Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H035202.153ON1091095826e-79
Suva_15.3132.153ON1321093382e-41
Skud_8.1772.153ON1301003372e-41
Smik_8.1942.153ON129943345e-41
YHR116W (COX23)2.153ON151943332e-40
CAGL0I02728g2.153ON1111083241e-39
ZYRO0G06534g2.153ON1121123241e-39
SAKL0E10934g2.153ON113993162e-38
KLTH0B05148g2.153ON111913127e-38
TDEL0B051502.153ON1191003112e-37
Kwal_33.147762.153ON111913102e-37
Kpol_505.202.153ON1121103059e-37
NDAI0B043302.153ON127933042e-36
Ecym_82052.153ON114993014e-36
TPHA0F018702.153ON1801123022e-35
NCAS0B070002.153ON1081062928e-35
KLLA0F24024g2.153ON122992939e-35
KAFR0F007302.153ON108962892e-34
ABR130W2.153ON111982562e-29
TBLA0B012402.153ON119701764e-17
NCAS0A105403.265ON87767670.78
KLTH0H02552g6.284ON7747621.5
Suva_10.665.205ON7227611.9
TDEL0A069806.284ON6848602.3
Suva_4.4806.121ON53647632.5
Smik_12.545.205ON6927585.0
YLL009C (COX17)5.205ON6927567.3
Kpol_489.4na 1ON33962598.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03520
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.15...   228   6e-79
Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W...   134   2e-41
Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W (...   134   2e-41
Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W (...   133   5e-41
YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}  COX23Mitoch...   132   2e-40
CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {O...   129   1e-39
ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {O...   129   1e-39
SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly ...   126   2e-38
KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar...   124   7e-38
TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON...   124   2e-37
Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {O...   124   2e-37
Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON} (55992..56...   122   9e-37
NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2....   121   2e-36
Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON} ...   120   4e-36
TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.15...   120   2e-35
NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2....   117   8e-35
KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} simil...   117   9e-35
KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON...   115   2e-34
ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic hom...   103   2e-29
TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON...    72   4e-17
NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON} Anc_3...    30   0.78 
KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa...    28   1.5  
Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}...    28   1.9  
TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {O...    28   2.3  
Suva_4.480 Chr4 complement(838938..840548) [1611 bp, 536 aa] {ON...    29   2.5  
Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}...    27   5.0  
YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}  C...    26   7.3  
Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON} (17106..18...    27   8.9  

>KNAG0H03520 Chr8 (656843..657172) [330 bp, 109 aa] {ON} Anc_2.153
           YHR116W
          Length = 109

 Score =  228 bits (582), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 109/109 (100%), Positives = 109/109 (100%)

Query: 1   MSDGNGKGDTPAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYD 60
           MSDGNGKGDTPAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYD
Sbjct: 1   MSDGNGKGDTPAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYD 60

Query: 61  PCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           PCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE
Sbjct: 61  PCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109

>Suva_15.313 Chr15 (544054..544452) [399 bp, 132 aa] {ON} YHR116W
           (REAL)
          Length = 132

 Score =  134 bits (338), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 61/109 (55%), Positives = 80/109 (73%), Gaps = 1/109 (0%)

Query: 2   SDGNGKGDTPAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYD 60
           SD +     PA  G V+ +  V++ P   +P  F+Y+PD P++  +KYKF  KGDS++YD
Sbjct: 24  SDNSAPPTQPARRGPVTDRSKVNYVPQSNDPSSFQYYPDDPENPVNKYKFALKGDSQYYD 83

Query: 61  PCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           PC+ESSK+SF CLE+N YDR+KC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 84  PCEESSKLSFQCLERNSYDRTKCQDYFDAYRECKKQWLTARRNNRQQWE 132

>Skud_8.177 Chr8 (315505..315897) [393 bp, 130 aa] {ON} YHR116W
           (REAL)
          Length = 130

