Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032708.255ON64864834960.0
NCAS0B038808.255ON70671817050.0
YDR108W (TRS85)8.255ON69871117020.0
Smik_4.3548.255ON69871116790.0
Suva_2.2688.255ON69570916730.0
Skud_4.3698.255ON69871116560.0
NDAI0J014108.255ON71672216430.0
TDEL0F038208.255ON68770416320.0
KAFR0B055708.255ON66969716290.0
Kpol_392.118.255ON67569916250.0
ZYRO0C01826g8.255ON69971716090.0
CAGL0B01705g8.255ON67270216000.0
Kwal_56.235838.255ON70073614720.0
KLTH0G13860g8.255ON70873114490.0
TPHA0B032608.255ON71471914290.0
SAKL0H17226g8.255ON71974714110.0
TBLA0E043808.255ON88966912271e-157
Ecym_43168.255ON62366211281e-146
KLLA0F18953g8.255ON64768511081e-142
AGR096C8.255ON62366110981e-141
YJR053W (BFA1)1.494ON574103761.4
KLTH0D04444g2.430ON70552724.4
CAGL0M06435gsingletonOFF521125724.5
NDAI0I002506.371ON89769725.0
Cgla_YGOB_M064358.558ON549125715.1
TBLA0C070905.11ON114748725.4
TBLA0D005007.408ON1115238715.6
Ecym_12023.526ON41897699.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03270
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...  1351   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   661   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   660   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   651   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   649   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   642   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   637   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   633   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   632   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   630   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   624   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   620   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   571   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   562   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   555   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   548   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   477   e-157
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   439   e-146
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   431   e-142
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   427   e-141
YJR053W Chr10 (534027..535751) [1725 bp, 574 aa] {ON}  BFA1Compo...    34   1.4  
KLTH0D04444g Chr4 complement(409499..411616) [2118 bp, 705 aa] {...    32   4.4  
CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} simi...    32   4.5  
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    32   5.0  
Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,...    32   5.1  
TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]...    32   5.4  
TBLA0D00500 Chr4 (131830..135177) [3348 bp, 1115 aa] {ON} Anc_7....    32   5.6  
Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 b...    31   9.0  

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score = 1351 bits (3496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/648 (100%), Positives = 648/648 (100%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120
           YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120

Query: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180
           RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL
Sbjct: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180

Query: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240
           LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF
Sbjct: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240

Query: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP 300
           LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP
Sbjct: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP 300

Query: 301 LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML 360
           LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML
Sbjct: 301 LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML 360

Query: 361 IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDTQFFPASSTECLLRK 420
           IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDTQFFPASSTECLLRK
Sbjct: 361 IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDTQFFPASSTECLLRK 420

Query: 421 LADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEI 480
           LADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEI
Sbjct: 421 LADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEI 480

Query: 481 TPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGA 540
           TPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGA
Sbjct: 481 TPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGA 540

Query: 541 CSQVMIWERLSDCYQSRTDPRVASALSTNTSPGSAQPGNEILAQGFTRKRKAAFFRLIAA 600
           CSQVMIWERLSDCYQSRTDPRVASALSTNTSPGSAQPGNEILAQGFTRKRKAAFFRLIAA
Sbjct: 541 CSQVMIWERLSDCYQSRTDPRVASALSTNTSPGSAQPGNEILAQGFTRKRKAAFFRLIAA 600

Query: 601 KKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQSFSM 648
           KKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQSFSM
Sbjct: 601 KKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQSFSM 648

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/718 (48%), Positives = 458/718 (63%), Gaps = 110/718 (15%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+   ETVP +IA+RIVS+A++PVI VTS+  LD HI+E+Y + S 
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YLLFRLFGGCISDRDQL--MEHYTLDDSSTGG---------------RTRKRSNSLFQRD 103
           Y+L R F GC+SDRDQ   +E    D  S+                 R R RSNSLFQRD
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSPLPKVRTRGRSRSNSLFQRD 120

Query: 104 ATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDE 163
           +TQSQ+IRF +PL D++ +      LFD  SLE YL +YL  IQK T           D+
Sbjct: 121 STQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNT-----------DD 169

Query: 164 LTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQD 223
            TP           ++LL+ ++YH+FF+LA+SSTT +SP+E FN PV++LIA+D+S GQ+
Sbjct: 170 NTP-----------YELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQN 218

Query: 224 YEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCL 283
           Y+ VRDL+  FKNLN    +FP+F+N ND+LP+++LCYD     Q  TC+ L +KIKK L
Sbjct: 219 YDDVRDLLVDFKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQL 278

Query: 284 FVDSIPLALW-DEDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPL 342
           FV+ I L LW D  P  P V LH+P+MSSL+E++ F              +      LP 
Sbjct: 279 FVECISLPLWKDSYPSDPQVHLHQPVMSSLEEMIYFL-------------NQPKEVTLPY 325

Query: 343 NIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTT---- 398
            +I  +Y  LD LV  ++IPFM RK  +W+E ILQPRKS+FHG+  F KKF+ KT     
Sbjct: 326 ELIQSIYNILDSLVYNLMIPFMKRKIAFWDETILQPRKSLFHGA-KFLKKFMTKTALTHQ 384

Query: 399 ---TQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC 455
                +D    ++F ++S+E L+RKLADWS+MLSDFKTAY TY+SL++DL++ P Y ASC
Sbjct: 385 ENLLTKDAQGNEYFTSASSEFLMRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASC 444

Query: 456 LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQQGR------------------S 497
           LEWCAVSLL+GAQNIVTVKM+K +I PLIE+A++TY                        
Sbjct: 445 LEWCAVSLLMGAQNIVTVKMLKNDINPLIEKALSTYENCATVLPETDKRNTDELIVVPVR 504

Query: 498 SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSR 557
           SYETRCMIL++ELFL+L DTWTSTPYAI YLETIL +C +LGACSQ+MIWERLSDCY+ R
Sbjct: 505 SYETRCMILASELFLSLSDTWTSTPYAISYLETILVEC-KLGACSQIMIWERLSDCYELR 563

Query: 558 TDPRV----ASALSTNTSPGSAQPGN--------------------------EILAQGFT 587
            DPR+    A  ++  +SP  +   +                          +I+++GFT
Sbjct: 564 VDPRIKHKAAGTIANTSSPKKSSESDMQGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFT 623

Query: 588 RKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQS 645
           RKRKAAFFRL+AAKKWAEQ +WRQV WCL  I D Y+   L D+  L++ ++  ++++
Sbjct: 624 RKRKAAFFRLMAAKKWAEQKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKLKT 681

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/711 (48%), Positives = 458/711 (64%), Gaps = 104/711 (14%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RI+S+A+APVITVTS+   D HI E+YKV S 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YLLFRLFGGCISDRDQL-------MEHYTLDDSSTGGR----------------TRKRSN 97
           Y+L R FGGC+SDRDQ         EH   D S +                   +R RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE +L +YL    KL A + +++
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYL----KLVAANTDEM 176

Query: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217
                             +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 177 ------------------VPHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218

Query: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ +LCY+   + +   C+ L +
Sbjct: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAK 278

Query: 278 KIKKCLFVDSIPLALWDED---PESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334
           K+KK LFV+SI LALW +     E+ ++ LH+P+MSSL+EI+ F                
Sbjct: 279 KLKKQLFVESILLALWKDSFIYDENSVIQLHQPVMSSLEEILFFLQ-------------A 325

Query: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394
            ++  L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 326 PTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGA-KFFKKFM 384

Query: 395 GK---------TTTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445
            K          +  RD    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 385 NKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444

Query: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYR-----QQGRS--- 497
              P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY      Q+G+    
Sbjct: 445 DAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRIQRGKGKES 504

Query: 498 ----------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547
                     SYETRCMIL++ELFL+L +TWTSTPYAI+YLETIL +C +LG CSQ+M+W
Sbjct: 505 NSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPYAIQYLETILDEC-KLGPCSQIMVW 563

Query: 548 ERLSDCYQSRTDPRV---ASALSTNTSPGSAQPG-----------NEILAQGFTRKRKAA 593
           ERLSDCY  R DPR+     A+  +        G            +IL++G TR+RKAA
Sbjct: 564 ERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHKYSTDHFTDEDILSEGLTRRRKAA 623

