 44  LKVKGNTFFKNGDYETAILYYEKACALDSSNPIYFSNMATALIKLERWQEAVNACDKGL 102

>Suva_3.95 Chr3 (137419..137754) [336 bp, 111 aa] {ON} YCR060W
           (REAL)
          Length = 111

 Score = 37.7 bits (86), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K++GNEL+K+    +AI  Y   +  + ++PV ++N +   + L +  + +E C + L+L
Sbjct: 8   KEEGNELYKQGLYRDAIGCYDRLIAAQPQNPVGHSNKAMALIKLGEHAQAIEACQQGLQL 67

Query: 169 KPDYSKVLLR 178
                   LR
Sbjct: 68  AASPQHAALR 77

>NDAI0D00810 Chr4 complement(181659..182708) [1050 bp, 349 aa] {ON}
           Anc_6.21 YOR007C
          Length = 349

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A A K +GN+    K    A++ Y  A++    + ++YAN +A + SL +FE+ +++   
Sbjct: 101 AEAFKLEGNKAMAMKDFHLAVEKYTEAIKILPTNAIYYANRAAAHSSLKEFEEAIKDAES 160

Query: 165 ALELKPDYSKVLLRRA 180
           A+++ P YSK   R A
Sbjct: 161 AIKIDPSYSKGYSRLA 176

>KAFR0B00250 Chr2 complement(58608..62870) [4263 bp, 1420 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1420

 Score = 40.8 bits (94), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 57/107 (53%), Gaps = 8/107 (7%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPL-VGKATVLARQPSPENFA 522
           +   I  D G+++ A++   +A+RL ++ +AKT +R    P  V   + L  Q    N  
Sbjct: 649 YICTIYTDCGNWATASQ---IAERLIKSENAKTELRKANWPYRVMGISFLEDQ----NET 701

Query: 523 EATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLA 569
           ++   F+ A + DP   ++ VGL Q       V+++IK+FE+A +L+
Sbjct: 702 DSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVELS 748

 Score = 35.0 bits (79), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 50/118 (42%), Gaps = 5/118 (4%)

Query: 360 YIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKE 419
           Y  + ++  ++   ++ +  F  AL ++PN   ++   GQ YF     + +   F KA E
Sbjct: 687 YRVMGISFLEDQNETDSIEWFQSALRVDPNDIESWVGLGQAYFACGRVEASIKVFEKAVE 746

Query: 420 LDNDNIFA-YIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFS 476
           L  D+ +A Y     L      MDE ++  D  R      PE   F  E+     D+S
Sbjct: 747 LSPDHNYAKYFNSVAL----AQMDEFERAIDILRHVLKDEPEKEVFKMELATQIVDYS 800

 Score = 34.7 bits (78), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 35/72 (48%)

Query: 509 ATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
           AT      SP+N   A +LF++    DP +  AK+G   + +++ED + A  +     + 
Sbjct: 458 ATCYTYVESPKNHKPALSLFDKILSEDPTNINAKIGKGIIAIEREDWNGAYTLITNIIEQ 517

Query: 569 ARTTDEKLQAVT 580
             +T   L+ ++
Sbjct: 518 EPSTSSNLEILS 529

>TDEL0G04480 Chr7 (813648..814679) [1032 bp, 343 aa] {ON} Anc_6.21
           YOR007C
          Length = 343

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 45/82 (54%), Gaps = 3/82 (3%)

Query: 100 EQRETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFE 156
           E  ET A A  LK +GN+    K  + AIK Y  A+E    + V+YAN +A + S+  +E
Sbjct: 89  EDAETKAKAETLKLEGNKAMACKDFDLAIKKYSDAIEVLPTNAVYYANRAAAHSSMKAYE 148

Query: 157 KVLENCNKALELKPDYSKVLLR 178
           + +++   A++  P YSK   R
Sbjct: 149 EAIKDAESAIKTDPTYSKGYSR 170

>SAKL0A01672g Chr1 complement(154932..155318) [387 bp, 128 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90
          Length = 128

 Score = 38.1 bits (87), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 108 ALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNKAL 166
            LK KGN  FK+   E A+ YYQ A+     +P+ Y+N +   + L  + + ++ CNK L
Sbjct: 6   TLKAKGNVFFKKCDYETAVLYYQKAITADPSNPIGYSNNAMGLIKLEKWSEAVDACNKGL 65

Query: 167 EL 168
           ++
Sbjct: 66  KM 67

>NCAS0H00830 Chr8 complement(151809..152825) [1017 bp, 338 aa] {ON}
           Anc_6.21 YOR007C
          Length = 338

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 1/76 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A + K +GN+    K    AI+ Y  A++    + ++YAN +A Y S+ +++  +++  K
Sbjct: 99  AESFKLEGNKAMAAKDYRLAIEKYSEAIKTLPTNVIYYANRAAAYSSVKEYDNAIKDAEK 158

Query: 165 ALELKPDYSKVLLRRA 180
           A+E+ P YSK   R A
Sbjct: 159 AIEIDPAYSKGYSRLA 174

>KNAG0M01170 Chr13 complement(211476..212495) [1020 bp, 339 aa] {ON}
           Anc_6.21 YOR007C
          Length = 339

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 51/89 (57%), Gaps = 1/89 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A ALK +GN+    K  + A++ Y  A++    + V++AN +A Y +  ++++ +++  +
Sbjct: 101 AEALKLEGNKAVASKDYDLAVEKYTEAIKILPTNAVYFANRAAAYTNSQNYDEAVKDAEE 160

Query: 165 ALELKPDYSKVLLRRANTYENMENFADAM 193
           A++L P YSK   R A      ENF +++
Sbjct: 161 AIKLDPAYSKGYSRLAYAKYVQENFEESL 189

>NDAI0C05290 Chr3 (1224979..1226118) [1140 bp, 379 aa] {ON}
           Anc_8.506 YBR155W
          Length = 379

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 22/90 (24%), Positives = 44/90 (48%), Gaps = 6/90 (6%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKDP------VFYANISACYVSLNDFEKVLENC 162
            K++GN+L+K K  ++A   Y   ++ + +         +AN +AC + L +F + + +C
Sbjct: 79  FKNQGNDLYKAKRFKDARDVYLKGIQIENNKDVKIKESLFANKAACELELKNFRRCINDC 138

Query: 163 NKALELKPDYSKVLLRRANTYENMENFADA 192
             AL+L P   K   R    +  ++   +A
Sbjct: 139 KNALQLNPKNVKCYFRMTRAFFALDKLEEA 168

>NCAS0A15300 Chr1 (3006855..3011051) [4197 bp, 1398 aa] {ON} 
          Length = 1398

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/139 (23%), Positives = 71/139 (51%), Gaps = 15/139 (10%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           +  E+ A   ++S A +   +A+RL +A  AK  ++    P  ++G   +  +Q S    
Sbjct: 630 YMTEVYAKSNNWSSAVQ---IAERLVKAEKAKRVLQTMNWPYRVIGIGNLERQQES---- 682

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL--ARTTDEKLQAV 579
            ++   F+ A + DP   ++ +GL Q  L    ++++IK+FE+A +L  + T  +  +++
Sbjct: 683 -DSIEWFQSAIRVDPNDVESWIGLGQAYLGCGRIEASIKVFEKAIELDSSHTYAKYFKSI 741

Query: 580 TFAEAAKVQKKIRADPIIR 598
             +E  +  + I   P+++
Sbjct: 742 ALSEMGEFTESI---PLLK 757

>ZYRO0C07788g Chr3 (589880..590884) [1005 bp, 334 aa] {ON} similar
           to uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 334

 Score = 38.9 bits (89), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           A +LK +GN+    K  E AIK Y  A+     + V+YAN +A + SL ++++ +++   
Sbjct: 93  AESLKLEGNKAMAGKDYELAIKKYSEAISVVPTNAVYYANRAAAHSSLKNYDEAIKDAES 152

Query: 165 ALELKPDYSKVLLR 178
           A+++   YSK   R
Sbjct: 153 AVKVDSSYSKGYSR 166

>TDEL0E02750 Chr5 (529920..531614) [1695 bp, 564 aa] {ON} Anc_5.352
           YDR320C
          Length = 564

 Score = 39.3 bits (90), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 54/123 (43%), Gaps = 26/123 (21%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFKKDP-----VFYANISACYVSLNDFEKVLENCNK 164
           KD+G E FK      A + Y+ +L           V Y+N++A    + ++++ L +   
Sbjct: 277 KDRGTEFFKAGDYVSASQEYEKSLNSLPQNHALRIVAYSNLTAALFKVGEYKRCLSDIES 336

Query: 165 ALELKPD---------------------YSKVLLRRANTYENMENFADAMFDLSVLSLNN 203
           ALE+ P                      + K++ RRA  +E++EN+  A+ D   L   N
Sbjct: 337 ALEMFPKDPNLWDEPIQDSQPIRTFKEMWPKIVTRRAEAFEHIENYERALQDYQSLIEKN 396

Query: 204 DFS 206
           +F+
Sbjct: 397 NFN 399

>KLLA0E20857g Chr5 (1860517..1862649) [2133 bp, 710 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 710

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 42/88 (47%)

Query: 370 NGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYI 429
           N +  E +T F KA++L+P  +  Y  +G  Y     +  AK+ F KA  ++  +  A  
Sbjct: 505 NKDHDEAITAFGKAIQLDPFFAYAYTLQGHEYSNNDAFDNAKSCFRKALTIEKTHYNALY 564

Query: 430 QLACLCYREGDMDECKKLFDEAREKFPV 457
            L   C + G  +E    F++AR   PV
Sbjct: 565 GLGMCCVKLGKFEEALLFFEKARALNPV 592

>TBLA0H01520 Chr8 (344716..346785) [2070 bp, 689 aa] {ON} Anc_3.367
           YBR112C
          Length = 689

 Score = 38.9 bits (89), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 49/235 (20%), Positives = 91/235 (38%), Gaps = 16/235 (6%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LEL+P  S T+Y+ G+++   +D+  A     +A   D+ N   +  +  L Y+ G  
Sbjct: 405 KSLELDPTDSTTWYYLGRIHMAKKDFTAAYESLQQAVNRDSRNPIFWCSIGVLYYQIGQN 464

