Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032608.257ON58058031150.0
YDR109C8.257ON71552017380.0
Suva_2.2698.257ON72551717100.0
NCAS0B038708.257ON59658216960.0
KLLA0F19041g8.257ON76355517120.0
Kpol_392.98.257ON59458716880.0
KLTH0G13794g8.257ON72552016980.0
NDAI0J014008.257ON58858116840.0
Skud_4.3708.257ON71452016940.0
Kwal_56.236078.257ON72552016940.0
Ecym_43138.257ON59759416560.0
Smik_4.3558.257ON70452316640.0
KAFR0B055608.257ON60558416530.0
SAKL0H17160g8.257ON73951816650.0
CAGL0B01727g8.257ON57757716390.0
TBLA0E044008.257ON58958616240.0
ZYRO0C01782g8.257ON73051916340.0
TDEL0F038408.257ON72652016230.0
AGR092W8.257ON59658416060.0
TPHA0B032408.257ON58558215960.0
Skud_14.891.111ON5695835793e-66
Smik_14.861.111ON5435865265e-59
YNL249C (MPA43)1.111ON5426045189e-58
Suva_14.931.111ON5435865091e-56
SAKL0C03432g1.111ON5475904644e-50
KLTH0F03080g1.111ON5335834573e-49
TDEL0C059001.111ON5436054574e-49
Kwal_33.135301.111ON5345894372e-46
KNAG0F006601.111ON5355944283e-45
ZYRO0F16016g1.111ON5425894073e-42
KLLA0C02937g1.111ON5164893004e-28
NCAS0A007801.111ON5495171529e-10
NDAI0H002204.9ON8101191073e-04
NCAS0C059004.9ON7033141020.001
YHL032C (GUT1)4.9ON709133910.024
TPHA0K022804.9ON667125890.033
Skud_8.124.9ON710130890.042
Suva_8.194.9ON732130880.056
Smik_8.94.9ON708130870.060
TDEL0G018204.9ON698128870.070
Kpol_1070.24.9ON662129840.14
CAGL0E03916g4.9ON672201820.26
KLLA0E00595g4.9ON661101820.28
KLTH0E05654g4.9ON686196810.30
ACL069C4.9ON644190780.71
KNAG0J029204.9ON675136771.1
SAKL0H25938g4.9ON685103742.0
ZYRO0G07700g4.9ON704125706.2
TDEL0D064903.581ON48791706.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03260
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...  1204   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   674   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   663   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    657   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   664   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   654   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   658   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   653   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   657   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   657   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   642   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   645   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   641   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   645   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   635   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   630   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   634   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   629   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   623   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   619   0.0  
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   227   3e-66
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   207   5e-59
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   204   9e-58
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   200   1e-56
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   183   4e-50
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   180   3e-49
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   180   4e-49
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   172   2e-46
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   169   3e-45
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   161   3e-42
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   120   4e-28
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    63   9e-10
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    46   3e-04
NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4...    44   0.001
YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}  GU...    40   0.024
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    39   0.033
Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON} Y...    39   0.042
Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON} Y...    39   0.056
Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON} YH...    38   0.060
TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9...    38   0.070
Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON} ...    37   0.14 
CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} simila...    36   0.26 
KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON...    36   0.28 
KLTH0E05654g Chr5 complement(499361..501421) [2061 bp, 686 aa] {...    36   0.30 
ACL069C Chr3 complement(232439..234373) [1935 bp, 644 aa] {ON} S...    35   0.71 
KNAG0J02920 Chr10 (561449..563476) [2028 bp, 675 aa] {ON} Anc_4....    34   1.1  
SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} simi...    33   2.0  
ZYRO0G07700g Chr7 complement(609766..611880) [2115 bp, 704 aa] {...    32   6.2  
TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa] ...    32   6.3  

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score = 1204 bits (3115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 580/580 (100%), Positives = 580/580 (100%)

Query: 1   MGEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHC 60
           MGEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHC
Sbjct: 1   MGEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHC 60

Query: 61  VRGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATR 120
           VRGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATR
Sbjct: 61  VRGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATR 120