Query: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644
           FFRLIAAKKWAEQ QWRQV WCL DI+  Y+        GL++ +L  ++ 
Sbjct: 624 FFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLHGNGLILSKLKNQLN 674

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  651 bits (1679), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/711 (47%), Positives = 453/711 (63%), Gaps = 104/711 (14%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RIVS+A+APVITVTS+   D HI E+YKV S 
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRT-----------------------RKRSN 97
           Y+L R FGGC+SDRDQ  E     D    G T                       R RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE +L +YL    KL A + +++
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYL----KLVADNTDEM 176

Query: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217
                             +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 177 ------------------VPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218

Query: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ +LCY+   + +   C+ L +
Sbjct: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAK 278

Query: 278 KIKKCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334
           K+KK LFV+S+ L+LW +   +  +  + LH+P+MSSL+EI+ F                
Sbjct: 279 KLKKQLFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQ-------------A 325

Query: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394
            ++ +L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 326 PTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGA-KFFKKFM 384

Query: 395 GKTTTQ---------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445
            K  +           D    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 385 NKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444

Query: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQQGR--------- 496
              P YLASC+EWCAVSLL+GAQ IVTVKMIK +I PLIE+A+ATY    +         
Sbjct: 445 DAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCSKIQRSKSEKS 504

Query: 497 ---------SSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547
                     SYETRCMIL++ELFL+L D WTSTPYAI+YLETIL +C +LG C Q+MIW
Sbjct: 505 SSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDEC-KLGPCCQIMIW 563

Query: 548 ERLSDCYQSRTDPRVASALST------NTSPGSAQPGN--------EILAQGFTRKRKAA 593
           ERLSDCY  R DPR+   +        +T       GN        +IL++G TRKRKAA
Sbjct: 564 ERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAA 623

Query: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644
           FFRLIAA+KWAEQ QWRQV WCL DI+ IY+     +  GL++ +L+ ++ 
Sbjct: 624 FFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/709 (48%), Positives = 457/709 (64%), Gaps = 101/709 (14%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RIVS+A+APVITVTS+   D HI E+Y V S 
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDD--------------------SSTGGRTRKRSNSLF 100
           Y+L R FGGC+SDRDQ  E     D                    S+    +R RSNSLF
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQNASPSIESSSKNQNLGVPSALKRGSRSRSNSLF 120

Query: 101 QRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQL 160
           QRD+TQSQ++RF +PL DL+ +      LF+  SLE +L +YL    KL A + ++    
Sbjct: 121 QRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYL----KLVAGNTDE---- 172

Query: 161 PDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSR 220
                          +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D+S 
Sbjct: 173 --------------KVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISY 218

Query: 221 GQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIK 280
           G+ YE  RDL+  FKNLN   E FP+F+N N++LP+ +LCY+   + +   C+ L +K+K
Sbjct: 219 GEVYEDARDLLVNFKNLNHNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLK 278

Query: 281 KCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSR 337
           K LFV+SI L LW +   D E+  + LH+P+MSSL+EI+ F  + +            ++
Sbjct: 279 KQLFVESILLPLWKDSFVDVENSNIQLHQPVMSSLEEILFFLRAPT-----------QTK 327

Query: 338 AALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGK- 396
            +LPL  I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+ K 
Sbjct: 328 LSLPL--INSIYDMLDYLVYDLMIPFMKRKISFWEETILQPRKSLFNGA-KFFKKFMNKA 384

Query: 397 --------TTTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNS 448
                    +  +D    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL   
Sbjct: 385 PVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAF 444

Query: 449 PNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY----RQQGRS------- 497
           P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY    R Q R+       
Sbjct: 445 PKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYENCSRMQRRNSKELTSS 504

Query: 498 -------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERL 550
                  SYETRCMIL++ELFL+L DTWTSTPYAI+YLETIL +C +LG CSQ+M+WERL
Sbjct: 505 GVLEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDEC-KLGPCSQIMVWERL 563

Query: 551 SDCYQSRTDPRVASALS--TNTSPGSAQPGN------------EILAQGFTRKRKAAFFR 596
           SDCY  R DPRV   +     +   +    N            +IL++G TR+RKAAFFR
Sbjct: 564 SDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDEYDTDHFTEEDILSEGLTRRRKAAFFR 623

Query: 597 LIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQS 645
           L+AAKKWAEQ QWRQV WCL DI++ Y+        GL++  L  ++ S
Sbjct: 624 LMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLHGNGLILSNLKNQLNS 672

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/711 (47%), Positives = 451/711 (63%), Gaps = 104/711 (14%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+ + E VPP+IA+RIVS+A+APVITVTS+   D HI E+Y V S 
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YLLFRLFGGCISDRDQLME------HYTLDDSSTGGRT-----------------RKRSN 97
           Y+L R FGGC+SDRDQ  E       + + D+S    +                 R RSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE YL +YL  + + T       
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENT------- 173

Query: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217
                           +  PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 174 ---------------NETAPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218

Query: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ ++CY+   + +   C+ L +
Sbjct: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAK 278

Query: 278 KIKKCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334
           K+KK LFV+SI L LW E   D E+  + LH+P+MSSL+EI+ F                
Sbjct: 279 KLKKQLFVESIFLPLWKESFIDDENSSIKLHQPVMSSLEEILFFLQ-------------A 325

Query: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394
            ++  L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 326 PTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGA-KFFKKFM 384

Query: 395 GK---------TTTQRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445
            K          +  RD    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 385 NKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444

Query: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY-------RQQGRS- 497
              P YLASC+EWCAVSLL+GAQ+IVTVKMIK +I PLIERA+ATY       R +G+  
Sbjct: 445 DAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDINPLIERALATYEKCSQIQRHKGKEL 504

Query: 498 ----------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547
                     SYETRCMIL++ELFL+L DTWTSTPYAI+YLETIL +C +LG CSQ+MIW
Sbjct: 505 SSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPYAIQYLETILDEC-KLGPCSQIMIW 563

Query: 548 ERLSDCYQSRTDPRVASALS----TNTSPGSAQPGNE----------ILAQGFTRKRKAA 593
           ERLSDCY  R DPR+   +     +       + G+E          IL++G TR+RKAA
Sbjct: 564 ERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDEHYTDHFIEEDILSEGLTRRRKAA 623

Query: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644
           FFRLIAAKKWAEQ  WRQV WCL DI+  Y+          ++ +L +++ 
Sbjct: 624 FFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLHCNDSILSKLKSQLN 674

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  637 bits (1643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/722 (47%), Positives = 456/722 (63%), Gaps = 120/722 (16%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNLL HL+ A E+VPP+IA+RIVS+A+APVITVTS+  LD+HI E+Y + S 
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YLLFRLFGGCISDRDQ---LMEHYTLDDSS----------------------TGGRTRKR 95
           Y+L R FGGC+SDRDQ   L+    LD +                          R R R
Sbjct: 61  YMLLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSR 120

Query: 96  SNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPE 155
           SNSLFQRD+TQSQ+IRF +P+ D++   +    LFD  SLE YL  YL    +L AT+  
Sbjct: 121 SNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYL----QLIATN-- 174

Query: 156 KVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIA 215
                                P++LL+N++YHNFF+LA+SSTT++SP+ETFN P+++LIA
Sbjct: 175 ----------------TNNSTPYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIA 218

Query: 216 IDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQL 275
           +D+S GQ Y+ +RDL+  FKNLN    +FP+F+N ND+LP+ +LCYDA  + Q   C+ L
Sbjct: 219 VDISMGQTYDDIRDLLVEFKNLNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSL 278

Query: 276 QRKIKKCLFVDSIPLALWDEDPESPL-VPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334
            +++KK LFV+S+ L LW+E  E  + V LH+PIMSSL+E++ F  +  S          
Sbjct: 279 TKRLKKQLFVESLILPLWNEQYEIDIKVDLHQPIMSSLEEMIYFLQTPFS---------- 328

Query: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394
              A L +++I  +Y  LD L+ ++++PFM RK  +WEE ILQPR+S+FHG+  F KKF+
Sbjct: 329 ---AKLSISLINSIYNILDSLIYDLMLPFMKRKLLFWEETILQPRRSLFHGA-KFLKKFM 384