 Score =  134 bits (337), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 77/100 (77%), Gaps = 1/100 (1%)

Query: 11  PAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMS 69
           PA  G ++ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+S
Sbjct: 31  PAPRGPITDRTKVNYVPKNNDPSSFQYYPDDPENPINKYKFALKADSQYYDPCEESSKLS 90

Query: 70  FTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           F CLE+NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 91  FQCLERNDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 130

>Smik_8.194 Chr8 (318092..318481) [390 bp, 129 aa] {ON} YHR116W
           (REAL)
          Length = 129

 Score =  133 bits (334), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 74/94 (78%)

Query: 16  VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQ 75
           V+ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+SF CLE+
Sbjct: 36  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 95

Query: 76  NDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 96  NDYDRSKCQEYFDAYRECKKQWLTARRNNRQQWE 129

>YHR116W Chr8 (341665..342120) [456 bp, 151 aa] {ON}
           COX23Mitochondrial intermembrane space protein that
           functions in mitochondrial copper homeostasis, essential
           for functional cytochrome oxidase expression; homologous
           to Cox17p; contains twin cysteine-x9-cysteine motifs
          Length = 151

 Score =  132 bits (333), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 74/94 (78%)

Query: 16  VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQ 75
           V+ +  V++ P   +P  F+Y+PD P++  +KYKF  K DS++YDPC+ESSK+SF CLE+
Sbjct: 58  VTDRTKVNYVPKSDDPSSFQYYPDDPENPVNKYKFALKADSQYYDPCEESSKLSFQCLER 117

Query: 76  NDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           NDYDRSKC+ YFDAYRECKKQWL ARR N+ QWE
Sbjct: 118 NDYDRSKCQEYFDAYRECKKQWLTARRKNRQQWE 151

>CAGL0I02728g Chr9 complement(242221..242556) [336 bp, 111 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116w
          Length = 111

 Score =  129 bits (324), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 5/108 (4%)

Query: 1   MSDGNGKGDTPAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYD 60
           + DGN     P V+  + K+ VD+AP G +  E+RY+PD P+S  +KY+F  K  S++YD
Sbjct: 8   IKDGNY---DPHVQ--TDKDKVDYAPKGVDTTEYRYYPDNPESTLNKYRFAMKDHSQYYD 62

Query: 61  PCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQW 108
           PCQES+KMSF CLE NDYDR +CK YFDAYRECKKQWL+ARR +++ W
Sbjct: 63  PCQESAKMSFKCLELNDYDRDQCKEYFDAYRECKKQWLEARRKDRTNW 110

>ZYRO0G06534g Chr7 complement(518228..518566) [339 bp, 112 aa] {ON}
           similar to uniprot|P38824 Saccharomyces cerevisiae
           YHR116W COX23 Mitochondrial intermembrane space protein
           that functions in mitochondrial
          Length = 112

 Score =  129 bits (324), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 81/112 (72%), Gaps = 3/112 (2%)

Query: 1   MSDG---NGKGDTPAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSK 57
           M+DG   N +      + V   + VD+AP G +PD+F+Y+PD P+S   +Y+F  K  S+
Sbjct: 1   MADGDKDNLREGNLDPQLVVEPKKVDYAPQGDSPDKFQYYPDKPESSLSRYRFAVKDASQ 60

Query: 58  FYDPCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           ++DPCQESS+MSF CL++N+YDR  CK YFDAYRECKKQWL+ARR N+S WE
Sbjct: 61  YFDPCQESSRMSFNCLDRNNYDREMCKEYFDAYRECKKQWLRARRENRSLWE 112

>SAKL0E10934g Chr5 (916050..916391) [342 bp, 113 aa] {ON} highly
           similar to gnl|GLV|CAGL0I02728g Candida glabrata
           CAGL0I02728g and similar to YHR116W uniprot|P38824
           Saccharomyces cerevisiae YHR116W COX23 Mitochondrial
           intermembrane space protein that functions in
           mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 113