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKGD-FSDAAKQYDMAKRLEEAISAKTGIRV 500
            +    +  A    P   EV      +     D  +DA   Y+ A  L+       G R+
Sbjct: 465 HDALDAYTRAIRLNPYISEVWYNLGTLYETCNDQITDALDSYERALSLDPENPVIQG-RL 523

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACK--RDPRSEQAKVGLAQLLLQ---QEDV 555
               +  K +    +  P N   +  L   +     +P+       +A+ +LQ   Q  V
Sbjct: 524 NALKIQDKKS----EYDPNNVVPSKNLHPSSLSNLNNPQPIVDISTMARPVLQVNTQGTV 579

Query: 556 DSAIKMFEEAADLARTTDEKLQAV-----TFAEAAKVQKKIRADPIIRAKVEEAL 605
           D+ I   E   D   ++D  + +        +++     K+ A  I + K   +L
Sbjct: 580 DNTIMKRESEKDFFHSSDPNMSSSNTPLNNISQSGMPNTKLEAADITKDKPSNSL 634

>Kpol_1006.4 s1006 complement(17836..20034) [2199 bp, 732 aa] {ON}
           complement(17836..20034) [2199 nt, 733 aa]
          Length = 732

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           ++LE++   S T+YH G+++ I  DY  A   F +A   D  N   +  +  L Y+    
Sbjct: 277 RSLEVDSEDSTTWYHLGRIHMIRSDYNAAYEAFQQAVNRDARNPIFWCSIGVLYYQIYQ- 335

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
                 + +A + +  A  +  + +E+  D G          +DA   Y  A RLE
Sbjct: 336 ------YRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDALDAYKQAARLE 385

>Smik_3.159 Chr3 (222475..222822) [348 bp, 115 aa] {ON} YCR060W
           (REAL)
          Length = 115

 Score = 36.2 bits (82), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 3/69 (4%)

Query: 110 KDKGNELFKEKAVEEAIKYY-QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALE- 167
           K+ GN LFK+    EA+  Y Q      ++PV Y+N +   + L ++   ++ C + L  
Sbjct: 12  KELGNALFKQGLYREAVDSYDQLITAQPQNPVGYSNKAMALIKLAEYTHAIQTCQEGLRY 71

Query: 168 -LKPDYSKV 175
            L P+++ +
Sbjct: 72  ALGPEHAAI 80

>NCAS0E02490 Chr5 complement(493779..496208) [2430 bp, 809 aa] {ON}
           Anc_7.412 YBL084C
          Length = 809

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 73/194 (37%), Gaps = 12/194 (6%)

Query: 375 EYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACL 434
           E +  FDKA +L+PN    Y  +G  Y     Y  AK  + KA   D  +  AY  +   
Sbjct: 608 EAIRAFDKATKLDPNFVYAYTLQGHEYLSMDSYDTAKTFYRKAISNDLHHYNAYYGMGMC 667

Query: 435 CYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISA 494
             + G+ ++    F++AR   P    +       +   G+   A   Y++A +++   S 
Sbjct: 668 SMKLGEYEQALVYFEKARSINPSNAILICCCGVTMEKLGNQEKALNYYELACQIQPTSSL 727

Query: 495 KTGIRVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQED 554
               R  +   + K            + +A   FEE  K  P     +  L QL      
Sbjct: 728 AKFKRAHLLYSMAK------------YTQALDAFEELIKIAPEEATVQFILGQLYQIMGR 775

Query: 555 VDSAIKMFEEAADL 568
              AIK +  A +L
Sbjct: 776 KKDAIKRYTIAMNL 789

>NDAI0G03710 Chr7 complement(894337..897702) [3366 bp, 1121 aa] {ON}
           Anc_3.5 YOL145C
          Length = 1121

 Score = 38.9 bits (89), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 44/98 (44%), Gaps = 18/98 (18%)

Query: 116 LFKEKAVEEAIKYYQWALE----FKKDPVFYANISACYVSLNDFEKVLENCNKALELKP- 170
           LF++K    ++K +Q  L      K DP     I AC+  L D++  +    ++LEL P 
Sbjct: 207 LFRKKNFMASLKLFQELLVNNPVLKPDPRI--GIGACFWQLKDYKMAINAWERSLELDPT 264

Query: 171 -----------DYSKVLLRRANTYENMENFADAMFDLS 197
                       + K L+   N  E  +NF DAM DLS
Sbjct: 265 NKNSKVLCLLGKFHKTLIDSGNDDEFKDNFKDAMIDLS 302

>KNAG0H01250 Chr8 (217258..219645) [2388 bp, 795 aa] {ON} Anc_3.265
           YBR055C
          Length = 795

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 336 LKNDVIGAQAAVNEAIKLFPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYY 395
           L+++ I  Q  + +A++  PR       A+   D+   SE V    KALE  P S   + 
Sbjct: 297 LESETINKQRVIRKALQTLPREEQLWKQAVEYEDS--PSEIVRIVRKALEFVPQSITLW- 353

Query: 396 HRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447
               L   +Q+Y +AK    KA+EL  D+   +I  + +  R+G +  C KL
Sbjct: 354 ---TLLIESQEYSEAKRSLSKARELVPDSFDIWIIASQVEERQGSVT-CAKL 401

>TBLA0I02310 Chr9 (528067..528417) [351 bp, 116 aa] {ON} Anc_6.328
           YCR060W
          Length = 116

 Score = 35.8 bits (81), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 19/61 (31%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALE 167
           LK KGN  FK  +  EAI +Y   +     +P+ Y+N +   +  + F++ +  C K L+
Sbjct: 6   LKAKGNISFKNGSYSEAISWYNRCISIDPSNPIGYSNKAMALLKADRFDEAITTCEKGLQ 65

Query: 168 L 168
           L
Sbjct: 66  L 66

>Skud_15.168 Chr15 complement(298955..300001) [1047 bp, 348 aa] {ON}
           YOR007C (REAL)
          Length = 348

 Score = 38.1 bits (87), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167
           LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL  +++ +E+   A+ 
Sbjct: 105 LKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKGYDEAVEDAESAIS 164

Query: 168 LKPDY 172
           + P Y
Sbjct: 165 IDPTY 169

>SAKL0F12936g Chr6 (1016829..1018727) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q751K0 Ashbya gossypii AGL294W AGL294Wp and
           some similarites with YBL084C uniprot|P38042
           Saccharomyces cerevisiae YBL084C CDC27 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 632

 Score = 38.1 bits (87), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 50/120 (41%)

Query: 370 NGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYI 429
           N +  E + +F KA +L+P  +  Y  +G  Y     +  AK  + KA   ++ +  A  
Sbjct: 427 NKDHDEAIKSFQKATQLDPRFTYAYTLQGHEYSSNDAFDTAKTCYRKALATNSQHYNASY 486

Query: 430 QLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLE 489
            L   C + G  +E    F +A    PV   +      +    G   DA K Y++A  L+
Sbjct: 487 GLGMCCLKLGQYEESLLHFQKAHSINPVNVILICCCGVVFEKLGHQQDALKYYELACELQ 546

>NDAI0A05100 Chr1 (1157935..1160958) [3024 bp, 1007 aa] {ON}
           Anc_3.367
          Length = 1007

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 302 KSLEVDSQDATTWYHLGRVHMIRNDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQ---I 358

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          +DA   Y  A RL+
Sbjct: 359 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 410

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 14/59 (23%), Positives = 27/59 (45%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFD 195
           ++P+F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +   D
Sbjct: 343 RNPIFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLNDALD 401

>TBLA0F01230 Chr6 complement(304299..307868) [3570 bp, 1189 aa] {ON}
           Anc_3.367 YBR112C
          Length = 1189

 Score = 38.5 bits (88), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 27/113 (23%), Positives = 46/113 (40%), Gaps = 15/113 (13%)

Query: 385 ELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDEC 444
           E +P+ + T+YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+     + 
Sbjct: 279 EFDPSDATTWYHLGRIHMIRTDYTAAYDAFQQAVNRDSRNPIFWCSIGVLYYQISQYRDA 338

Query: 445 KKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
              +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 339 LDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 384

>YCR060W Chr3 (224399..224734) [336 bp, 111 aa] {ON}  TAH1Component
           of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1);
           contains a single TPR domain with at least two TPR
           motifs; R2TP complex interacts with Hsp90 (Hsp82p and
           Hsc82p) to mediate assembly large protein complexes such
           as box C/D snoRNPs and RNA polymerase II
          Length = 111

 Score = 35.4 bits (80), Expect = 0.072,   Method: Composition-based stats.
 Identities = 20/75 (26%), Positives = 36/75 (48%), Gaps = 1/75 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYY-QWALEFKKDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K++GN LFK+    EA+  Y Q      ++PV Y+N +   + L ++ + ++ C + L  
Sbjct: 8   KEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQMCQQGLRY 67

Query: 169 KPDYSKVLLRRANTY 183
                 V +R    Y
Sbjct: 68  TSTAEHVAIRSKLQY 82

>TPHA0L01420 Chr12 (293980..295104) [1125 bp, 374 aa] {ON} Anc_8.506
           YBR155W
          Length = 374

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 53/118 (44%), Gaps = 6/118 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEF-----KKDPVFYANISACYVSLNDFEKVLENCN 163
            K +GNE +K K    A   Y+  +E      K + + + N +AC + + ++   + +C 
Sbjct: 77  FKKQGNEAYKLKQYRNARVLYERGIEVNCNNDKINELLFVNKAACELEMKNYRSCINDCK 136

Query: 164 KALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNNDFSGASIEPMLERNLNKQ 221
           KAL   P   K   R A  +  +E + ++   +    L  D   +S+  +L+  + KQ
Sbjct: 137 KALSFNPLNVKCYFRMAKAFSAIEKYDESRESIE-FGLKVDSRNSSLLNLLKTIIKKQ 193