Query: 395 GKTTT-------QRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQN 447
            K           +D    ++F  SSTE L+RKLADWS+M+SDFKTAY TY+SLS DL  
Sbjct: 385 TKNNNGPQENILTKDSEGNEYFAFSSTELLMRKLADWSMMISDFKTAYSTYESLSRDLDT 444

Query: 448 SPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ-------------- 493
            P YLASCLEWCA SLL+GAQ+IVTVKMIK +I PLIERA+ TY                
Sbjct: 445 FPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPLIERALQTYENCAITLIQDTTNKVF 504

Query: 494 -----QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWE 548
                +   SYETRCMIL +ELFL+L DTWTSTPYAI YLETIL +C +LG CSQ+ IWE
Sbjct: 505 AEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYAITYLETILTEC-KLGPCSQIQIWE 563

Query: 549 RLSDCYQSRTDPRVASALSTN----------------TSPGSAQP--------------- 577
           RLSDCY+ R DPR+   ++                   +P + +P               
Sbjct: 564 RLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKVVATPSTDKPKTIQWESDLESKLGS 623

Query: 578 GNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLID 637
           G  IL++GFTR+RK+AFFRLIAAKKWAEQ QWRQV WCL D++ IY A+ L  +  L++ 
Sbjct: 624 GKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVA 683

Query: 638 RL 639
           +L
Sbjct: 684 KL 685

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/704 (48%), Positives = 447/704 (63%), Gaps = 96/704 (13%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           +  SYE+YMNLL HL+   + VP DIA+RIVS+A++PVI VTS+  LD HI E++ + S 
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 61  YLLFRLFGGCISDRDQLMEHYTL-----DD------SST----GGRTRKRSNSLFQRDAT 105
           Y+L R FG C+ DRDQ  E  +      DD      SST     G +RKRSNSLFQRDAT
Sbjct: 62  YMLLRFFGDCVGDRDQAHECTSAGSPSGDDRAEKSSSSTLAVASGPSRKRSNSLFQRDAT 121

Query: 106 QSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELT 165
           QSQ+IRF +PL DL+ S      LFD  +LE +L + L  I+K T               
Sbjct: 122 QSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKST--------------- 166

Query: 166 PSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYE 225
                      PHKLL+ ++YH FF+LA+SST  +SP+ETFN PV++LIA+D+  GQ YE
Sbjct: 167 -------NDKTPHKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYE 219

Query: 226 VVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFV 285
             RDL+T FKNLN   ++FPVF+N ND+LP+ +LCY+   E Q   C+ L +K+KK LFV
Sbjct: 220 EARDLLTKFKNLNHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFV 279

Query: 286 DSIPLALWDEDPESPL-VPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNI 344
           + I L LW ++ ++   V LH+PIM+SLDE++ F                 SR  L L +
Sbjct: 280 EGILLPLWKDNYKTATQVILHQPIMTSLDEVLYFLREP-------------SRIELSLEL 326

Query: 345 ITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT----- 399
           I  +Y  L++L++ ++IPFM RK  +WEE ILQPR+S+FHGS  F K+F+ KTT+     
Sbjct: 327 INSIYDVLEILINGLMIPFMQRKISFWEETILQPRRSLFHGS-KFLKRFMSKTTSGTNIH 385

Query: 400 -----QRDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLAS 454
                 +D +  ++F +SS E L+RKLADWS+MLSD+KTAY TYDSLS+DL++ P YLAS
Sbjct: 386 QQASIAKDANGKEYFVSSSAEFLMRKLADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLAS 445

Query: 455 CLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYR------------QQGRS----- 497
           CLEWC+VS+L+GAQNIVT KM+KT+I PLI+RAV TY             ++  S     
Sbjct: 446 CLEWCSVSVLMGAQNIVTAKMLKTDIDPLIQRAVETYENCALYDTQLSGSKKSNSMAPVR 505

Query: 498 SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSR 557
           SYETRCM L++ELFL+L DTWTSTPYA+R LETIL +C +LG CSQ+MIWERLS+CYQ R
Sbjct: 506 SYETRCMFLASELFLSLSDTWTSTPYALRNLETILAEC-RLGPCSQIMIWERLSNCYQQR 564

Query: 558 TDPRVASALSTNTSPGSAQPGNE-----------ILAQGFTRKRKAAFFRLIAAKKWAEQ 606
            D R+   ++        +  NE           I+ +G TR RKAAFF+LIAA KWAEQ
Sbjct: 565 IDHRIRHKVNDGAMSNEEKVENEDDSEKEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQ 624

Query: 607 GQWRQVQWCLHDIKDIYTASALYDKKGLLIDRL-----NTEVQS 645
            QWRQ  WCL D +D Y      ++K L + +L     N E+ S
Sbjct: 625 KQWRQASWCLKDTEDAYAGIEFVNRKDLALAKLKETLKNVEIDS 668

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/697 (49%), Positives = 448/697 (64%), Gaps = 93/697 (13%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           + FSYEHYMNLL HLEC+ E +P +IARRIVSHA+APVITVTS+  LD HI ++Y + S 
Sbjct: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 61  YLLFRLFGGCISDRDQLME-------HYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFA 113
           Y+L R FGGC+SDRDQ  E         +   ++   R R RSNSLFQRD+TQSQ+IRF 
Sbjct: 62  YMLLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTRARSRSNSLFQRDSTQSQYIRFT 121

Query: 114 QPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRG 173
           +PLPDL+  + +   LFD+ SLE YL  YL  ++K T                       
Sbjct: 122 RPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTS------------------ 163

Query: 174 KPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTT 233
               H+LL+ ++YHNFF+LA+SSTT +SPFE+FN P+M+LIA+D++  Q YE  + L+  
Sbjct: 164 ----HQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIK 219

Query: 234 FKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALW 293
           FKNL+  ++ FP++IN  D+LP+ +LCY+A    ++  CE+L  KIKK LFV+SI L LW
Sbjct: 220 FKNLHNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLW 279

Query: 294 DEDPES-PLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQAL 352
               ++ P + LH+P+MSSLDE++ F  S      DE  T       LP+ +    Y  L
Sbjct: 280 KNSYQTEPFIKLHQPVMSSLDEMIYFLQS------DEQNT-------LPIELTNTTYDML 326

Query: 353 DVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQ---------RDP 403
           + LV  +LIPFM RK  +WEE +LQP+KSIFHGS  F KK + + +T          +D 
Sbjct: 327 EKLVYALLIPFMQRKIAFWEETVLQPKKSIFHGS-KFLKKLMSRASTSSHQQQNILTKDH 385

Query: 404 SDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSL 463
              ++F +SS E LLRKLADWS+MLSDFKT Y TY+ LS+DL+  P YLASCLEW AVSL
Sbjct: 386 DGNEYFASSSPELLLRKLADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSL 445

Query: 464 LLGAQNIVTVKMIKTEITPLIERAVATY-----------RQQGRS----------SYETR 502
           L+GAQNIVTVKM+K +I+PLI+RA+  Y           ++ G +          SYETR
Sbjct: 446 LMGAQNIVTVKMMKNDISPLIDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETR 505

Query: 503 CMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSRTDPRV 562
           C+ILS+ELFL+L DTWTSTPYAI YLE+IL +  +LG CS++MIWERLSDCY  R DPR+
Sbjct: 506 CLILSSELFLSLSDTWTSTPYAINYLESILEES-RLGPCSRIMIWERLSDCYDLRVDPRI 564

Query: 563 ASALSTN-----------------TSPGSAQPGNEILAQGFTRKRKAAFFRLIAAKKWAE 605
            S +                     S     P N I++QG TRKRKAAFFRL+AAK WAE
Sbjct: 565 KSKVEQVQKQDNLEEPADNEHRILNSQDDLNPSN-IVSQGLTRKRKAAFFRLLAAKMWAE 623

Query: 606 QGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTE 642
           QGQW+QV+WCL +I DIY+   L ++  L++ RL  E
Sbjct: 624 QGQWKQVKWCLDNITDIYSRVGLVNRDDLILTRLREE 660

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/699 (46%), Positives = 445/699 (63%), Gaps = 93/699 (13%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           + FSYE+YMNL+ HL+  +E VP DI++RIVS+A+APVITV S+  LD H+ +SY + S 
Sbjct: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63