 Score =  126 bits (316), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 56/99 (56%), Positives = 74/99 (74%), Gaps = 2/99 (2%)

Query: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70
           P +E  + KE V+F P   +   F+++PD P+S  +K++F  K  S+++DPCQESSKMSF
Sbjct: 17  PQLE--TDKEKVNFTPQANDTSSFKFYPDNPESTLNKFRFAAKDPSRYFDPCQESSKMSF 74

Query: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
            CLE N+YDR  CK YFDAYRECKKQWL++RR N+SQWE
Sbjct: 75  KCLEMNNYDRDMCKEYFDAYRECKKQWLQSRRENRSQWE 113

>KLTH0B05148g Chr2 (426037..426372) [336 bp, 111 aa] {ON} similar to
           uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 111

 Score =  124 bits (312), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 57/91 (62%), Positives = 69/91 (75%)

Query: 19  KETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQNDY 78
           K  VD+AP       F+++PD P+S  +KY+F  K  S+FYDPCQESSKMS  CLE N+Y
Sbjct: 21  KTKVDYAPKNTESGSFKFYPDNPESSFNKYRFAAKDASQFYDPCQESSKMSMKCLELNNY 80

Query: 79  DRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           DRS C+ YFDAYRECKKQWL+ARR N+SQWE
Sbjct: 81  DRSMCQEYFDAYRECKKQWLQARRRNRSQWE 111

>TDEL0B05150 Chr2 complement(906670..907029) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score =  124 bits (311), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 75/100 (75%), Gaps = 1/100 (1%)

Query: 11  PAVEG-VSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMS 69
           P V G V     VD+AP G +P +F+Y+P+ P+S  ++  F  KG S++YDPCQES++MS
Sbjct: 20  PNVNGAVKDSSKVDYAPKGQDPSKFQYYPENPESGVNRLMFAIKGPSQYYDPCQESAQMS 79

Query: 70  FTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
             CL++NDY++  CK YFDAYRECKKQWLK+RR ++SQWE
Sbjct: 80  LNCLDRNDYNKDLCKEYFDAYRECKKQWLKSRRQDRSQWE 119

>Kwal_33.14776 s33 complement(812440..812775) [336 bp, 111 aa] {ON}
           YHR116W - Hypothetical ORF [contig 101] FULL
          Length = 111

 Score =  124 bits (310), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 69/91 (75%)

Query: 19  KETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQNDY 78
           K  +D+AP       ++++PD P+S  +K++F  K  S+FYDPCQESSKMS  CLE NDY
Sbjct: 21  KSKIDYAPQDAKAGSYKFYPDNPESSFNKFRFAAKDVSQFYDPCQESSKMSMKCLELNDY 80

Query: 79  DRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           DRS C+ YFDAYRECKKQWL+ARR N+SQWE
Sbjct: 81  DRSMCQEYFDAYRECKKQWLQARRKNRSQWE 111

>Kpol_505.20 s505 (55992..56330) [339 bp, 112 aa] {ON}
           (55992..56330) [339 nt, 113 aa]
          Length = 112

 Score =  122 bits (305), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 59/110 (53%), Positives = 81/110 (73%), Gaps = 4/110 (3%)

Query: 3   DGNGKGDTP-AVEGV--SGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFY 59
           +   K D+P A++    + K  VDFA      D  +++PD P+S   KY+F TK  S++Y
Sbjct: 4   ESKDKLDSPSALDSTLETDKSKVDFANKDDKKD-LKFYPDNPESTLAKYRFITKETSQYY 62

Query: 60  DPCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           DPCQES++MSF CL++N+YD+SKC+AYFDAYRECKKQWL+ARR ++SQWE
Sbjct: 63  DPCQESAQMSFNCLDRNNYDKSKCRAYFDAYRECKKQWLRARRQDRSQWE 112