>TDEL0C02720 Chr3 (477529..479631) [2103 bp, 700 aa] {ON} Anc_7.412
           YBL084C
          Length = 700

 Score = 37.7 bits (86), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           ++ +E  PN   T+   G LY + +D++ A   F KA ++D +  +AY            
Sbjct: 472 NELVETLPNKPQTWCCLGNLYSLQRDHEDAIKYFEKATKIDYNFAYAYTLQGHEHSSNDS 531

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
           +D  K  +   R      P+    Y  +    G       QYD A    E       + V
Sbjct: 532 IDTAKNCY---RRALACDPQHYNAYYGL----GMCYMKLGQYDKALLFFEKARNINPVNV 584

Query: 501 GVAPLVGKAT-VLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAI 559
            +    G A   L+ Q       +A   +E+AC+  P S  AK   A LL       +A+
Sbjct: 585 ILICCCGVALEKLSYQ------EKALQYYEQACELQPSSSLAKFKKAHLLYSMARYSAAL 638

Query: 560 KMFEEAADLA 569
           + FEE A LA
Sbjct: 639 ENFEELAKLA 648

>YOR007C Chr15 complement(338938..339978) [1041 bp, 346 aa] {ON}
           SGT2Glutamine-rich cytoplasmic protein that serves as a
           scaffold for binding Get4/5p and other proteins required
           to mediate posttranslational insertion of tail-anchored
           proteins into the ER membrane; has similarity to human
           cochaperone SGT
          Length = 346

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 103 ETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVL 159
           ET A A  LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL ++++ +
Sbjct: 97  ETKAKAEDLKMQGNKAMANKDYELAINKYTEAIKVLPTNAIYYANRAAAHSSLKEYDQAV 156

Query: 160 ENCNKALELKPDY 172
           ++   A+ + P Y
Sbjct: 157 KDAESAISIDPSY 169

>ACR168W Chr3 (650615..652738) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL022C (CDC16)
          Length = 707

 Score = 37.7 bits (86), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 1/97 (1%)

Query: 388 PNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447
           P SS T++  G  YF   +  +A+  F KA  LD +  +A++  A     EG+ ++    
Sbjct: 419 PKSSVTWFAVGTYYFSINNITEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 478

Query: 448 FDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDM 484
           +  A   FP    +P  Y  +   + D    A++Y M
Sbjct: 479 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEYFM 514

>Smik_15.176 Chr15 complement(306259..307296) [1038 bp, 345 aa] {ON}
           YOR007C (REAL)
          Length = 345

 Score = 37.4 bits (85), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 42/76 (55%), Gaps = 3/76 (3%)

Query: 100 EQRETYALA--LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFE 156
           E  ET A A  LK +GN+    K  E AI  Y  A++    + ++YAN +A + SL +++
Sbjct: 94  EDAETKAKAEDLKMQGNKAMANKDYELAINKYTEAIQVLPTNAIYYANRAAAHSSLREYD 153

Query: 157 KVLENCNKALELKPDY 172
           + +++   ++ + P Y
Sbjct: 154 EAVKDAESSISIDPSY 169

>Kpol_1050.112 s1050 (249717..252797,252855..252863,252906..253898)
           [4083 bp, 1360 aa] {ON}
           (249717..252797,252855..252863,252906..253898) [4083 nt,
           1361 aa]
          Length = 1360

 Score = 37.7 bits (86), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 55/107 (51%), Gaps = 10/107 (9%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           +  E   + G++S A     ++K L +   AK  +R    P  ++G A +  +Q S    
Sbjct: 633 YMVETYCNSGNWSAAES---ISKILVKTDGAKKYLRYTCWPFRVIGIANLERQQES---- 685

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
            +A   F+ A + +P + ++ VGL Q  L    ++++I++FE+A +L
Sbjct: 686 -DAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATEL 731

 Score = 33.9 bits (76), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/155 (23%), Positives = 64/155 (41%), Gaps = 9/155 (5%)

Query: 363 LALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDN 422
           + + + +  + S+ +  F  AL + PN+  ++   GQ Y      + +   F KA ELD 
Sbjct: 674 IGIANLERQQESDAIEWFQSALRIEPNNVESWVGLGQSYLSCGRIEASIRVFEKATELDP 733

Query: 423 DNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQY 482
           D+++A    A      G+  +   +F+E   + P        Y+E L       D   Q 
Sbjct: 734 DHLYAKYFTAQSLSEMGEYVKSISIFEEIIMETPKEESFQVSYSETLMKHA--QDLFNQG 791

Query: 483 DMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPS 517
            + K +  AI A       ++ +   AT L R PS
Sbjct: 792 FLTKSVSIAIEA-------ISVMSYIATDLNRFPS 819

>KLTH0C11220g Chr3 (920972..921955) [984 bp, 327 aa] {ON} similar to
           uniprot|Q12118 Saccharomyces cerevisiae YOR007C SGT2
           Glutamine-rich cytoplasmic protein of unknown function
           contains tetratricopeptide (TPR) repeats which often
           mediate protein-protein interactions conserved in human
           and C. elegans
          Length = 327

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 1/74 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNK 164
           A ALK +GN+    K  E AI  Y  A+     + V++AN +A Y SL  + + +E+   
Sbjct: 98  AEALKLEGNKAMATKDFEHAISKYSEAIRTLPSNAVYFANRAAAYSSLKKYAEAVEDAEA 157

Query: 165 ALELKPDYSKVLLR 178
           A+++ P YSK   R
Sbjct: 158 AIKVNPSYSKGYSR 171

>Kpol_1018.106 s1018 (280224..282485) [2262 bp, 753 aa] {ON}
           (280224..282485) [2262 nt, 754 aa]
          Length = 753

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +++PN +  Y  +G  +     +  AK  + KA   D  +  AY  L   C + G
Sbjct: 558 FEKATQVDPNFAYAYTLQGHEHSSNDSFDTAKNCYRKALACDPQHYNAYYGLGMSCMKLG 617

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAA-KQYDMAKRLEEAISAKTGI 498
             DE    F++AR   P+   +      +  +K  + + A   Y++A  L+ + S     
Sbjct: 618 QYDEALLHFEKARSINPINV-ILICCCGVALEKLQYQEKALSYYELACELQPSSSLANFK 676

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
           R  +   +G+ +V            A   FEE  K  P        L QL         A
Sbjct: 677 RAHLLYSMGRYSV------------ALQYFEELTKLAPDEATVHFLLGQLYQILGRKKDA 724

Query: 559 IKMFEEAADL 568
           +K F  A +L
Sbjct: 725 VKEFTIAMNL 734

>Ecym_5637 Chr5 (1288532..1290685) [2154 bp, 717 aa] {ON} similar to
           Ashbya gossypii ACR168W
          Length = 717

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 44/97 (45%), Gaps = 1/97 (1%)

Query: 388 PNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447
           P SS T++  G  YF   +  +A+  F KA  LD +  +A++  A     EG+ ++    
Sbjct: 429 PKSSVTWFAVGTYYFSINNIPEARKYFSKASVLDPNFGYAWLGFAHTYAVEGEHEQALSA 488

Query: 448 FDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDM 484
           +  A   FP    +P  Y  +   + D    A++Y M
Sbjct: 489 YSTAARFFP-GTHLPHLYLGMQYSRMDTLTLAEEYFM 524

>Kpol_1028.51 s1028 complement(123535..123888) [354 bp, 117 aa] {ON}
           complement(123535..123888) [354 nt, 118 aa]
          Length = 117

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K  GN  FK+    +A++YY+  +E + ++P+ Y+N +   + L  + + LE+C   L+ 
Sbjct: 7   KTTGNTYFKDGNYLKAVEYYKKCIEVEPENPIGYSNSAMSLIKLTKYTEALESCGTGLKY 66

Query: 169 KPD 171
             D
Sbjct: 67  VND 69

>Suva_8.129 Chr8 (231888..234113) [2226 bp, 741 aa] {ON} YOR080W
           (REAL)
          Length = 741

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/135 (25%), Positives = 57/135 (42%), Gaps = 25/135 (18%)

Query: 144 NISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADAMFDLSVLSLNN 203
           NI ACY  L+D +  L    K+L+L PD +K  +R   T   ++++  A     V S   
Sbjct: 83  NICACYEKLDDLKSCLSISQKSLKLDPDNAKCYIRCTRTLIKLKDWKRAY---KVCSRGL 139

Query: 204 DFSGASIEPMLERNLNKQAMKMLKERLENTQD---------KFEQPLPSDTSMAS----- 249
              G +       +L +Q  + +K+ +  TQD         K+  PL  D  +A      
Sbjct: 140 QICGNA------NSLLRQQKQFIKQSIAKTQDIQKVNNGDRKYINPLVDDVKVAKRKKDS 193

Query: 250 --FFGIFKPETEFKG 262
               G+ +P+  FK 
Sbjct: 194 HDITGLSRPKKVFKN 208

>Skud_3.135 Chr3 (208664..209020) [357 bp, 118 aa] {ON} YCR060W
           (REAL)
          Length = 118

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALE 167
           K +GN LFK+    EA+  Y   +  + ++PV Y+N +   + L +  + ++ C + L+
Sbjct: 12  KQQGNALFKQGLYLEAVDSYDRLIAAQPQNPVGYSNKAMALIKLGEHAQAIQACQQGLQ 70

>KNAG0F04010 Chr6 (757749..762005) [4257 bp, 1418 aa] {ON} Anc_7.546
           YPR189W
          Length = 1418

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 54/124 (43%), Gaps = 2/124 (1%)

Query: 349 EAIKLFPRVNSYIY--LALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQD 406
           EAIK+  R  ++ Y  + +   +  + SE V  F  AL ++PN   ++   GQ YF    
Sbjct: 675 EAIKMELRSTNWPYRVIGIAYLERQQESESVEWFHSALRVDPNDVESWVALGQAYFACGR 734

Query: 407 YQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYA 466
            + +   F KA E+D  +++A    +      G  +EC ++     +  P        Y+
Sbjct: 735 VEASTKVFEKAIEIDPLHLYAQYFNSLSLAEMGCFEECIEILKNITQLNPEELAFQVSYS 794