Query: 61  YLLFRLFGGCISDRDQLMEHY-------------------------TLDDSSTGGRTRKR 95
           YLL R FGGCISDRDQ  E+                          TL+   +   +R R
Sbjct: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123

Query: 96  SNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPE 155
           SNSLFQRD+TQS +IRF +P+ DL+ S      LFD  SLE YL   LS I K T  + +
Sbjct: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183

Query: 156 KVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIA 215
                                 HK L+ +++H FF+ A+SSTT +SP+E+FN P+++L+A
Sbjct: 184 ----------------------HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVA 221

Query: 216 IDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQL 275
           +D+S+GQ+YE  RDL+  FKN N  +E+FP F++ NDIL + +LCYD   E Q   C+ +
Sbjct: 222 LDISKGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDV 281

Query: 276 QRKIKKCLFVDSIPLALWDED-PESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334
            +K+KK LF +S+ L LW++   E   V LH+P MSSLDE++ F+             + 
Sbjct: 282 VKKLKKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEMLYFF-------------ER 328

Query: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394
            S   LPLN+I  +Y  ++ LV +++IPFM RK  +WEE ILQPRKS+FHG N  F+KF+
Sbjct: 329 PSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHG-NKLFRKFM 387

Query: 395 GKTTTQ---------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445
            ++++Q         +D    ++F +SS E LLRKLADWS+M+SDFKTAY TY++L +DL
Sbjct: 388 NRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDL 447

Query: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ------------ 493
           +  P YLASCLEWCA+S+L+GAQNIVT KMIK ++ PLIER++ TY Q            
Sbjct: 448 EAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNSLEND 507

Query: 494 ----QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWER 549
               +   SYETRCM+L++ELFL+L DTWTSTPYA+  LETIL +C +LG CSQ+MIWER
Sbjct: 508 ELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAEC-KLGICSQIMIWER 566

Query: 550 LSDCYQSRTDPRVASALST-----NTSPGSAQPGNEILAQGFTRKRKAAFFRLIAAKKWA 604
           LSDCY  RTDPR+   + T     N   G     ++I+++G  RKRKAAFFRL+AAKKWA
Sbjct: 567 LSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQTDDIVSKGLARKRKAAFFRLLAAKKWA 626

Query: 605 EQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643
           EQ QWRQV WCL D++ IY   +   +  L+  +L  E+
Sbjct: 627 EQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDEL 665

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/717 (47%), Positives = 444/717 (61%), Gaps = 112/717 (15%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M  SYE+YMNLL HL+   ETVPPDIARRIVS+AV+PVITV+S+  LD HI ++Y + S 
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTL----------------DDSSTGGR------------- 91
           Y+  R FG C+SDRDQ  E+  L                D+     R             
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 92  -------------TRKRSNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWY 138
                        TRKRSNSLFQRD TQSQ++RF +P+ DL+ S      LFD  SLE +
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 139 LTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTT 198
           L + L  +++ T           D+ TP            +LL+ ++YH FF+LA+SSTT
Sbjct: 181 LENTLRLVEEYT-----------DDNTP-----------FELLKKSLYHKFFSLAISSTT 218

Query: 199 RISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIV 258
            +SP+ETFN PV++LIAID+S GQ YE  RDL+  FKNLN  +E+FP+F++  DILP+ +
Sbjct: 219 YLSPYETFNHPVVSLIAIDISAGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFL 278

Query: 259 LCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED-PESPLVPLHEPIMSSLDEIVK 317
           LCY+   E +   C+QL  ++KK LFV+S+ L LW     +   V LH+PIMSSL+E++ 
Sbjct: 279 LCYNDESEDEQNACQQLANQLKKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLY 338

Query: 318 FYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQ 377
           F  S +                LPL +I   Y  L+ LV ++++PFM RK  +WEE ILQ
Sbjct: 339 FLQSPTP-------------TRLPLQLINVTYNILEKLVKDLMVPFMKRKISFWEETILQ 385

Query: 378 PRKSIFHGSNNFFKKFIGKTTT----------QRDPSDTQFFPASSTECLLRKLADWSLM 427
           PRKS+FHG+ NFFKK + K +            +D +  ++F ASSTE L+RKLADWS+M
Sbjct: 386 PRKSLFHGA-NFFKKLMSKNSNGSNNHQPISLGKDKNGNEYFVASSTEFLMRKLADWSMM 444

Query: 428 LSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERA 487
           LSDFKTAY TY+SL +DL+N P YLASC EWCAVS+L+GAQNIVTVKMIK +I PLI+RA
Sbjct: 445 LSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVSVLMGAQNIVTVKMIKNDIDPLIQRA 504

Query: 488 VATYRQQGRS-------------SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRD 534
           + TY                   SYETRCM L++ELFL+L DTWTSTPYA+  LETIL +
Sbjct: 505 LETYENCAADEDSTGEELYVPVRSYETRCMFLASELFLSLSDTWTSTPYALNSLETILTE 564

Query: 535 CPQLGACSQVMIWERLSDCYQSRTDPRV--------ASALSTNTSPGSAQPGNEILAQGF 586
           C +LG CS++MIWERLSDCY  R DPR+        A A++   +P   +   EI+ +G 
Sbjct: 565 C-RLGPCSEIMIWERLSDCYYQRIDPRIRHKTSAQGAKAMTDELAPDE-ESNEEIVTRGL 622

Query: 587 TRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643
           TRKRKAAFFRLIAA KW EQ QW+Q  WCL +I++ Y      +++ L++ RL  ++
Sbjct: 623 TRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIEEAYAGLDFVNREDLILARLKRQM 679

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/702 (46%), Positives = 440/702 (62%), Gaps = 96/702 (13%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M FSYEHYMNL+ HL+ A+ETVP DIA+R+VS+A+APVITVTS++ LD HI E+Y + S 
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDS-------------STGG-------RTRKRSNSLF 100
           Y+L R FGGC+SDRDQ  E     D               T G       R R  SNSL+
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEKDGTNGLTVPRQTRVRSNSNSLY 120

Query: 101 QRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQL 160
           QRDATQSQ++RF +PL DL+ +      LFD  SLE YL  YLS + K            
Sbjct: 121 QRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDK------------ 168

Query: 161 PDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSR 220
             + +P         +PH LL+ ++YH+FFALA+SST+++SPFE FN P+++L+AID++R
Sbjct: 169 --KFSPH--------IPHHLLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITR 218

Query: 221 GQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIK 280
            +DYE   + +  FK++N  +  FP FIN NDILP+ +LCY+  +ET+   C+ L  K+K
Sbjct: 219 NEDYETAAEQLKEFKSMNNNIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLK 278

Query: 281 KCLFVDSIPLALWD-EDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAA 339
           K LFV+SI L LW  E  ++ +V LH+P+MSS++EI+ F  +                  
Sbjct: 279 KQLFVESIILPLWSTEFTDNLVVSLHQPVMSSIEEIMFFLQNPVD-------------HK 325

Query: 340 LPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTT 399
           LPL ++  +Y  +D++V +++ PFM RK  +WEE IL PRKS+FHG+  FFKKF+ K+T 
Sbjct: 326 LPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFWEETILTPRKSLFHGA-KFFKKFMNKSTQ 384

Query: 400 Q--------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNY 451
                    ++   + +  ++S E L+RKLADWS+M+SDFKTAY TY+SL  D +  P Y
Sbjct: 385 ALSQPNSLLKENHGSNYLSSTSPEFLMRKLADWSMMVSDFKTAYTTYESLCQDFERMPKY 444

Query: 452 LASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATY----------RQQGRS---- 497
           LASC EWCAVSLL+GAQNIVT KM+K EI P IERA+  Y          R+ G S    
Sbjct: 445 LASCSEWCAVSLLMGAQNIVTAKMLKNEINPAIERALGAYELCATESNAHRKFGDSDDLS 504

Query: 498 ----SYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDC 553
               SYETRCM L++ELFL+L DTWTSTP+AI YLETIL +C +LG  S++MIWERLSDC
Sbjct: 505 APVRSYETRCMFLASELFLSLSDTWTSTPFAIAYLETILNEC-KLGPLSEIMIWERLSDC 563