>NDAI0B04330 Chr2 (1087146..1087529) [384 bp, 127 aa] {ON} Anc_2.153
           YHR116W
          Length = 127

 Score =  121 bits (304), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 71/93 (76%)

Query: 17  SGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQN 76
           + K+TV+F P   +   F+Y+PD P+   +KYKF  K  S++YDPCQESS+MSF CL++N
Sbjct: 34  TTKDTVNFTPDEKDTSTFKYYPDDPEEGMNKYKFMMKDTSEYYDPCQESSQMSFKCLDRN 93

Query: 77  DYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           ++DR KC  YFDAYRECKKQWL ARR N+SQW+
Sbjct: 94  NFDRDKCHEYFDAYRECKKQWLMARRNNRSQWQ 126

>Ecym_8205 Chr8 complement(422048..422392) [345 bp, 114 aa] {ON}
           similar to Ashbya gossypii ABR130W
          Length = 114

 Score =  120 bits (301), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 72/99 (72%)

Query: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70
           P    V+ K  V+F P   +   F+++PD P++  +++KF +KG S +YDPC+ESSKMSF
Sbjct: 16  PKGNVVTDKTKVNFTPTSNDTSTFQFYPDDPEATLNRFKFYSKGASMYYDPCEESSKMSF 75

Query: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
            CLE N+YDRS C  YFDAYRECKKQWLKARR + S+W+
Sbjct: 76  KCLELNNYDRSLCHDYFDAYRECKKQWLKARREDNSKWQ 114

>TPHA0F01870 Chr6 (427543..428085) [543 bp, 180 aa] {ON} Anc_2.153
           YHR116W
          Length = 180

 Score =  120 bits (302), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 79/112 (70%), Gaps = 10/112 (8%)

Query: 2   SDGNGKGDT------PAVEGVSGKETVDFAP--LGGNPDEFRYFPDTPDSITHKYKFQTK 53
           ++ NG  D       P++  V+ KE+VDF    +  N + F+++PD P+S   KY+F +K
Sbjct: 65  NNNNGSNDITKDSYDPSL--VTNKESVDFTKPDITLNENRFKFYPDNPESSFAKYRFMSK 122

Query: 54  GDSKFYDPCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANK 105
             S++YDPC ES+KMSF CL+ NDYDR KC+AYFDAYRECKKQWL+ARR N+
Sbjct: 123 DSSQYYDPCDESAKMSFKCLDMNDYDRDKCRAYFDAYRECKKQWLRARRNNE 174

>NCAS0B07000 Chr2 (1331938..1332264) [327 bp, 108 aa] {ON} Anc_2.153
           YHR116W
          Length = 108

 Score =  117 bits (292), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 75/106 (70%), Gaps = 2/106 (1%)

Query: 6   GKGDTPAVEGVSG--KETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQ 63
           G+ + P  +G +   K+ V+F P   NP  ++YFPD P    +KYKF  KGDS++YDPCQ
Sbjct: 2   GEQEQPEEKGNNSNRKQDVNFTPDEKNPGSYKYFPDDPVQGLNKYKFIMKGDSEYYDPCQ 61

Query: 64  ESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           E S+MS  CLE+N +D+S+C+ YFDAYR+CKK W+K RR N+ QWE
Sbjct: 62  ECSEMSRKCLERNPFDKSQCQEYFDAYRDCKKMWMKTRRENRKQWE 107

>KLLA0F24024g Chr6 (2239420..2239788) [369 bp, 122 aa] {ON} similar
           to uniprot|P38824 Saccharomyces cerevisiae YHR116W COX23
           Mitochondrial intermembrane space protein that functions
           in mitochondrial copper homeostasis essential for
           functional cytochrome oxidase expression homologous to
           Cox17p
          Length = 122

 Score =  117 bits (293), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 54/99 (54%), Positives = 71/99 (71%), Gaps = 2/99 (2%)