Query: 467 EILA 470
            IL 
Sbjct: 795 SILV 798

>SAKL0B07986g Chr2 complement(675999..678641) [2643 bp, 880 aa] {ON}
           highly similar to uniprot|P14922 Saccharomyces
           cerevisiae YBR112C CYC8 General transcriptional co-
           repressor acts together with Tup1p also acts as part of
           a transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 880

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 48/116 (41%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + T+YH G+++ +  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 299 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQISQY 358

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 359 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 407

>KLLA0B09262g Chr2 (814303..817128) [2826 bp, 941 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 941

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 51/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + ++YH G+++ I  DY  A   F +A   D+ N   +  +  L Y+    
Sbjct: 349 KSLEIDSTDATSWYHLGRIHMIRNDYTSAYDAFQQAVNRDSRNPTFWCSIGVLYYQIAQ- 407

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKGDF--------SDAAKQYDMAKRLE 489
                 + +A + +  A  +  + +E+  D G          +DA   Y  A RL+
Sbjct: 408 ------YRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQVNDALDAYKQAARLD 457

>Suva_2.489 Chr2 complement(863483..865462) [1980 bp, 659 aa] {ON}
           YDR320C (REAL)
          Length = 659

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDP---VFYANISACYVSLNDFEKVLENCN 163
            K KG  LFK      +++ Y+ +L     K P   +  +NI A  + + ++ K +EN +
Sbjct: 373 FKAKGTSLFKNGDYVNSLQEYEKSLNSLPLKHPLRIIALSNIIASQLKIGEYSKSIENSD 432

Query: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193
            AL L P                      + K+++RRA ++E++E+F +A+
Sbjct: 433 TALALFPANKSSWNDKISKSDPQRSYNDIWPKIMIRRAESFEHLESFKNAL 483

>TBLA0G01050 Chr7 complement(262407..263459) [1053 bp, 350 aa] {ON}
           Anc_6.21 YOR007C
          Length = 350

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/74 (29%), Positives = 42/74 (56%), Gaps = 1/74 (1%)

Query: 106 ALALKDKGNELFKEKAVEEAIKYYQWALEF-KKDPVFYANISACYVSLNDFEKVLENCNK 164
           A ALK +GN+    K    A++ Y  A++      V+YAN +A Y S   +++ +++   
Sbjct: 103 AEALKLEGNKAMAAKDYNLAVEKYNAAIKLVPTKAVYYANRAAAYSSQEKYDEAIKDAES 162

Query: 165 ALELKPDYSKVLLR 178
           A++++P++SK   R
Sbjct: 163 AIKVEPNWSKGYSR 176

>CAGL0G10087g Chr7 (962823..967058) [4236 bp, 1411 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189w SKI3
           antiviral protein
          Length = 1411

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 56/107 (52%), Gaps = 10/107 (9%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           + A   AD  +++ A    ++++RL ++  +K  +R    P  ++G A +  +Q      
Sbjct: 644 YLARTYADATNWTLAL---EVSERLVKSEKSKKALRKVSWPYRILGVAYLEKQQD----- 695

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
           AE+   F+ A + DP   ++ +GL Q  L    V++++K+FE A DL
Sbjct: 696 AESIQWFQLALRIDPTDVESWIGLGQSYLNCGRVEASLKVFERALDL 742

>KLTH0F10428g Chr6 (902697..905084) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P14922 Saccharomyces cerevisiae
           YBR112C CYC8 General transcriptional co- repressor acts
           together with Tup1p also acts as part of a
           transcriptional co-activator complex that recruits the
           SWI/SNF and SAGA complexes to promoters
          Length = 795

 Score = 36.6 bits (83), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 49/116 (42%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + T+YH G+++ +  DY  A   F  A   D+ N   +  +  L Y+   +
Sbjct: 303 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQ---I 359

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          +DA   Y  A RL+
Sbjct: 360 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 411

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 27/58 (46%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N   DA+
Sbjct: 344 RNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLTDAL 401

>Ecym_3459 Chr3 (864878..868225) [3348 bp, 1115 aa] {ON} similar to
           Ashbya gossypii ADL344W
          Length = 1115

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 50/116 (43%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + T+YH G+++ +  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 369 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ---I 425

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          +DA   Y  A RL+
Sbjct: 426 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLNDALDAYKQAARLD 477

>SAKL0F16236g Chr6 (1313573..1317799) [4227 bp, 1408 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1408

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 38/146 (26%), Positives = 61/146 (41%), Gaps = 16/146 (10%)

Query: 360 YIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKE 419
           Y  L ++  +  +  E +  F  AL ++ N   ++   GQ Y+     + +   F KA E
Sbjct: 681 YRVLGVSYLEKQKEPESIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATE 740

Query: 420 LDNDNIFA----YIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILAD---- 471
           L  D++FA     I LA +    G+ ++C ++     EK P           IL D    
Sbjct: 741 LAPDHLFAGYFKAISLAGI----GEYEQCIEIIAALLEKLPNEESFQVSMVNILIDYSVE 796

Query: 472 ---KGDFSDAAKQ-YDMAKRLEEAIS 493
              +G  + A  Q  D  KR+E  IS
Sbjct: 797 LFSQGYLAKAVAQAVDSIKRIEYIIS 822

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 51/119 (42%), Gaps = 8/119 (6%)

Query: 354 FPRVNSYIYLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKAD 413
             ++  Y+  A  +  +G+  E +     AL L+ N        G+ Y   ++  K+K +
Sbjct: 1   MSQLKHYLKDAKNALSDGDYDEAIECSKSALNLDKNCYFALVFLGKAYSCVKELGKSKQN 60

Query: 414 FLKAKELDNDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADK 472
           +LKA E+D +N+ A+  L  L     D+      F    E F +       YAEIL  +
Sbjct: 61  YLKAIEIDQENVLAWKGLFMLFKNTNDITS----FTSFDEYFDLCGR----YAEILTSQ 111

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 53/107 (49%), Gaps = 8/107 (7%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPL-VGKATVLARQPSPENFA 522
           +  E   + G++  A+    +A+R+ +A  +K  ++    P  V   + L +Q  PE   
Sbjct: 643 YMTEKYCETGNWQSASM---IAERVVKAEKSKGALQKANWPYRVLGVSYLEKQKEPE--- 696

Query: 523 EATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLA 569
            +   F+ A + D    ++ VGL Q       ++++IK+FE+A +LA
Sbjct: 697 -SIEWFQSALRVDANDVESWVGLGQAYYACGRLEASIKVFEKATELA 742

>Kwal_23.3670 s23 (387536..389944) [2409 bp, 802 aa] {ON} YBR112C
           (CYC8) - 1:1 [contig 253] FULL
          Length = 802

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/116 (23%), Positives = 47/116 (40%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE++   + T+YH G+++ +  DY  A   F  A   D+ N   +  +  L Y+    
Sbjct: 307 KSLEVDSTDATTWYHLGRIHMVRNDYTAAYDAFQHAVNRDSRNPTFWCSIGVLYYQISQY 366

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            +    +  A    P       + +E+  D G          +DA   Y  A RL+
Sbjct: 367 RDALDAYTRAIRLNP-------YISEVWYDLGTLYETCNNQLTDALDAYKQAARLD 415

>KLLA0C08910g Chr3 complement(781726..782073) [348 bp, 115 aa] {ON}
           similar to uniprot|P25638 Saccharomyces cerevisiae
           YCR060W TAH1 HSP90 cofactor interacts with Hsp82p Pih1p
           Rvb1 and Rvb2 contains a single TPR domain with at least
           two TPR motifs
          Length = 115

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKAL 166
            K KGN  +K+    +A+ +Y+ A+ +   +PV Y+N +   + LN++    + C + L
Sbjct: 7   FKIKGNTAYKQNNFTDAVNFYKKAITYDPTNPVGYSNCAMALIKLNNYADASQMCQRGL 65

>TPHA0M00270 Chr13 complement(53640..54773) [1134 bp, 377 aa] {ON}
           Anc_6.21 YOR007C
          Length = 377

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPVFYANISACYVSLNDFEKVLENCNKALE 167
           LK+KGNE  K K   +AI  Y  A++ +  +  +Y N +  Y+  N+F+  + + NK++E
Sbjct: 137 LKEKGNEEMKAKQYSKAIGSYSDAIKLYPTNFNYYNNRALAYIKANNFDHAIIDANKSIE 196

Query: 168 L 168
           +
Sbjct: 197 I 197

>YDR320C Chr4 complement(1106095..1108101) [2007 bp, 668 aa] {ON}
           SWA2Auxilin-like protein involved in vesicular
           transport; clathrin-binding protein required for
           uncoating of clathrin-coated vesicles
          Length = 668

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 51/111 (45%), Gaps = 26/111 (23%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK--KDP---VFYANISACYVSLNDFEKVLENCN 163
            K KG  LFK      +++ Y+ +L       P   +  +NI A  + + ++ K +EN +
Sbjct: 377 FKAKGTSLFKNGDYINSLQEYEKSLNTLPLNHPLRIIALSNIIASQLKIGEYSKSIENSS 436

Query: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193
            ALEL P                      + K+++RRA ++E++E+F  A+
Sbjct: 437 MALELFPSSKAKWKNKISNSDPERSFNDIWPKIMIRRAESFEHLESFKKAL 487

>ADL344W Chr4 (103565..106297) [2733 bp, 910 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR112C (CYC8)
          Length = 910

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 28/116 (24%), Positives = 49/116 (42%), Gaps = 15/116 (12%)

Query: 382 KALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDM 441
           K+LE +   + T+YH G+++ +  DY  A   F +A   D+ N   +  +  L Y+   +
Sbjct: 303 KSLEADSTDATTWYHLGRIHMVRNDYTAAYDAFQQAVNRDSRNPTFWCSIGVLYYQ---I 359