Query: 554 YQSRTDPRVASALST-----NTSPGSAQPGN-------EILAQGFTRKRKAAFFRLIAAK 601
           Y  R DPR+   +               P N       +IL++G TR RKAA F+LIAA+
Sbjct: 564 YGMRIDPRIKHRIGNLELLQKKEENMDDPKNADVFTTEDILSKGLTRNRKAALFKLIAAR 623

Query: 602 KWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643
           KW EQ QWR++ WCL D++  Y+    ++K+ LL  RL  E+
Sbjct: 624 KWCEQKQWRELSWCLDDLESTYSDLKCFNKENLLYTRLRNEL 665

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/736 (43%), Positives = 418/736 (56%), Gaps = 128/736 (17%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M  SYE YMNL+SHL+ ASE VP +I+R+IVS+AV+PV+TVTSS ALD HI ESY + S 
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120
           Y+L R FG CISDRDQ              R R RS SLFQR A  SQF+RF +PL D++
Sbjct: 61  YMLLRYFGDCISDRDQADSEQESGVEPNKSRARSRSGSLFQRQA--SQFLRFTRPLSDII 118

Query: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180
            +   +  LFD  SLE +L  YL  +   T+ D                       PH L
Sbjct: 119 GTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDT----------------------PHTL 156

Query: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240
           L++++YH FF  A+SST  +SP+E FN PV +L+A+D+S+ + YE  RDL+ TFKN++  
Sbjct: 157 LQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHNK 216

Query: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDED---P 297
              FP FINVNDILP+ +LCY+     Q  TC+ L + +KK LFV+S+ L  W  +    
Sbjct: 217 TPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTAK 276

Query: 298 ESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVD 357
           ++P   LH+PIMSSL+E +  +S    +  D           LPL  I H+Y  L  LVD
Sbjct: 277 DTPTRVLHQPIMSSLEETM--FSMLKDSAFD-----------LPLPFIEHIYDRLTKLVD 323

Query: 358 EMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDT--------QFF 409
           E++IPFM RK  +WEE+ILQPR+SIF  S  FF+K I K  T    +D+         +F
Sbjct: 324 ELMIPFMKRKISFWEESILQPRRSIFPNS-KFFRKLISKAPTPSTNNDSATHSEQGLAYF 382

Query: 410 PASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQN 469
            A+S E LLRKLADWS MLSDFKTAY TY+ LS D +  P YLA CLEWCA+S+L+GAQ+
Sbjct: 383 AATSNELLLRKLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQS 442

Query: 470 IVTVKMIKTEITPLIERAVATYR------------------------------------- 492
           IVTVKMIK +I PLI RA+ +Y                                      
Sbjct: 443 IVTVKMIKNDIDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHD 502

Query: 493 ---------------QQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQ 537
                           Q   SYETRCM+L+AELFL+L DTWT+TPYAI+YLETIL  C  
Sbjct: 503 DRVSGTTDFEISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQC-T 561

Query: 538 LGACSQVMIWERLSDCYQSRTDPRVASALSTNTSPGSAQ--------------PGNE--- 580
           +GA S+++IWERL+ CY  R DPRV S L+ +    S Q               G+E   
Sbjct: 562 VGALSEIVIWERLAYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQV 621

Query: 581 ---------ILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDK 631
                    I + G TRKRKA  FRLIA KKW E  QWRQ  W   D++ +Y+     ++
Sbjct: 622 CQHKMSQSCIASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANR 681

Query: 632 KGLLIDRLNTEVQSFS 647
           + L++ +L   +   S
Sbjct: 682 EDLILKKLEKRIAQHS 697

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/731 (42%), Positives = 417/731 (57%), Gaps = 126/731 (17%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M  S+  YMNL  HL+ A E VP +I+R+IVS AV+PV+TVTS+ ALD+HI ESY V S 
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120
           Y+L R FG C+SDRDQ      L   S   R R RSNSLFQR A  S ++RF +PL DL+
Sbjct: 61  YMLLRYFGDCVSDRDQAEAGPELGTESGKNRNRARSNSLFQRQA--SHYLRFTRPLTDLI 118

Query: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180
                +  LFD  SLE +L  YLS ++  T +D                       PH L
Sbjct: 119 DVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDT----------------------PHTL 156

Query: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240
           L++++YH FF  A+SST  +SP+E+FN PV +L+A+D+S+ Q YE  RDL+  FKN++  
Sbjct: 157 LQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHNT 216

Query: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP 300
              FP FINVNDILP+ +LCY+     Q   C+ L + IKK LFV+S+ L  W ++  + 
Sbjct: 217 TPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINAG 276

Query: 301 LVP---LHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVD 357
             P   LH+PIMSSL+E +  YS               S   LPL++I ++Y  L  L+D
Sbjct: 277 ASPSRILHQPIMSSLEETM--YSMMK-----------ESTITLPLSLINYIYDRLTNLID 323

Query: 358 EMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQRDPSDT--------QFF 409
           E++IPFM RK  +W+E+ILQPRKSIF  S  FF+K I KT      SD+         +F
Sbjct: 324 ELMIPFMKRKISFWDESILQPRKSIFPNS-KFFRKLISKTPAPPPASDSATHSQQGVAYF 382

Query: 410 PASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQN 469
            A+S E +LRKLADWS MLSDFK AY TY+ LS D +  P YLASCLEWCA+S+L+GAQ+
Sbjct: 383 AATSNEFILRKLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQS 442

Query: 470 IVTVKMIKTEITPLIERAVATYRQQGRSS------------------------------- 498
           IVTVKMIK +I PLI RA+ +Y    R +                               
Sbjct: 443 IVTVKMIKNDIDPLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSD 502

Query: 499 ---------------------YETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQ 537
                                YETRCM+L+AELFL+L DTWT+TPYAI+YLETIL +C  
Sbjct: 503 EHSGQELDEGVSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDEC-T 561

Query: 538 LGACSQVMIWERLSDCYQSRTDPRVASALST------------NTSPGSAQPGNE----- 580
           LG+ S++++WERL+ CY  R DPRV   L +              S GS +  +E     
Sbjct: 562 LGSLSEIVLWERLAYCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYD 621

Query: 581 -------ILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKG 633
                  + + G  R+RK+  FRLIA KKW E  QWRQ  W L DI+ +Y+     ++  
Sbjct: 622 HKISQNCMASLGLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDD 681

Query: 634 LLIDRLNTEVQ 644
           L++++L  ++ 
Sbjct: 682 LILEKLRKKIH 692

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/719 (41%), Positives = 423/719 (58%), Gaps = 95/719 (13%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           M F+YE+YMNL+ HL+   E VP DI++RIVS+A+APVITVT+++ LD HI E Y + S 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YLLFRLFGGCISDRDQLMEHY------------------TLDDSSTGGRTRKRSNSLFQR 102
           Y L R FGGCISDRDQ  E+                   T++++       ++     Q 
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 103 D----------ATQSQFIRFAQPLPDLL-------RSYTEQQGLFDNDSLEWYLTHYLSW 145
           D             + ++       +LL       R+ +    LF  DS +     +   
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 146 IQKLTAT--------DPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSST 197
           I+ L  +        D   +E                 + HK L+ ++YH FF+ A+SST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 198 TRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMI 257
             +SP+E+FN P+++LIAID+++GQ+YE+ RDL+  FKN N  + +FP+F++ NDILP+ 
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 258 VLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESPL-VPLHEPIMSSLDEIV 316
           VLCY+ +   +     +L +KIKK LF + I + LWD+     + V LH+P MSSLDE++
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360

Query: 317 KFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENIL 376
             + ++ +               LPL +I  +Y  L++L ++++IPFM RK  +WEE IL
Sbjct: 361 YVFQTSKT-------------DKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETIL 407

Query: 377 QPRKSIFHGSNNFFKKFIGKTTTQ---------RDPSDTQFFPASSTECLLRKLADWSLM 427
           QP+KS+F G+   F+KF+G+ +           +D    ++F ++S   LLRKLADWS+M
Sbjct: 408 QPKKSLFQGT-KLFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMM 466