Query: 121 ETDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180
           ETDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK
Sbjct: 121 ETDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180

Query: 181 DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA 240
           DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA
Sbjct: 181 DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA 240

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL 300
           GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL
Sbjct: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL 300

Query: 301 IAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEEL 360
           IAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEEL
Sbjct: 301 IAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEEL 360

Query: 361 VRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATV 420
           VRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATV
Sbjct: 361 VRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATV 420

Query: 421 IGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI 480
           IGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI
Sbjct: 421 IGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI 480

Query: 481 ADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIMTAMTPMGTRVLP 540
           ADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIMTAMTPMGTRVLP
Sbjct: 481 ADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIMTAMTPMGTRVLP 540

Query: 541 NDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT 580
           NDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT
Sbjct: 541 NDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT 580

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/520 (60%), Positives = 397/520 (76%), Gaps = 8/520 (1%)

Query: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62
           EA +Y+GVDVGTGSARA ++   G  L+L E PIKR++L  +FITQSS EIW+AVC+CVR
Sbjct: 36  EAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVR 95

Query: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122
            VV +SGV+P  V+GIGFDATCSLV V A   + + VGP+F ++ QNIILWMDHRA +ET
Sbjct: 96  TVVEESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKET 155

Query: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182
           + IN++GD+CLKYVGGQMSVEME+PKIKWLK ++  G F  CKFFDLPDYLTF AT K+ 
Sbjct: 156 EEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKEN 215

Query: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242
           RSFCSAVCKQG LP GV+GS+  WS EFL ++GLSEL   +F +LGG+   K  FLTAG+
Sbjct: 216 RSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKKNFLTAGE 275

Query: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHK--------SSGLDVA 294
            +  L  +A+ Q GL+  C+V+SG+IDAYAGW+G+V AK + + K            + A
Sbjct: 276 CISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGA 335

Query: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354
           I RLA +AGTSTCHI+LSK P FV GVWGPYRDVL  G+W AEGGQSCTG LL H++ TH
Sbjct: 336 IGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTH 395

Query: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414
           PA  EL  +A    VS FEYL  +L+TL+ KR+VR+V+ L++  F YGD+HGNRSP+ADP
Sbjct: 396 PAFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADP 455

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474
           +MRA +IGQSMD SIE LAV YL+ACEFI+ QTRQI+E M+++GH +  ++MSGGQCRNS
Sbjct: 456 NMRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNS 515

Query: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 516 LLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           LW +M  +T     V PN+ +  +R  +D KY IFLDMIE Q+ YR  +D+V
Sbjct: 658 LWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKV 709

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/517 (59%), Positives = 391/517 (75%), Gaps = 8/517 (1%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           +++GVDVGTGS RA ++   G  L+L E PIKR+E+R +FITQSS EIW AVCHCV+ V+
Sbjct: 43  FHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVL 102

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
            +S V+P+ V GIGFDATCSLV V A     + VGP+F ++ QNIILWMDHRA +ET+ I
Sbjct: 103 QESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEI 162

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           N+TGD+CLKYVGGQMSVEM++PKIKWLK ++    F  CKFF+LPDYLTF AT K+ RSF
Sbjct: 163 NSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSF 222

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPVG 245
            SAVCKQG LP GV+ S+  WS EFL ++GLSEL   +F +LGG+   K  FL+AG+ VG
Sbjct: 223 ASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKKNFLSAGECVG 282

Query: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK--------FDQSHKSSGLDVAITR 297
            L + ++ + GL+  CIV SG+IDAYAGW+G+V AK         +  H+ + ++ AI R
Sbjct: 283 FLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAIGR 342

Query: 298 LALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAH 357
           LA +AGTSTCHI+LSK P FV GVWGPYRDVL   +W AEGGQSCTGALLAH+++THPA 
Sbjct: 343 LAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHPAF 402

Query: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMR 417
            EL +LA    +S FEYL  ML+TL+ KR  R+V+ L++ FF YGD+HGNRSP+ADP+MR
Sbjct: 403 TELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPNMR 462

Query: 418 ATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLM 477
           A +IGQSMD S+E LAV YL ACEFI+ QTRQI+E M+ NGH ++ ++MSGGQCRN LLM
Sbjct: 463 ACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGLLM 522