Query: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70
           P++E    K  V+F P   + + ++++PD P+S  ++Y+F  KG S++YDPCQESSKMSF
Sbjct: 26  PSLEL--NKTKVNFTPEKTDVNTYKFYPDDPESTLNRYRFAVKGASEYYDPCQESSKMSF 83

Query: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
            CLE N+YDR  C  YFDAYRECKKQWLKARR  +  WE
Sbjct: 84  KCLELNNYDRDLCHDYFDAYRECKKQWLKARREKREFWE 122

>KAFR0F00730 Chr6 complement(143260..143586) [327 bp, 108 aa] {ON}
           Anc_2.153 YHR116W
          Length = 108

 Score =  115 bits (289), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 54/96 (56%), Positives = 73/96 (76%), Gaps = 2/96 (2%)

Query: 16  VSGKETVDFAPL--GGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCL 73
           V+ K  V+F     G N  +F+Y+PD P+S  H+ +F+TK  +K+YDPCQES+++SF CL
Sbjct: 13  VTDKTKVNFVQEDPGTNTTKFKYYPDDPESAYHRDQFRTKQPTKYYDPCQESAQLSFKCL 72

Query: 74  EQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQWE 109
           E N+YDRS CK YFDAYRECKKQWL AR+ ++S+WE
Sbjct: 73  ELNNYDRSLCKDYFDAYRECKKQWLNARKTDRSKWE 108

>ABR130W Chr2 (641041..641376) [336 bp, 111 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR116W
          Length = 111

 Score =  103 bits (256), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 48/98 (48%), Positives = 67/98 (68%), Gaps = 3/98 (3%)

Query: 11  PAVEGVSGKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSF 70
           P+V+  + +  V+F P   +   F+++PD  +S   +Y+   KG S++ DPCQES+ MS 
Sbjct: 16  PSVQ--TDRAAVNFTP-STDASSFQFYPDNLESPLARYRXAAKGPSQYXDPCQESANMSM 72

Query: 71  TCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKSQW 108
            CLE+N+YDR  C+ YFDAYRECKKQWL ARR + SQW
Sbjct: 73  KCLERNNYDRDLCREYFDAYRECKKQWLSARRKDNSQW 110

>TBLA0B01240 Chr2 complement(262962..263321) [360 bp, 119 aa] {ON}
           Anc_2.153 YHR116W
          Length = 119

 Score = 72.4 bits (176), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 32/70 (45%), Positives = 46/70 (65%), Gaps = 1/70 (1%)

Query: 34  FRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCL-EQNDYDRSKCKAYFDAYRE 92
           F+YFPD P S   ++ F  K  SKFYDPC ES++MS  C+ +  D  ++ C  +F AYR+
Sbjct: 46  FQYFPDKPTSTMTRFNFADKESSKFYDPCHESAQMSVRCMTDHPDDHKTVCAEFFAAYRD 105

Query: 93  CKKQWLKARR 102
           CKK W+ A++
Sbjct: 106 CKKAWIDAKK 115

>NCAS0A10540 Chr1 (2097795..2100428) [2634 bp, 877 aa] {ON}
          Anc_3.265 YBR055C
          Length = 877

 Score = 30.4 bits (67), Expect = 0.78,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 4/67 (5%)

Query: 18 GKETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESSKMSFTCLEQND 77
          G+    FA  GGNP   R     P  +  K K Q+  D    D   E ++  F+ +EQ  
Sbjct: 21 GRGATGFATRGGNPSNGR----IPIRLQQKQKNQSLADENKADESDEEAEDIFSAIEQKL 76

Query: 78 YDRSKCK 84
            R+K K
Sbjct: 77 SSRNKRK 83

>KLTH0H02552g Chr8 (227237..227276,227330..227523) [234 bp, 77 aa]
           {ON} similar to uniprot|Q3E7A9 Saccharomyces cerevisiae
           YMR194C-B
          Length = 77