Query: 428 LSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERA 487
           +SDFKTAY T++SL  D++  P YLASCLEWCAV +L+GAQNIVT KMIK ++ PLIER+
Sbjct: 467 ISDFKTAYTTFESLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERS 526

Query: 488 VATYRQ-----------------QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLET 530
           +  Y                   +   SYETRCM++++ELFL+L DTWTSTPYA+  LET
Sbjct: 527 LDVYGNCALLLNSIAESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLET 586

Query: 531 ILRDCPQLGACSQVMIWERLSDCYQSRTDPRVASALSTNTSPG----------SAQPGNE 580
           IL +C +LGACSQ+MIWERLSDCY  RTDPRV   L +N S              Q  + 
Sbjct: 587 ILSEC-KLGACSQIMIWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDVSS 645

Query: 581 ILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRL 639
           I+ +G TR+RKA+FFRL+AAKKWAEQ QWRQV WCL+DI ++Y  +    ++ L+  +L
Sbjct: 646 IVLKGLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKL 704

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/747 (41%), Positives = 431/747 (57%), Gaps = 134/747 (17%)

Query: 1   MAFSYEHYMNLLSHLECASE--TVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQ 58
           M  SYE+YMNLL H++ + E  TV  ++A++IVS+AV+PV+ VTS+  LD H+ E+Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SAYLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPD 118
           S Y+L R FG C++DRDQ       +++ T  + R RSNSLFQR++  S F+RF +PL D
Sbjct: 61  SMYMLLRFFGDCVTDRDQE------NETETNFKGRPRSNSLFQRES--STFVRFTRPLID 112

Query: 119 LLRSYTEQQG-LFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLP 177
           L+       G LFD  SLE +L  YL  +    + +                       P
Sbjct: 113 LVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT----------------------P 150

Query: 178 HKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNL 237
           H+LL++++YH FF  A+SST  +SP+E+FN PVM+L+A+D+SRG  YE  RDL+  FKN+
Sbjct: 151 HRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKNM 210

Query: 238 N---KFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALW- 293
           N   K    FP FIN+NDILP+ +LCY+ +   Q   C+ L + +KK LFV+SI L LW 
Sbjct: 211 NSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLWR 270

Query: 294 ---DEDPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRA----ALPLNIIT 346
              D D E P   LH PIMSSL+E++ F    +  G D +   G S       LPL ++ 
Sbjct: 271 DSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEA-PGKDNISYTGSSNPISSFELPLALVE 329

Query: 347 HMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTT--TQRDPS 404
            +Y  L++L+ E++IPFM RK  +WEE ILQPRKSIF  +  F ++F+ K+   T   P 
Sbjct: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAK-FLRRFVSKSAPATPAAPI 388

Query: 405 DTQ---------FFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASC 455
           +++         FFPASS E LLRKLADWS MLSD++TAY TYD+LS DL++   YLA C
Sbjct: 389 NSKSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC 448

Query: 456 LEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ-------------------QGR 496
           LEWCAVS+L+GAQ+IVTVKMIK +I PLI +++  Y +                   +  
Sbjct: 449 LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPA 508

Query: 497 SSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCP-----------QLGACSQVM 545
            SYETRCM+LSAELFL+L DTWT+TPYAI+YLETIL++CP           +L  C ++ 
Sbjct: 509 QSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELR 568

Query: 546 IWERLSDCYQ-------------SRTDPRV-----ASALSTNTSPGSAQ----------- 576
           +  R+S  +              S+++ R       S  ST  +    Q           
Sbjct: 569 VDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDE 628

Query: 577 ------------------PGNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHD 618
                             P  +I   G TR+RKAAFFRLIAA KW EQ QW+Q  W L D
Sbjct: 629 ALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRD 688

Query: 619 IKDIYTASALYDKKGLLIDRLNTEVQS 645
           +  +Y+      +KGL+++RL  E+++
Sbjct: 689 VDTVYSGLVFSYRKGLILERLVGEIEA 715

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  477 bits (1227), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 269/669 (40%), Positives = 379/669 (56%), Gaps = 147/669 (21%)

Query: 91  RTRKRSNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLT 150
           +TRKRSNSLFQRD+TQSQ+IRF +P+PDL+ +      LFD+ SLE  L  YL  I+  T
Sbjct: 183 KTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNT 242

Query: 151 ATDPEKVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPV 210
             D                      +PH  L+ ++YH FF++ V+STT + PFE+F+ P+
Sbjct: 243 TPD----------------------MPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPI 280

Query: 211 MNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLA 270
           ++L++ID++  Q+Y+  ++++  FKN++    +FPV++N+NDILP+ +LCYDA+   QL 
Sbjct: 281 VSLLSIDLTLNQNYDTAKEMLIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLD 340

Query: 271 TCEQLQRKIKKCLFVDSIPLALWDED--PESPLVPLHEPIMSSLDEIVKF---YSSNSSA 325
             +++  KIKK LF +SI L LW++        V LHEP+MSS+DE + F   Y   +S 
Sbjct: 341 IAKKISTKIKKQLFFESILLPLWNDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSC 400

Query: 326 GGDEVGTDGHSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHG 385
             D           LPL+++ ++Y+ +  L   ++IPFM RK ++W+E ILQPRKSIF  
Sbjct: 401 VTDN---------KLPLSLVKYIYEMIANLSVNLIIPFMQRKIRFWDETILQPRKSIFR- 450

Query: 386 SNNFFKKFIGKTTTQ------------------------RDPSDTQFFPASSTECLLRKL 421
            N  FK F+ + +                          +D +  ++F A STE  LRKL
Sbjct: 451 -NKLFKSFMNRNSNVSSSTGTSSSEISNSISKHHHSLLTKDSNGHEYFSALSTEFQLRKL 509

Query: 422 ADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEIT 481
           ADWS+M+SDFKTAY TY+SLS DL+N+  Y+ASCLEW AVS+L+GAQNIVT KM+K ++ 
Sbjct: 510 ADWSMMVSDFKTAYTTYESLSRDLENTSKYMASCLEWWAVSILMGAQNIVTAKMLKNDVD 569

Query: 482 PLIERAVATYRQ--------------------------------------QGRSSYETRC 503
           PLIE A+ +Y +                                          SYE RC
Sbjct: 570 PLIESALESYEKPLPPVPNSRLPSNNINSLNSRSSISSATKAEVSLIENNHTIRSYEIRC 629

Query: 504 MILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWERLSDCYQSRTDPRVA 563
           M+L +ELFL+L DTWTSTPYA+RYLETIL D  +LG CSQ ++WERLS CY  R DPR+ 
Sbjct: 630 MLLLSELFLSLSDTWTSTPYALRYLETILSDY-KLGPCSQTILWERLSFCYDLRVDPRIK 688

Query: 564 SALS-TNTSPGSAQPGNE------------------------------------------ 580
              + TN + G+   G+E                                          
Sbjct: 689 RKPTITNINKGTKATGSEASHSSIKEVNEKYRNDGKQEKYSIDRKNSLIIDVNSNEEYDC 748

Query: 581 ---ILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLID 637
              IL+ GFTRKRKAAFF+LIAAKKW+EQ QWRQ+ WCL DI+++Y      D+K L++ 
Sbjct: 749 GYDILSDGFTRKRKAAFFKLIAAKKWSEQKQWRQLDWCLKDIENVYKEVGFSDRKDLILI 808

Query: 638 RLNTEVQSF 646
           +L  ++  +
Sbjct: 809 KLKDQLNKY 817

 Score =  104 bits (260), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 45/79 (56%), Positives = 61/79 (77%)

Query: 1  MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
          M FSYE+YMNLL HL+  +E +P DIA+RIV +++AP+I+VT++  LD H+ +SY + S 
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YLLFRLFGGCISDRDQLME 79
          Y+L R FGGCISDRDQ  E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  439 bits (1128), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/662 (39%), Positives = 382/662 (57%), Gaps = 71/662 (10%)

Query: 3   FSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSAYL 62
            SYE YMNLL + +  S+ VP +I+R+++ +A++P I+V S+ AL+ H+ E +K+ S Y 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 63  LFRLFGGCISDRDQLMEHYTLDDSSTG----GRTRKRSNSLFQRDATQSQFIRFAQPLPD 118
           L R FG  I DRDQL      DD  +        R+R NSLFQR++  S++IRF  PL D
Sbjct: 62  LLRYFGDYIQDRDQL------DDKISAKLQPNNRRQRQNSLFQRNS--SRYIRFQTPLTD 113