Query: 478 QLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           +L+AD  G+P+++P+Y D  VVFG+ALL   AS+  D
Sbjct: 523 RLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASD 559

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 32/52 (61%)

Query: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           LW +M  +T     V PND +  +R  +D KY IFLDM E Q+ YR+ +D+V
Sbjct: 665 LWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRV 716

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  657 bits (1696), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/582 (54%), Positives = 412/582 (70%), Gaps = 9/582 (1%)

Query: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62
           + GYY+G+DVGTGS RA ++   G  L+L E  I R+EL+ +FITQS+ EIW A C CV+
Sbjct: 13  QTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVK 72

Query: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122
             + +  V+  LV GIGFDATCSLVA++  T   V VGPNF++   N+ILWMDHRA +E 
Sbjct: 73  TAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEA 132

Query: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182
           + INAT D+CLKYVGG MSVEM++PKIKWLK +M    F KC+FF+L DYLTF AT K  
Sbjct: 133 NEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRT 192

Query: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT--SESKPKFLTA 240
           RSFCS VCKQG LP GV+GS   WS EFL ++GL +L   ++  LGG   ++S+  F ++
Sbjct: 193 RSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQSS 252

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHK-----SSGLDVAI 295
           G+ +G L+ EA  + GLS +C+V +G+IDAYAG IG++ A  + SH+     S GL  AI
Sbjct: 253 GKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKNDSSIGLQNAI 312

Query: 296 TRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHP 355
            RLA +AGTSTCH++LSK P FVPGVWGPYRDV+  GYWCAEGGQ+CTG LL+++L  HP
Sbjct: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372

Query: 356 AHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415
           A +EL+  +   ++  F+YL  MLD L +K +V + L+L++  F YGD+ GNRSP ADP 
Sbjct: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432

Query: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSL 475
           M A +IGQSM+ ++E+LAV YLAACEFIA QTRQIVET+ + G  V  +YMSGGQCRN L
Sbjct: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492

Query: 476 LMQLIADSVGVPVVLPKYTDCCVVFGAALLACC--ASKGCDGIEADQSTRLWDIMTAMTP 533
           LM+L++D  G+P++LPKY D  VVFGAA+L     AS+    IE D    LW+ M  MTP
Sbjct: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIECDFGFMLWETMDRMTP 552

Query: 534 MGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
            GT + PND +  +RK +D KY IFLDM E Q+ YR  +D +
Sbjct: 553 HGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDI 594

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/555 (58%), Positives = 402/555 (72%), Gaps = 26/555 (4%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YY+GVDVGTGSARA ++ + G  L+L E PI+R EL+ ++ITQSS EIW+A+C+CV+ VV
Sbjct: 36  YYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKNVV 95

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV+PR + GIGFDATCSLV VD    D V VGP+F D+ QNIILWMDHRA  ET+ I
Sbjct: 96  RDSGVDPRTIHGIGFDATCSLVVVDNNNED-VGVGPDFTDNLQNIILWMDHRAIEETEEI 154

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           NATGD+CLKYVGGQMSVEME+PKIKWLK ++P  +F +CKFFDL DYLTF AT  + RS+
Sbjct: 155 NATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIRSY 214

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPVG 245
           CS VCKQGLLP GV+GS+  WS EFL+ +GL ELI  +F +LGG S ++  FL+AG+ +G
Sbjct: 215 CSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGG-SVTETTFLSAGECIG 273

Query: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKSSGLDVAITR 297
            LT E++ + GLST C+V SGVIDAYAGW+G+V A+ D              G+D A  R
Sbjct: 274 TLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGIDRATGR 333

Query: 298 LALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAH 357
           LA +AGTSTCHI +SK P FV GVWGPYRDV+ PG+W AEGGQSCTGALLAH+L THPA+
Sbjct: 334 LAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLTTHPAY 393

Query: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMR 417
            EL +L+    VS F+YL   L+ L  +R+  +V+ L++  F YGD+HGNRSP+ADPSMR
Sbjct: 394 AELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIADPSMR 453