Query: 442 DECKKLFDEAREKFPVAPEVPTFYAEILADKG--------DFSDAAKQYDMAKRLE 489
            + +   D       + P    + +E+  D G          SDA   Y  A RL+
Sbjct: 360 SQYRDALDAYTRAIRLNP----YISEVWYDLGTLYETCNNQLSDALDAYKQAVRLD 411

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 15/58 (25%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 137 KDPVFYANISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMEN-FADAM 193
           ++P F+ +I   Y  ++ +   L+   +A+ L P  S+V       YE   N  +DA+
Sbjct: 344 RNPTFWCSIGVLYYQISQYRDALDAYTRAIRLNPYISEVWYDLGTLYETCNNQLSDAL 401

>KLTH0E11748g Chr5 (1043203..1044339) [1137 bp, 378 aa] {ON} similar
           to uniprot|P33313 Saccharomyces cerevisiae YBR155W CNS1
           cyclophilin seven suppressor component of Hsp90p
           chaperone machinery
          Length = 378

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFKKD-----PVFYANISACYVSLNDFEKVLENCN 163
            K++GN+L++ K  ++A + Y   ++ K D        ++N +AC + L ++ + + +C 
Sbjct: 81  FKNQGNDLYRAKRYKDAREIYNRGIDIKCDDSKVNESLFSNRAACELELKNYRRCVNDCK 140

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
           +AL+      K   R A  +  +    DA
Sbjct: 141 RALQYNVKNIKCYYRIAKAFLLLNKLEDA 169

>CAGL0C01903g Chr3 complement(199487..201796) [2310 bp, 769 aa] {ON}
           similar to uniprot|P38042 Saccharomyces cerevisiae
           YBL084c CDC27 subunit of anaphase-promoting complex
          Length = 769

 Score = 35.4 bits (80), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 44/190 (23%), Positives = 75/190 (39%), Gaps = 14/190 (7%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +++P  +  Y  +G        +  AK  F KA   D  +  AY  +     + G
Sbjct: 574 FEKATKIDPKFAYAYTLQGHECSSNDSFDAAKKCFRKAIACDPRHYNAYYGMGIYSMKLG 633

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQ-YDMAKRLEEAISAKTGI 498
             DE    F++AR+ +P+   V      +  +K ++ D A + Y++A  L+   +     
Sbjct: 634 HYDEALLYFEKARQIYPIN-AVLICCCGVALEKLEYQDKALEYYELACTLQPNSNLARFK 692

Query: 499 RVGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSA 558
           R  +   +G+  +            A   FEE  K  P        L QL       + A
Sbjct: 693 RANLLYAMGRYNL------------ALQSFEELSKLTPEEPTVHFVLGQLYQIMGRKNEA 740

Query: 559 IKMFEEAADL 568
           I+ F  A +L
Sbjct: 741 IREFTVAMNL 750

>KNAG0A03950 Chr1 complement(529620..530780) [1161 bp, 386 aa] {ON}
           Anc_8.506 YBR155W
          Length = 386

 Score = 35.0 bits (79), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 44/89 (49%), Gaps = 5/89 (5%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALE-FKKDPV----FYANISACYVSLNDFEKVLENCN 163
            K++ N+L+K K   +A + Y   ++ F +D       +AN +AC + L ++   + +C 
Sbjct: 88  FKNQANDLYKVKRFRDARELYTKGIKVFCEDKSINESLFANRAACELELKNYRSCVADCQ 147

Query: 164 KALELKPDYSKVLLRRANTYENMENFADA 192
           KA+E+ P   K   R    +  +  F +A
Sbjct: 148 KAMEINPMNLKCFYRMGKAFLALGKFKEA 176

>TBLA0H01970 Chr8 (464239..466761) [2523 bp, 840 aa] {ON} Anc_5.352
           YDR320C
          Length = 840

 Score = 35.4 bits (80), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 26/103 (25%)

Query: 113 GNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCNKALE 167
           G E FK+   + A+  Y+ +L    +K P   + Y+NI A  + + ++ + +++C+ ALE
Sbjct: 553 GTEFFKKGDYDSALSEYKKSLNTLPQKHPLRLISYSNILAAQLKVGEYSQSVKDCDVALE 612

Query: 168 LKPD---------------------YSKVLLRRANTYENMENF 189
           L P                      + K++LR+A   E+ME +
Sbjct: 613 LFPKNDKQWTQFIQDSDPQKTYKEIWPKIVLRKAEACEHMEKY 655

>ZYRO0D00836g Chr4 complement(62421..66626) [4206 bp, 1401 aa] {ON}
           similar to uniprot|P17883 Saccharomyces cerevisiae
           YPR189W SKI3 dsRNA virus protection family member
           contains 8 copies of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%)

Query: 509 ATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
           AT+     SP+N + A +LFE+  K +P + QAK+G   + +++++   A  +  E    
Sbjct: 443 ATLYIYIDSPKNHSLALSLFEKVLKENPENTQAKMGKGLIFMERQNYTDAKLLLSEVISQ 502

Query: 569 ARTTDEKLQAVTFAEAA 585
                E L  + + EA 
Sbjct: 503 YADNLEFLSELAWCEAC 519

>TDEL0D05500 Chr4 complement(991567..993105) [1539 bp, 512 aa] {ON}
           Anc_3.481 YGR123C
          Length = 512

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 36/62 (58%), Gaps = 5/62 (8%)

Query: 363 LALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADF---LKAKE 419
           LA    DN +SS  + + D+AL+L+P ++  Y+ RG  Y    +++KAK D    LKAK 
Sbjct: 54  LAHLKLDNFQSS--LNDCDEALKLDPKNAKAYHRRGLSYIGLLEFKKAKNDLQIVLKAKP 111

Query: 420 LD 421
            D
Sbjct: 112 GD 113

>TBLA0B04990 Chr2 (1171599..1175831) [4233 bp, 1410 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1410

 Score = 35.0 bits (79), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 39/76 (51%)

Query: 509 ATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
            TV     +P+N   A +LFE+    DP + +AK+G   + +++E+ + A  + +E  + 
Sbjct: 449 GTVYTYVDAPKNHNAALSLFEKIISEDPGNARAKMGKGIIFMERENWNDANNLLKEVTEE 508

Query: 569 ARTTDEKLQAVTFAEA 584
                E L  + ++EA
Sbjct: 509 FPDNLEILSELGWSEA 524

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 63/126 (50%), Gaps = 10/126 (7%)

Query: 446 KLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP- 504
           K +++A E  P   E   +     AD  +++ AA    +A+RL ++  AK G++    P 
Sbjct: 622 KCYNKAFELNPGDIEAAKYMTSKYADNQNWTAAAI---VAERLVKSEKAKKGLKRENWPY 678

Query: 505 -LVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFE 563
            ++G + +  +Q      A++   F+ A + D    ++ VGL Q       ++++IK+FE
Sbjct: 679 RVIGISYLEKQQA-----ADSIEWFQSAIRVDDSDVESWVGLGQSYYSCGRIEASIKVFE 733

Query: 564 EAADLA 569
           +  +L+
Sbjct: 734 KPLELS 739

>KAFR0C01850 Chr3 (369596..371536) [1941 bp, 646 aa] {ON} Anc_5.352
           YDR320C
          Length = 646

 Score = 34.7 bits (78), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 56/121 (46%), Gaps = 26/121 (21%)

Query: 112 KGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCNKAL 166
           +G+  FK      A++ Y+ +L    +  P   + Y+NI+A  + + ++  +++  +KAL
Sbjct: 363 RGSSFFKNGDYISALEEYEKSLNTLPQSHPLRIIAYSNITAAELKIGEYSNLVKKADKAL 422

Query: 167 ELKPD---------------------YSKVLLRRANTYENMENFADAMFDLSVLSLNNDF 205
           +L P                      +SK++LR+A   E++ENF  A      L  NN F
Sbjct: 423 KLFPKENLKWNLIIQDSEPHKSYKDIWSKLVLRKAEALEHLENFELAYKQYHSLIENNVF 482

Query: 206 S 206
           S
Sbjct: 483 S 483

>KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {ON}
           Anc_1.182 YJL164C
          Length = 424

 Score = 34.3 bits (77), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 23/41 (56%), Gaps = 1/41 (2%)

Query: 77  ETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELF 117
           ETP  P    G+ D SQ D Y PE+ ETY +  +D  + LF
Sbjct: 382 ETPYEPPIQQGQGDTSQFDRY-PEEDETYGVVCEDPYSNLF 421

>NCAS0D04500 Chr4 (855490..855855) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 33/75 (44%), Gaps = 1/75 (1%)

Query: 110 KDKGNELFKEKAVEEAIKYYQWA-LEFKKDPVFYANISACYVSLNDFEKVLENCNKALEL 168
           K +GN LFK      A K+Y    +E   +P+ Y+N +   +    F++ +  CN  L  
Sbjct: 7   KTEGNRLFKLGDYTAANKFYDLCIMEEPTNPIGYSNKAMSLIKQEHFDQAIRTCNTGLLY 66

Query: 169 KPDYSKVLLRRANTY 183
             D     ++R   Y
Sbjct: 67  SSDPEHEAIKRKLQY 81

>TDEL0A07430 Chr1 (1296631..1297005) [375 bp, 124 aa] {ON} Anc_6.328
           YCR060W
          Length = 124

 Score = 32.3 bits (72), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKALE 167
           LK +GN  ++++    A+++Y   LE    +P+ ++N + C + LN  ++  + C   L 
Sbjct: 7   LKAQGNSCYQQQDYAGALRWYDQCLEADATNPIAHSNRAMCLIKLNRSQEAQKACQAGLA 66

Query: 168 L 168
           L
Sbjct: 67  L 67

>AGL294W Chr7 (154711..156681) [1971 bp, 656 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL084C (CDC27)
          Length = 656

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 28/55 (50%)

Query: 371 GESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNI 425
           G+ S  + NF+K  +L PN +  ++  GQLY I    + A   F  A  LD + I
Sbjct: 588 GQYSNALQNFEKLEQLTPNEAPVHFLLGQLYQIVGRKKDAITQFTIAMNLDPNGI 642

>KAFR0J02570 Chr10 (488372..488737) [366 bp, 121 aa] {ON} Anc_6.328
           YCR060W
          Length = 121