Query: 119 LLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPH 178
           ++      Q  F++  LE  L+ +L  I++ T  D                       P 
Sbjct: 114 IISVGDNHQVEFND--LEESLSEFLKDIEEHTVNDS----------------------PC 149

Query: 179 KLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLN 238
           +LL+++++H F  +   S+T +SP+ +FN P++ L+A+D+++G++YE+ R+L+  FKNL 
Sbjct: 150 ELLKHSIFHKFITML--SSTTLSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLP 207

Query: 239 KFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPE 298
             L  FP FIN ND+LP+ +LC+D +   Q  T + L + IKK LFV+S+PL ++    +
Sbjct: 208 NTLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIFTNFRD 267

Query: 299 SPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDE 358
             +V LH PI +SL E  + Y S+                 L   ++  +Y  ++ +V++
Sbjct: 268 RSIV-LHPPITNSLQE--QLYDSSHPVS-----------LKLCPRLVKLIYDTINSMVED 313

Query: 359 MLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKT----TTQRDPSDTQFFPASST 414
           ++IPFM+RK  +W+E ILQPRKSIFH SN   K+FI K+    T     S    F ASS 
Sbjct: 314 LMIPFMNRKISFWDETILQPRKSIFH-SNKLLKRFISKSSGSPTASMPTSPDGHFLASSN 372

Query: 415 ECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVK 474
           E LLRKLADW  MLSD+KTAY  Y+ L  D +N P Y++SC E+ A+SLL+GA +IVT K
Sbjct: 373 EFLLRKLADWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAK 432

Query: 475 MIKTEITPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETIL-R 533
           MIK +I PLI + +        S  + RCMI   ELFL+L DTWTS P+AI+YLE IL +
Sbjct: 433 MIKNDIDPLIMKYLDYAVNNIISLDQIRCMIYMTELFLSLSDTWTSAPFAIKYLEVILQK 492

Query: 534 DCPQLGACSQVMIWERLSDCYQSRTDPRVASALSTNT------------SPGSAQPGNEI 581
           +  +LG   + +IWER+S  Y+ R DPR+ +   + +            +P     G +I
Sbjct: 493 ENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDHDLEEELYLNPHKLHCG-KI 551

Query: 582 LAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNT 641
             QGFTR RK A F+L+AAKKW + GQ RQ  W L     +Y      + +G L+ RL  
Sbjct: 552 QNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGTLLSRLAD 611

Query: 642 EV 643
            V
Sbjct: 612 AV 613

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  431 bits (1108), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 253/685 (36%), Positives = 377/685 (55%), Gaps = 83/685 (12%)

Query: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60
           + FSYE YMNL+ + E  S  +P +I+++++ + ++P I V S+L LD+H+ + Y + S 
Sbjct: 3   LQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSI 62

Query: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLL 120
            +LFR FG  I DRDQ+     L D  +    R RS+SLFQR A  S+ +RF + L DL+
Sbjct: 63  SMLFRYFGDYIQDRDQIPSTTDLKDPGSVSSGRHRSDSLFQRQA--SECVRFTRSLEDLI 120

Query: 121 RSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKL 180
              +E   L   D ++ +L+ YL  ++                     P       P KL
Sbjct: 121 SIDSEDHILQSTD-IDSFLSQYLQNLE---------------------PIMNENGTPSKL 158

Query: 181 LRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKF 240
           L++++YH FF     S+  +S + +F+ PV+ L+ +D+++GQ YE  R+++  FKNLN  
Sbjct: 159 LKHSIYHRFFITL--SSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216

Query: 241 LEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESP 300
           LE+FP FIN+NDILP+ VLCYD     Q  + + L + +KK LFV+S+ ++L+       
Sbjct: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTPHDNQK 276

Query: 301 LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHMYQALDVLVDEML 360
              LH PI  SL E V   S  +S               +P  ++TH+Y  +  +V+EM+
Sbjct: 277 STTLHSPITVSLHEQVFNMSHPTSIN-------------IPSRLLTHIYDTISFIVEEMM 323

Query: 361 IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIG---------KTTTQRDPSDTQ-FFP 410
           IPFMHRK  +W+E +LQPRKSIF  SN FF++FI          K    +DP++    FP
Sbjct: 324 IPFMHRKLVFWDETVLQPRKSIFQ-SNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFP 382

Query: 411 ASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNI 470
           ASS E LLRKLADWS MLSDFK AY  YD L+ D ++ P YLA CLE+  +SLL+GAQNI
Sbjct: 383 ASSPEFLLRKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNI 442

Query: 471 VTVKMIKTEITPLIERAVATYRQQ--GRSSYETRCMILSAELFLALRDTWTSTPYAIRYL 528
           +T K IKTE+ PL+ RA+  Y++Q    S     C++  ++L L+L DTW S+P A+ YL
Sbjct: 443 ITAKTIKTEVDPLMTRAIEQYKKQDEKHSLRVIHCILTFSDLLLSLSDTWVSSPLAVNYL 502

Query: 529 ETILRDCPQLGACSQVMIWERLSDCYQSRTDPRV---------------ASALSTNTSPG 573
            T ++    LG  + V+I ER++  Y+   D RV                S  + N+  G
Sbjct: 503 -TYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAENSKKG 561

Query: 574 ---------------SAQPGNEILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHD 618
                          +    N + ++G TR RK + ++L+AAKKW E  +  Q +WC++ 
Sbjct: 562 ENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKWCIYH 621

Query: 619 IKDIYTASALYDKKGLLIDRLNTEV 643
               Y   +L  +   L  RL+ E+
Sbjct: 622 AAPAYEKLSLSKRPDGLFHRLSMEL 646

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  427 bits (1098), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 256/661 (38%), Positives = 377/661 (57%), Gaps = 82/661 (12%)

Query: 3   FSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSAYL 62
            SYE YMNL+ + E  S+ VP +I+RR++ +A++P ++V S+ AL+ H+ E +   S Y+
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 63  LFRLFGGCISDRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFIRFAQPLPDLLRS 122
           L R F   + +R +       +  S  G+  +R  S++QR    S+++RF +PL +++ +
Sbjct: 62  LLRYFADYVRERGE-------EVGSVSGQ--RRPGSVYQRQT--SRYVRFQRPLEEVIET 110

Query: 123 YTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTPSSPPQRGKPLPHKLLR 182
             EQQ + D + LE  L  +L  I+  T  +                       P +LL+
Sbjct: 111 -VEQQAV-DFEDLEEALGQHLRDIEARTTNES----------------------PSELLK 146

Query: 183 NAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNLNKFLE 242
           ++++H F  +   S+T +SP+ T N P+M L+A+DV++G++Y + R+L+  FKNL     
Sbjct: 147 HSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSKSS 204

Query: 243 DFPVFINVNDILPMIVLCYDAADETQLATCEQLQRKIKKCLFVDSIPLALWDEDPESPLV 302
            FP +IN ND+LP+ +LC+D +   Q  T + LQ+ IKK LFV+S+PL ++      P+V
Sbjct: 205 KFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTNYESDPVV 264

Query: 303 PLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPL--NIITHMYQALDVLVDEML 360
            LH PI +SL E V                DG     L L   ++  +Y+ ++ +V++++
Sbjct: 265 -LHPPITNSLQEQV---------------YDGSHPPLLRLCPQLVDVIYETINAMVEDLM 308

Query: 361 IPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFIGKTTTQR----DPSDTQFFPASSTEC 416
           IPFM+RK  +W+E ILQPRKSIFHG N F K+F+ KT +        S   +F ASS E 
Sbjct: 309 IPFMNRKISFWDETILQPRKSIFHG-NKFLKRFMNKTNSSAAGTLSTSSDGYFLASSNEF 367

Query: 417 LLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLLLGAQNIVTVKMI 476
           LLRKLADWS MLSD+KTAY  Y  L  D +  P YL+SC E+ A+SLL+GA +IVT KMI
Sbjct: 368 LLRKLADWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMI 427