 Score = 28.5 bits (62), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 22/47 (46%)

Query: 58  FYDPCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRAN 104
             DPC+  +     CL +  +D SKC    D+  EC  ++   R A+
Sbjct: 1   MTDPCKPQACAIQGCLTKTGFDESKCSHLIDSLYECCSKFYNERGAD 47

>Suva_10.66 Chr10 complement(136168..136383) [216 bp, 72 aa] {ON}
          YLL009C (REAL)
          Length = 72

 Score = 28.1 bits (61), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 71 TCLEQNDYDRSKCKAYFDAYRECKKQW 97
          TC+  N  D  KCK + D Y+EC K +
Sbjct: 38 TCILFNGQDSDKCKEFIDKYKECMKGY 64

>TDEL0A06980 Chr1 complement(1223058..1223264) [207 bp, 68 aa] {ON}
           Anc_6.284 YMR194C-B
          Length = 68

 Score = 27.7 bits (60), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 60  DPCQESSKMSFTCLEQNDYDRSKCKAYFD-AYRECKKQWLKARRANKS 106
           DPC+  +     CL  +DY  SKC+   D  YR C K + +  + NKS
Sbjct: 3   DPCKPEACAIQNCLISSDYKESKCQDLVDQLYRCCDKFYKEDGKENKS 50

>Suva_4.480 Chr4 complement(838938..840548) [1611 bp, 536 aa] {ON}
           YBR223C (REAL)
          Length = 536

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 22/47 (46%), Gaps = 10/47 (21%)

Query: 20  ETVDFAPLGGNPDEFRYFPDTPDSITHKYKFQTKGDSKFYDPCQESS 66
           E V+FAPL     E  +   TP       KFQ  G + FYD  QE S
Sbjct: 251 EGVNFAPLS----ELEFVYSTPS------KFQPSGLAMFYDKLQEIS 287

>Smik_12.54 Chr12 complement(118226..118432) [207 bp, 69 aa] {ON}
          YLL009C (REAL)
          Length = 69

 Score = 26.9 bits (58), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 71 TCLEQNDYDRSKCKAYFDAYRECKKQW 97
          TC+  N  D  KCK + + Y+EC K +
Sbjct: 35 TCILFNGQDSEKCKEFIEKYKECMKGY 61

>YLL009C Chr12 complement(131205..131414) [210 bp, 69 aa] {ON}
          COX17Copper metallochaperone that transfers copper to
          Sco1p and Cox11p for eventual delivery to cytochrome c
          oxidase; contains twin cysteine-x9-cysteine motifs
          Length = 69

 Score = 26.2 bits (56), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 11/27 (40%), Positives = 16/27 (59%)

Query: 71 TCLEQNDYDRSKCKAYFDAYRECKKQW 97
          TC+  N  D  KCK + + Y+EC K +
Sbjct: 35 TCILFNGQDSEKCKEFIEKYKECMKGY 61

>Kpol_489.4 s489 (17106..18125) [1020 bp, 339 aa] {ON}
           (17106..18125) [1020 nt, 340 aa]
          Length = 339

 Score = 27.3 bits (59), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 8/62 (12%)

Query: 47  KYKFQTKGDSKFYDPCQESSKMSFTCLEQNDYDRSKCKAYFDAYRECKKQWLKARRANKS 106
           +YK   +G +K YD          + L+Q+ Y  +  + YF  Y  C K++++       
Sbjct: 13  RYKCTYEGCTKVYD--------RPSLLQQHRYSHTNERPYFCDYENCGKRFMRPCHLRVH 64

Query: 107 QW 108
           QW
Sbjct: 65  QW 66

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,027,899
Number of extensions: 594597
Number of successful extensions: 1044
Number of sequences better than 10.0: 44
Number of HSP's gapped: 1042
Number of HSP's successfully gapped: 44
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 59 (27.3 bits)