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKAL 166
            K +GN+ FKE     AIK Y+  +E   ++P+ Y+N +   +  N  ++ +  C   L
Sbjct: 6   FKTEGNQYFKEGNYASAIKSYEKCIEINPENPIGYSNKAMALIKANKNQEAVRTCQDGL 64

>Skud_2.24 Chr2 complement(50790..53099) [2310 bp, 769 aa] {ON}
           YBL084C (REAL)
          Length = 769

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 64/190 (33%), Gaps = 46/190 (24%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +L+PN +  Y  +G  +        AK  + KA   D+ +  AY  L     + G
Sbjct: 574 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDSQHYNAYYGLGTSSMKLG 633

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIR 499
             +E    F++AR   PV   +       L   G + + A QY                 
Sbjct: 634 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLG-YKEKALQY----------------- 675

Query: 500 VGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAI 559
                                       +E AC   P S  +K  + QLL      + A+
Sbjct: 676 ----------------------------YELACHLQPTSSLSKYKMGQLLYSMTRYNVAL 707

Query: 560 KMFEEAADLA 569
           + FEE   L 
Sbjct: 708 QTFEELVKLV 717

>Smik_4.579 Chr4 complement(1032558..1034561) [2004 bp, 667 aa] {ON}
           YDR320C (REAL)
          Length = 667

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 26/111 (23%), Positives = 52/111 (46%), Gaps = 26/111 (23%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCN 163
            K KG+  FK      +++ Y+ +L       P   +  +NI A  + + ++ K +EN +
Sbjct: 377 FKAKGSNFFKNGDYVNSLQEYEKSLNSLPSNHPLRIIALSNIIASQLKVGEYSKSIENSS 436

Query: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193
            AL L P                      + K+++RRA ++E++E+F++A+
Sbjct: 437 MALALFPPTKANWSNMISDSDPQRSFNDIWPKIMIRRAESFEHLESFSNAL 487

>ZYRO0D12364g Chr4 (1037070..1039499) [2430 bp, 809 aa] {ON} similar
           to Q12309 YDR416W uniprot|Q04048 Saccharomyces
           cerevisiae CLF1 sssential splicesome assembly factor
          Length = 809

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 2/82 (2%)

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           D  L  NPNS  T+ HR  L+   +D     A+ + A  +D   +F    LA +      
Sbjct: 374 DLRLRQNPNSVETWRHRATLFQTIKDKCNVYAEAILA--IDASKVFVPGSLATIWCEHAA 431

Query: 441 MDECKKLFDEAREKFPVAPEVP 462
           +    K FD A+E +  A  VP
Sbjct: 432 LYWNAKAFDTAKEIWDRALRVP 453

>Suva_16.521 Chr16 (895057..899331) [4275 bp, 1424 aa] {ON} YPR189W
           (REAL)
          Length = 1424

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 53/107 (49%), Gaps = 10/107 (9%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           +  E  A K ++  A+    +A RL +   AK  IR    P  +VG A +  ++ S    
Sbjct: 660 YITETYASKPNWQAASS---IASRLIKGEKAKAEIRSNNWPFRVVGIAHLEKQEES---- 712

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL 568
            ++   F+ A + DP   ++ VGL Q       ++++IK+F++A +L
Sbjct: 713 -DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIEL 758

>Smik_16.453 Chr16 (775191..779444) [4254 bp, 1417 aa] {ON} YPR189W
           (REAL)
          Length = 1417

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 73/154 (47%), Gaps = 18/154 (11%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           +  E  A+K ++  A+    +A RL +   AK  +R    P  +VG A +  ++ S    
Sbjct: 652 YITETYANKPNWQAASS---IASRLIKGEKAKAELRKNNWPFRVVGIAHLEKQEES---- 704

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL--ARTTDEKLQAV 579
            ++   F+ A + DP   ++ VGL Q       ++++IK+F++A  L  + T  +  +AV
Sbjct: 705 -DSIEWFQSALRIDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTYAQYFKAV 763

Query: 580 T------FAEAAKVQKKIRADPIIRAKVEEALAE 607
           +      + E+ ++ KK+  +       + AL E
Sbjct: 764 SLCDIGEYLESLEILKKVCQEDSTEESFQSALVE 797

>KNAG0I02520 Chr9 complement(487699..488052) [354 bp, 117 aa] {ON}
           Anc_6.328 YCR060W
          Length = 117

 Score = 31.6 bits (70), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 14/60 (23%), Positives = 31/60 (51%), Gaps = 1/60 (1%)

Query: 108 ALKDKGNELFKEKAVEEAIKYYQWALEFK-KDPVFYANISACYVSLNDFEKVLENCNKAL 166
            +K++GN  F+      A +YY   +  + ++P+ Y+N +   + L  F + ++ C + L
Sbjct: 6   TVKEQGNVAFRNSNFSSAAEYYGKCICLEPENPIGYSNRAMALIKLQKFSETIDTCQRGL 65

>NCAS0F02870 Chr6 complement(573068..575170) [2103 bp, 700 aa] {ON}
           Anc_5.352 YDR320C
          Length = 700

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 36/75 (48%), Gaps = 21/75 (28%)

Query: 140 VFYANISACYVSLNDFEKVLENCNKALELKPD---------------------YSKVLLR 178
           + Y+NI A  + + ++ K L+N + ALE+ PD                     + KV LR
Sbjct: 442 IAYSNIIASELKIGEYSKSLKNSSSALEMFPDDTAQWTAVIQDSDPQRTYKDIWPKVKLR 501

Query: 179 RANTYENMENFADAM 193
           +A   E++E+F  A+
Sbjct: 502 QAEALEHIESFKAAL 516

>TPHA0E00740 Chr5 complement(142456..144696) [2241 bp, 746 aa] {ON}
           Anc_7.412 YBL084C
          Length = 746

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 48/177 (27%), Positives = 73/177 (41%), Gaps = 5/177 (2%)

Query: 316 AQNLNEKFAIALEYSGIFKFLKNDVIG-AQAAVNEAIKLFP-RVNSYIYLALTSADNGES 373
           A  ++ KFA A    G  ++  +D    A+    +AI   P   N+Y  L + S   G+ 
Sbjct: 554 ATQVDPKFAYAYTLQG-HEYTSSDSFDVAKRCYRKAIACDPGHYNAYYGLGMVSMKLGQY 612

Query: 374 SEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQ-KAKADFLKAKELDNDNIFAYIQLA 432
            E +  F+KA  +NP  +      G +      YQ KA   +  A EL   +  A  + A
Sbjct: 613 EEALLFFEKARSINP-INVVLVCCGGVALEKLSYQEKALQYYELACELQPSSSLATFKRA 671

Query: 433 CLCYREGDMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLE 489
            L Y  G      K F+E +   P    V     +I +  G   DA K+Y +A  L+
Sbjct: 672 HLLYSMGRYTLALKFFEELKHVAPDEATVHFLLGQIYSILGRKKDAIKEYTIALNLD 728

>YBL084C Chr2 complement(67169..69445) [2277 bp, 758 aa] {ON}
           CDC27Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition
          Length = 758

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 42/190 (22%), Positives = 63/190 (33%), Gaps = 46/190 (24%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +L+PN +  Y  +G  +        AK  + KA   D  +  AY  L     + G
Sbjct: 563 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSAMKLG 622

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIR 499
             +E    F++AR   PV   +       L   G + + A QY                 
Sbjct: 623 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLG-YKEKALQY----------------- 664

Query: 500 VGVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAI 559
                                       +E AC   P S  +K  + QLL      + A+
Sbjct: 665 ----------------------------YELACHLQPTSSLSKYKMGQLLYSMTRYNVAL 696

Query: 560 KMFEEAADLA 569
           + FEE   L 
Sbjct: 697 QTFEELVKLV 706

>Ecym_7142 Chr7 complement(287110..289137) [2028 bp, 675 aa] {ON}
           similar to Ashbya gossypii AGL294W
          Length = 675

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%)

Query: 371 GESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNI 425
           G+ S  + NF+K  +L PN +  ++  GQLY I    + A   F  A  LD   I
Sbjct: 607 GQYSNALQNFEKLEQLTPNEAPIHFLLGQLYQIVGRKKDAITQFTIAMNLDPKGI 661

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 61/258 (23%), Positives = 98/258 (37%), Gaps = 43/258 (16%)

Query: 302 YRELFSKASDEEKLAQNLNE------KFAIALEYSGIFKFLKNDVIGAQAAVNEAIKLFP 355
           Y  L     D+ +LA   +E      K AI     G    L  D   A  A+ +A  L P
Sbjct: 429 YSTLLWHLHDKIRLADLCHELMEQDDKSAITWCCLGNLFSLNRDHDEAIKALKKATNLDP 488

Query: 356 RVNSYIYLALTSADNGESSEYVTN---------FDKALELNPNSSATYYHRGQLYFITQD 406
           R  +Y Y         +  EY  N         + KAL +NPN    +Y  G        
Sbjct: 489 RF-AYAYTL-------QGHEYSNNDAFDNAKMCYRKALAINPNHYNAHYGLGMSCIKLGQ 540

Query: 407 YQKAKADFLKAKELDNDNIFAYIQLACLCY----REGDMDECKKLFDEAREKFPVAPEVP 462
           Y +A   F KA+ ++  N+     L C C     R G  ++    +  A E  P +    
Sbjct: 541 YDEALLHFEKARSINPVNVI----LNCCCGVALERLGRREKALDFYQLACELQPNSSLAL 596

Query: 463 TFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVGKATVLARQPSPENFA 522
              +++L + G +S+A + ++   +LE+    +  I   +  L     ++ R+       
Sbjct: 597 FKKSQLLFNLGQYSNALQNFE---KLEQLTPNEAPIHFLLGQLY---QIVGRK------K 644