Query: 477 KTEITPLI----ERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETIL 532
           K +I PLI    +  VA+    G+     RC++  AELFL+L DTWTS P+AI+YLE IL
Sbjct: 428 KNDIDPLIMKYMDSTVASLNYLGK----FRCLVYMAELFLSLSDTWTSAPFAIKYLELIL 483

Query: 533 RDCP-QLGACSQVMIWERLSDCYQSRTDPRVAS---ALSTNTSPGSAQ------PGN--- 579
           ++   +LG  S+ M+WER+S  YQ R DPR+ +    LS N    + +      P     
Sbjct: 484 QNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDDFCMNPNKLHH 543

Query: 580 -EILAQGFTRKRKAAFFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDR 638
             I + G TR RK A FRL+AAKKW E G  RQ  W L     +Y      +  G L+ R
Sbjct: 544 WRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADGTLLSR 603

Query: 639 L 639
           L
Sbjct: 604 L 604

>YJR053W Chr10 (534027..535751) [1725 bp, 574 aa] {ON}
           BFA1Component of the GTPase-activating Bfa1p-Bub2p
           complex involved in multiple cell cycle checkpoint
           pathways that control exit from mitosis
          Length = 574

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 46/103 (44%), Gaps = 10/103 (9%)

Query: 290 LALWDEDPESP-LVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDGHSRAALPLNIITHM 348
           LA +  D E   L    E    ++DE +   SSN     D       S ++LPL I    
Sbjct: 221 LAKFSSDDEGDFLTGFEELEGEAIDETI---SSNDKESADHPRFLKKSSSSLPLKISPAQ 277

Query: 349 YQALDVLVDEMLIPFMHRKTKYW----EENILQPRKSIFHGSN 387
           Y    V  DE+L P +HR+ + W    E +  + ++S+ H SN
Sbjct: 278 YDI--VKHDELLTPGLHRRQRDWNTQQELDSFKEKRSVRHCSN 318

>KLTH0D04444g Chr4 complement(409499..411616) [2118 bp, 705 aa] {ON}
           similar to uniprot|P36000 Saccharomyces cerevisiae
           YKL135C APL2 Beta-adaptin large subunit of the clathrin-
           associated protein (AP-1) complex
          Length = 705

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 115 PLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQLPDELTP 166
           PLP L++S+  Q  L  N+  EW     L  + + TA D  + +++ D +TP
Sbjct: 206 PLPKLIQSHVSQFLLALNECTEWARIIILGALAEYTAKDSLEAQEIIDRVTP 257

>CAGL0M06435g Chr13 (668126..669691) [1566 bp, 521 aa] {OFF} similar
           to uniprot|P38126 Saccharomyces cerevisiae YBR186w PCH2
          Length = 521

 Score = 32.3 bits (72), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 73  DRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFI--RFAQPLPDLLRSYTEQQGLF 130
           D+  +++ Y+ DD ST        NS ++++A Q+Q I  +   P P+L   +   + L+
Sbjct: 200 DKFSIVDSYSNDDESTYNEFSLDQNSSYEKNARQTQSIAHKVILPCPELEGVW---ENLY 256

Query: 131 DNDSLEWYLTHY------LSWIQKLTATDPEKVEQLPDE----LTPSSPPQRGKPLPHKL 180
            N  ++  L +Y      L+W  + T++  + V ++       +    PP  GK    K 
Sbjct: 257 YNKDIKIKLLNYSTASLRLAWYLETTSSSTDVVNEMISANNKMILLHGPPGTGKTTLCKA 316

Query: 181 LRNAV 185
           L N +
Sbjct: 317 LCNKL 321

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 2/69 (2%)

Query: 100 FQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKVEQ 159
           F  +  +SQ  +  QPLP+  ++      L DN+  + Y    LS   +LT T+P     
Sbjct: 367 FDNNNNKSQQQQQQQPLPNFSKTKMRSNTLMDNNETKPYFKRTLSVPNELTVTNP--TSP 424

Query: 160 LPDELTPSS 168
           +P    PSS
Sbjct: 425 IPQSAIPSS 433

>Cgla_YGOB_M06435 Chr13 (668126..669628,669749..669895) [1650 bp,
           549 aa] {ON} ANNOTATED BY YGOB -
          Length = 549

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 73  DRDQLMEHYTLDDSSTGGRTRKRSNSLFQRDATQSQFI--RFAQPLPDLLRSYTEQQGLF 130
           D+  +++ Y+ DD ST        NS ++++A Q+Q I  +   P P+L   +   + L+
Sbjct: 200 DKFSIVDSYSNDDESTYNEFSLDQNSSYEKNARQTQSIAHKVILPCPELEGVW---ENLY 256

Query: 131 DNDSLEWYLTHY------LSWIQKLTATDPEKVEQLPDE----LTPSSPPQRGKPLPHKL 180
            N  ++  L +Y      L+W  + T++  + V ++       +    PP  GK    K 
Sbjct: 257 YNKDIKIKLLNYSTASLRLAWYLETTSSSTDVVNEMISANNKMILLHGPPGTGKTTLCKA 316

Query: 181 LRNAV 185
           L N +
Sbjct: 317 LCNKL 321

>TBLA0C07090 Chr3 complement(1716766..1720209) [3444 bp, 1147 aa]
           {ON} Anc_5.11 YMR308C
          Length = 1147

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 106 QSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATD 153
           + +F  ++  L  LL +Y + QG+ D+DSL+ YL H  S I +L  TD
Sbjct: 591 KEKFSEYSNDLIQLLINY-QNQGIQDDDSLKPYLEHGWSRICRLLGTD 637

>TBLA0D00500 Chr4 (131830..135177) [3348 bp, 1115 aa] {ON} Anc_7.408
           YER110C
          Length = 1115

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 53/238 (22%), Positives = 98/238 (41%), Gaps = 32/238 (13%)

Query: 350 QALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNF----FKKFIGKTTTQRDPSD 405
           Q   V++D  L   M    ++   +IL        GS ++    F K I  T T     D
Sbjct: 354 QVSSVIIDN-LSNMMQSTNQFERRSILLAISVAVTGSPDYILTNFDKIIPATITGL--KD 410

Query: 406 TQ-FFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDLQNSPNYLASCLEWCAVSLL 464
           T+     ++ +C+ +  +D    ++ F   YL    L  D+ +S  ++     +  V+L 
Sbjct: 411 TEPVVKLAALKCIHQLTSDLQDEVAKFHEQYL---PLIIDIIDSAKFVV-IYNYATVALD 466

Query: 465 LGAQNIVTVKMIKTEITPLIERAVATYRQQGRSSYETRCMILSAELFLALRDTWTSTPY- 523
            G    +  + I   + PL+ +    +  Q  +S + RC ++SA    A       TPY 
Sbjct: 467 -GLLEFIAYEAIAKYLEPLMNKLF--FMLQNNNSSKLRCAVVSAIGSAAFAAGTAFTPYF 523

Query: 524 --AIRYLETILRDCPQLGACSQ------VMIWERL--------SDCYQSRTDPRVASA 565
             +++YLE  +++C Q+   S+       + +E +        SD +    +P V SA
Sbjct: 524 KNSVQYLEQFIQNCSQIEGMSEEDIELRAITFENISTMARAVRSDAFAEFAEPLVNSA 581

>Ecym_1202 Chr1 complement(408312..409565,409631..409633) [1257 bp,
           418 aa] {ON} similar to Ashbya gossypii AER439W
           1-intron
          Length = 418

 Score = 31.2 bits (69), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 40/97 (41%), Gaps = 4/97 (4%)

Query: 178 HKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAIDVSRGQDYEVVRDLVTTFKNL 237
           HK   +++ H F A  V+  TR+  F  F   +  +    + +G+D   +    +   + 
Sbjct: 126 HKSSDHSLTHKFVATEVNGNTRVWRFHPFKQELEEVKVTTLKKGKDSNAIPQ-ESAQPDE 184

Query: 238 NKFLEDFPVFINVNDILP---MIVLCYDAADETQLAT 271
            K LE +P F    DI P       C D +    +AT
Sbjct: 185 EKKLEWYPHFTVHGDIYPPNAKFATCVDVSSHNLIAT 221

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 69,366,328
Number of extensions: 3026528
Number of successful extensions: 8709
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8804
Number of HSP's successfully gapped: 46
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)