Query: 523 EATTLFEEACKRDPRSEQ 540
           +A T F  A   DP+  Q
Sbjct: 645 DAITQFTIAMNLDPKGIQ 662

>ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} similar
           to uniprot|P05986 Saccharomyces cerevisiae YKL166C TPK3
           Involved in nutrient control of cell growth and division
           cAMP-dependent protein kinase catalytic subunit and to
           YJL164C uniprot|P06244 Saccharomyces cerevisiae YJL164C
           TPK1 putative catalytic subunit of cAMP- dependent
           protein kinase
          Length = 396

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 77  ETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKE 119
           ETP  P    G+ D SQ D Y PE+   Y +A  D  + LF E
Sbjct: 354 ETPYEPPIQQGQGDTSQFDRY-PEEEINYGIAGHDPYDNLFDE 395

>KNAG0C05500 Chr3 (1069670..1071427) [1758 bp, 585 aa] {ON}
           Anc_5.352 YDR320C
          Length = 585

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 52/118 (44%), Gaps = 26/118 (22%)

Query: 112 KGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCNKAL 166
           KG ELFK+     A+  Y+ +L    +K P   +  +N+   Y+ + ++ K L+    AL
Sbjct: 296 KGTELFKKGDYSAAVLEYEKSLNTLPEKHPLRIIAMSNMMLPYLKIGEYTKCLKLAPLAL 355

Query: 167 ELKPD---------------------YSKVLLRRANTYENMENFADAMFDLSVLSLNN 203
           EL P+                     +SK+++R A   E+ EN+  A  +  +L  N 
Sbjct: 356 ELIPEDRSTWRSVIQQSEPKRTYRDIWSKLVMRLAEAQEHAENYTGAFDNYQLLVANG 413

>KLLA0B03520g Chr2 (317409..321614) [4206 bp, 1401 aa] {ON} similar
           to uniprot|P17883 Saccharomyces cerevisiae YPR189W SKI3
           dsRNA virus protection family member contains 8 copies
           of the tetratricopeptide (TPR) domain
          Length = 1401

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/58 (27%), Positives = 31/58 (53%)

Query: 509 ATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAA 566
           AT      +P+N   A +LF++    DP++ QAK+G   + ++ ++   A K  ++A 
Sbjct: 447 ATTYTYFEAPKNHNIALSLFDKVLLEDPKNAQAKMGKGLIFIEMKNWQEACKFLKDAV 504

>TBLA0D00460 Chr4 complement(113831..116338) [2508 bp, 835 aa] {ON}
           Anc_7.412 YBL084C
          Length = 835

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 68/183 (37%), Gaps = 14/183 (7%)

Query: 388 PNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGDMDECKKL 447
           PN+S ++   G  + +  D+ KA     KA  ++    +AY         EG        
Sbjct: 615 PNNSISWCFIGNYFSLINDHDKAIKYLKKATTINPRFTYAYT-------LEGHEQASIDA 667

Query: 448 FDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAPLVG 507
           FD A+  +  A      +       G       QYD A    E   AK         L  
Sbjct: 668 FDTAKNCYRKAIACDPNHYNAYYGLGTCCMRLGQYDQALLYFEK--AKMINPSNAILLCC 725

Query: 508 KATVLARQPSPENFAE-ATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAA 566
             + L +     NF E A   +E AC   P S  AK  LA+LL      + A+++ E+  
Sbjct: 726 CGSALEKL----NFNEKALNYYELACNLQPNSSFAKFKLAKLLYSMSRYNLALEILEQVI 781

Query: 567 DLA 569
           ++A
Sbjct: 782 EMA 784

>NCAS0H03540 Chr8 (672730..675012) [2283 bp, 760 aa] {ON} Anc_2.665
           YKL022C
          Length = 760

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 46/104 (44%), Gaps = 2/104 (1%)

Query: 362 YLALTSADNGESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELD 421
           Y++     NG++  ++ + + A E  P S+ T++     Y   +D  KA+  F KA  LD
Sbjct: 441 YISCLYEQNGKNKLFLLSHNLA-EKFPKSAITWFSVATYYMAIEDVPKARKYFSKASILD 499

Query: 422 NDNIFAYIQLACLCYREGDMDECKKLFDEAREKFPVAPEVPTFY 465
                A++  A     EG+ D+    +  A   FP    VP  +
Sbjct: 500 PSFSAAWLGFAHTYGLEGEHDQALSAYATAARFFP-GIHVPNLF 542

>Smik_2.36 Chr2 complement(61159..63414) [2256 bp, 751 aa] {ON}
           YBL084C (REAL)
          Length = 751

 Score = 32.7 bits (73), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 47/114 (41%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +L+PN +  Y  +G  +        AK  + KA   D  +  AY  L     + G
Sbjct: 556 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 615

Query: 440 DMDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAIS 493
             +E    F++AR   PV   +       L   G    A + Y++A  L+   S
Sbjct: 616 QYEEALLYFEKARSINPVNVVLICCCGGSLEKLGYKEKALQYYELACHLQPTSS 669

>YPR189W Chr16 (912664..916962) [4299 bp, 1432 aa] {ON}  SKI3Ski
           complex component and TPR protein, mediates 3'-5' RNA
           degradation by the cytoplasmic exosome; null mutants
           have superkiller phenotype of increased viral dsRNAs and
           are synthetic lethal with mutations in 5'-3' mRNA decay
          Length = 1432

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 60/126 (47%), Gaps = 12/126 (9%)

Query: 464 FYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRVGVAP--LVGKATVLARQPSPENF 521
           +  E  A K ++  A+    +A RL +   AK  +R    P  +VG A +  ++ S    
Sbjct: 667 YITETYASKPNWQAASS---IASRLIKGEKAKAELRSNNWPFRVVGIAHLEKQEES---- 719

Query: 522 AEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADL--ARTTDEKLQAV 579
            ++   F+ A + DP   ++ VGL Q       ++++IK+F++A  L  + T  +  +A+
Sbjct: 720 -DSIEWFQSALRVDPNDVESWVGLGQAYHACGRIEASIKVFDKAIQLRPSHTFAQYFKAI 778

Query: 580 TFAEAA 585
           +  +  
Sbjct: 779 SLCDVG 784

>Skud_4.586 Chr4 complement(1042397..1044325) [1929 bp, 642 aa] {ON}
           YDR320C (REAL)
          Length = 642

 Score = 32.3 bits (72), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 50/111 (45%), Gaps = 26/111 (23%)

Query: 109 LKDKGNELFKEKAVEEAIKYYQWALEF--KKDP---VFYANISACYVSLNDFEKVLENCN 163
            K KG  LFK      +++ Y+ AL       P   +  +NI A  + + ++ K + N +
Sbjct: 359 FKAKGATLFKNGDYVNSLQEYEKALNSLPSNHPLRIIGLSNIIASQLKVGEYSKSIVNSD 418

Query: 164 KALELKPD---------------------YSKVLLRRANTYENMENFADAM 193
            AL L P                      + K+++RRA ++E++E+F +A+
Sbjct: 419 LALALFPPAKASWNNKISNSDPQRSFNDIWPKIMIRRAESFEHLESFKNAL 469

>KLTH0H14872g Chr8 complement(1289638..1291509) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|Q06677 Saccharomyces
           cerevisiae YDR320C SWA2 auxilin-like protein
          Length = 623

 Score = 32.0 bits (71), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/135 (20%), Positives = 60/135 (44%), Gaps = 31/135 (22%)

Query: 83  ITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKEKAVEEAIKYYQWALE-----FKK 137
           + A+  P+L++L+ ++ E+        K+KG   F+      A + Y+ +L         
Sbjct: 309 VPATYSPNLTELERHSFEE-------FKEKGANSFRTGDYHAAFQNYEKSLNSLPLTHPL 361

Query: 138 DPVFYANISACYVSLNDFEKVLENCNKALELKPD-------------------YSKVLLR 178
             V ++NI  C + + ++ + L + + AL+L P                    +SK++  
Sbjct: 362 RVVSFSNIIICRLKVGEYREALSDASSALKLIPQGSMNSNIPNLNPPKTYKEFWSKIMNN 421

Query: 179 RANTYENMENFADAM 193
           +A  +E +EN+  A+
Sbjct: 422 KAVAFERVENYEKAL 436

>CAGL0B01375g Chr2 complement(123330..126662) [3333 bp, 1110 aa]
           {ON} similar to uniprot|P89105 Saccharomyces cerevisiae
           YOL145c CTR9 required for G1 cyclin expression
          Length = 1110

 Score = 32.3 bits (72), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 520 NFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAADLARTTDEKLQAV 579
           ++ +A T+F+E+ KRD  +  A++GL Q  ++   V+ +I  FE         +E +Q +
Sbjct: 352 DYRKAFTMFQESLKRDENNLLARLGLGQTQIKNSLVEESILTFES----LYKANENVQEL 407

Query: 580 TFAEAAKVQKKIRADP 595
            +        K  ADP
Sbjct: 408 NYILGMLYTAKCIADP 423

>TDEL0H00250 Chr8 complement(33258..37451) [4194 bp, 1397 aa] {ON}
           Anc_7.546 YPR189W
          Length = 1397

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 517 SPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAA 566
           +P+N   A +LFE+    DP +  AK+G   + +++E+  +A  +  E A
Sbjct: 450 APKNHNAAMSLFEKVLTDDPENTHAKLGKGLIFVEREEWANANALLNEVA 499

>Skud_15.245 Chr15 (431002..433254) [2253 bp, 750 aa] {ON} YOR080W
           (REAL)
          Length = 750

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 27/49 (55%)

Query: 144 NISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADA 192
           NI ACY  L+D +  L+   ++L+L PD  K  +R   T   ++++  A
Sbjct: 92  NICACYEKLDDLKSCLKISRRSLKLDPDNVKCYIRCTRTLIKLKDWKRA 140

>KAFR0B00350 Chr2 complement(80065..81090) [1026 bp, 341 aa] {ON}
           Anc_7.536 YPR180W
          Length = 341

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 49/101 (48%), Gaps = 10/101 (9%)

Query: 194 FDL-SVLSLNNDFSGASIEPMLERNLNKQAMKMLKERLENTQDKFEQPLPSDTSMASFFG 252
           FD+ SV S+N DF   + + ++   LN++  +MLK  +     KF  PL    S   F  
Sbjct: 107 FDIESVDSINEDFF-KNFDLIIATELNRE--QMLK--INQITRKFNIPLYLSGSNGLFSY 161

Query: 253 IFKPETEFKGYDETCEADRTLQTGLLELFAATHVGFVKADT 293
           IF    EFK  DE  ++ +  +TG    + +TH   V  +T
Sbjct: 162 IFVDLIEFKSEDEKLKSIKATETG----YISTHREIVHVET 198

>KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P05986 Saccharomyces
           cerevisiae YKL166C TPK3 and highly similar to
           uniprot|P06244 Saccharomyces cerevisiae YJL164C TPK1
          Length = 381

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 77  ETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKE 119
           ETP  P   +G+ D SQ D Y PE+  +Y     D  ++LF E
Sbjct: 339 ETPYEPPVHAGQGDTSQYDRY-PEEENSYGAEGDDPHHDLFAE 380

>Suva_11.150 Chr11 (282785..285430) [2646 bp, 881 aa] {ON} YKL073W
           (REAL)
          Length = 881

 Score = 32.0 bits (71), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 20/28 (71%)

Query: 420 LDNDNIFAYIQLACLCYREGDMDECKKL 447
           L +D +F+  +++C+C  E D+DE K++
Sbjct: 532 LSSDRLFSVQEVSCICLNENDVDESKQI 559

>Suva_2.34 Chr2 complement(63832..65304,65365..66183) [2292 bp, 763
           aa] {ON} YBL084C (REAL)
          Length = 763

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 35/78 (44%)

Query: 380 FDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREG 439
           F+KA +L+PN +  Y  +G  +        AK  + KA   D  +  AY  L     + G
Sbjct: 568 FEKATQLDPNFAYAYTLQGHEHSSNDSSDSAKTCYRKALACDPQHYNAYYGLGTSSMKLG 627

Query: 440 DMDECKKLFDEAREKFPV 457
             +E    F++AR   PV
Sbjct: 628 QYEEALLYFEKARSINPV 645

>YOR080W Chr15 (474594..476792) [2199 bp, 732 aa] {ON}
           DIA2Origin-binding F-box protein; forms an SCF ubiquitin
           ligase complex with Skp1p and Cdc53p; plays a role in
           DNA replication; plays a role in transcription; required
           for correct assembly of RSC complex, correct
           RSC-mediated transcription regulation, and correct
           nucleosome positioning; involved in invasive and
           pseudohyphal growth
          Length = 732

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 26/49 (53%)

Query: 144 NISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENMENFADA 192
           NI ACY  LND +  L+   + L+L+P   K  +R   T   ++++  A
Sbjct: 83  NICACYEKLNDLKSCLDVSQRLLKLEPGNIKCYIRCTRTLIKLKDWKRA 131

>TDEL0H02430 Chr8 (407748..409409) [1662 bp, 553 aa] {ON} Anc_7.204
           YFR037C
          Length = 553

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 23/62 (37%), Positives = 36/62 (58%), Gaps = 8/62 (12%)

Query: 535 DPRSEQAKVGLAQ-LLLQQEDVDSAIKMFEE----AAD---LARTTDEKLQAVTFAEAAK 586
           D  SE  K+ +++ L+L  + VDS IK+ EE     AD   L + TD+++QA++ AE   
Sbjct: 488 DLNSELGKLNISKKLVLISDQVDSGIKLVEEEEGAGADKEPLQKQTDQEIQALSHAEPQM 547

Query: 587 VQ 588
            Q
Sbjct: 548 YQ 549

>AEL281C Chr5 complement(111535..115707) [4173 bp, 1390 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR189W
           (SKI3)
          Length = 1390

 Score = 31.6 bits (70), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 509 ATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIKMFEEAAD 567
           ATV     SP+  + A +LF++    DP++ +AK+  + +L++++  D A  + +   D
Sbjct: 439 ATVYTYLESPKYHSIALSLFDKVLADDPQNYRAKLKKSHILIERKQWDEAYALLKGVVD 497

>ZYRO0B03828g Chr2 (318153..320336) [2184 bp, 727 aa] {ON} similar
           to uniprot|P38042 Saccharomyces cerevisiae YBL084C CDC27
           Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
          Length = 727

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 43/189 (22%), Positives = 70/189 (37%), Gaps = 12/189 (6%)

Query: 381 DKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLACLCYREGD 440
           ++ LE  P+   T+   G LY + +D+ +A   F KA E+D    + Y            
Sbjct: 499 NELLETQPDKPQTWCSLGNLYSLQRDHDEAIRYFEKATEVDPHFAYGYTLQGHEHSSNDS 558

Query: 441 MDECKKLFDEAREKFPVAPEVPTFYAEILADKGDFSDAAKQYDMAKRLEEAISAKTGIRV 500
           +D  K  + +A    P                G + +A   ++ A+ +           V
Sbjct: 559 IDMAKTCYRKAIASDPQHYNAYYGLGMCCMKLGQYEEALLYFEKARSINP---------V 609

Query: 501 GVAPLVGKATVLARQPSPENFAEATTLFEEACKRDPRSEQAKVGLAQLLLQQEDVDSAIK 560
            V  +      L +    E   +A   +E A +  P S  AK   A LL        A++
Sbjct: 610 NVILICCCGVALEKMSYQE---KALQYYELASELQPSSSLAKFKKAHLLYVMARYSVALE 666

Query: 561 MFEEAADLA 569
            FEE A+LA
Sbjct: 667 NFEELAELA 675

>ZYRO0D00572g Chr4 complement(42511..44830,45510..45547) [2358 bp,
           785 aa] {ON} similar to uniprot|P09798 Saccharomyces
           cerevisiae YKL022C CDC16 Subunit of the
           anaphase-promoting complex/cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition required for sporulation
          Length = 785

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 60/137 (43%), Gaps = 10/137 (7%)

Query: 301 QYREL--FSKASDEEKLAQNLNEKFAIALEYSGIFKFLKNDVIGAQAAVNEAIK----LF 354
           QY  L  FS A +   LA +   +  + L   G+  F +ND+  A+  +  A++    L 
Sbjct: 574 QYMALNTFSLAEEYFTLAYDTCPQDPLLLNEMGVMYFKRNDLHKAKRYLKRALEAVKELN 633

Query: 355 P--RVNSYIYLALTSADN--GESSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKA 410
           P  R +  I + L  A    GE+   +  F   LE++   S TY   G LY  T++ Q+A
Sbjct: 634 PTSRTSVSIQMNLAHAYRRLGENERAIKCFKTVLEVSSKDSDTYCSLGFLYLKTKELQRA 693

Query: 411 KADFLKAKELDNDNIFA 427
                 A  L   N+ A
Sbjct: 694 IDHLHTALSLKPSNLAA 710

>SAKL0G19712g Chr7 (1697758..1699923) [2166 bp, 721 aa] {ON} similar
           to uniprot|P09798 Saccharomyces cerevisiae YKL022C CDC16
           Subunit of the anaphase-promoting complex/cyclosome
           (APC/C) which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors including mitotic
           cyclins during the metaphase/anaphase transition
           required for sporulation
          Length = 721

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 35/59 (59%), Gaps = 3/59 (5%)

Query: 373 SSEYVTNFDKALELNPNSSATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQL 431
           S+++V N D  ++L    S+  Y RG++Y    +++KAK  F +A ++D  N  A+ +L
Sbjct: 246 SAQHVKNQDGGIKL---ESSLCYLRGKIYSAQNNFEKAKQSFKEAVQVDVKNFEAFDEL 301

>CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa]
           {ON} some similarities with uniprot|P05986 Saccharomyces
           cerevisiae YKL166c TPK3 or uniprot|P06244 Saccharomyces
           cerevisiae YJL164c SRA3 or uniprot|P06245 Saccharomyces
           cerevisiae YPL203w TPK2
          Length = 462

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 77  ETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKE 119
           ETP  P    G+ D SQ D Y PE+   Y +  +D   +LF+E
Sbjct: 420 ETPYEPPIQQGQGDTSQFDRY-PEEEINYGVQGEDPYADLFRE 461

>TBLA0C01010 Chr3 (198773..201367) [2595 bp, 864 aa] {ON} Anc_2.665
           YKL022C
          Length = 864

 Score = 31.2 bits (69), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 2/59 (3%)

Query: 391 SATYYHRGQLYFITQDYQKAKADFLKAKELDNDNIFAYIQLAC--LCYREGDMDECKKL 447
           S+  Y RG++Y    ++ KAK  F+ +  +D  N  AY QL    L   + ++D   KL
Sbjct: 365 SSMSYLRGRIYLYQNNFNKAKTSFINSILIDIKNFEAYEQLTSKNLLTPKEELDLLNKL 423

>KAFR0D02340 Chr4 complement(473431..475524) [2094 bp, 697 aa] {ON}
           Anc_5.689 YOR080W
          Length = 697

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 144 NISACYVSLNDFEKVLENCNKALELKPDYSKVLLRRANTYENM 186
           N++AC+  LND ++ L   +K ++L+P   K  +RR    + +
Sbjct: 72  NLAACWEKLNDLKRALNYSDKMVQLEPYNLKCYIRRGKVLQKL 114

>Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {ON}
           YKL166C (TPK3) - cAMP-dependent protein kinase catalytic
           subunit [contig 108] FULL
          Length = 375

 Score = 30.8 bits (68), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 77  ETPVYPITASGEPDLSQLDSYTPEQRETYALALKDKGNELFKE 119
           ETP  P   +G+ D SQ D Y PE+   Y    +D   +LF E
Sbjct: 333 ETPYEPPVQAGQGDTSQYDRY-PEEEMCYGAEAEDPHRDLFSE 374

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,087,575
Number of extensions: 2474580
Number of successful extensions: 10820
Number of sequences better than 10.0: 282
Number of HSP's gapped: 10789
Number of HSP's successfully gapped: 405
Length of query: 614
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 498
Effective length of database: 40,180,143
Effective search space: 20009711214
Effective search space used: 20009711214
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)