Query: 418 ATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLM 477
           A +IGQSMD SI+ L++ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN LLM
Sbjct: 454 AAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCRNGLLM 513

Query: 478 QLIADSVGVPVVLPKYTDCCVVFGAALLACCASK---GCDGIEADQSTRLWDIMTAMTPM 534
           +L+AD  G+P+V+P+Y D  VVFG+ALL   AS+    C  +E           TA  P 
Sbjct: 514 RLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNACAKLEE----------TASDPA 563

Query: 535 GTRVLPNDDSSFERK 549
            T    N D S  RK
Sbjct: 564 TTS---NKDVSIRRK 575

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 34/53 (64%)

Query: 523 RLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           +LW++M  MT  G  V P ++ + +R  ++AKY IFLDM   Q+ YR  +D+V
Sbjct: 710 KLWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEV 762

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/587 (54%), Positives = 407/587 (69%), Gaps = 16/587 (2%)

Query: 5   GYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGV 64
            +YIGVDVGTGS RA ++   G  L+L    I ++EL+ ++ITQSS EIW  +C CV  V
Sbjct: 2   NHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYV 61

Query: 65  VTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDA 124
           + +S + P  V GIGFDATCSLV +D  T   V VGPNF+D  +NIILWMDHRA +ETD 
Sbjct: 62  LQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDE 121

Query: 125 INATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRS 184
           INATGD+CLKYVGG+MSVEMELPKIKWLK ++  G F+ CKFFDL DYLT+ AT KD RS
Sbjct: 122 INATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRS 181

Query: 185 FCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKP---KFLTAG 241
           F S VCKQGLLP GV+GS+  WS EF   + L EL   NF  +GG+  S+       + G
Sbjct: 182 FSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVG 241

Query: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQ-------SHKSSGLDVA 294
           + VG L+  ++++ GL T+CIV SG+IDAYAGW+G+V AK ++          SS LD +
Sbjct: 242 EYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSS 301

Query: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354
           I  LA+IAGTSTCHI LS  P FV G+WGPYRDVL   +WCAEGGQSCTGALL HIL TH
Sbjct: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361

Query: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414
           PA+ EL     K  V  FE+L   L  L  +   R+++ L + FFLYGD+HGNRSP++D 
Sbjct: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474
           SMRA +IGQSMD SI+SLA+ YL+ACEFI+ Q+RQI+  +V+ GH ++ +YMSGGQ RN 
Sbjct: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481

Query: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCAS-----KGCDGIEA-DQSTRLWDIM 528
           LLM+L+AD  G+PVV+P+Y D  V+FG+A+L   A      K  DG +  D    LW+ M
Sbjct: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKM 541

Query: 529 TAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
             +TP GT + PN  +  +R  ++AKY IFLDM E Q+ YR Q+D++
Sbjct: 542 CKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/520 (59%), Positives = 386/520 (74%), Gaps = 11/520 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YY+GVDVGTGSARA ++   G  L+L E PI+R++L+ +FITQSS EIW AVCHCV+ VV
Sbjct: 34  YYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKSVV 93

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV    + GIGFDATCSLV V+  T   V VGP+F ++ QNIILWMDHRA  ET  I
Sbjct: 94  RDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQLI 153

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           NATGD+CLKYVGGQMSVEME+PKIKWLK H+P  +F +CKFFDL DYLTF A+ K+ RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETRSF 213

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK---FLTAGQ 242
           CS VCKQGLLP GV+GS   WS EFL  +GL ELI+ +F ++GG+ ++  K   FL+AG+
Sbjct: 214 CSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSAGE 273

Query: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVA 294
            +G +    +E+ GLS  C+V SGVIDAYAGW+G+V A+ D S         +  G+D A
Sbjct: 274 FIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMDRA 333

Query: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354
             RLA +AGTSTCHI +S+ P FV GVWGPYRD L   +WCAEGGQSCTGALLAH+L TH
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLTTH 393

Query: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414
           PA+ EL +LA    VS F+YL   L+TL  +++ R+V+ L++  F YGD+HGNRSP+ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIADP 453

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474
           SMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIV+ M  +GH +  ++MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCRNG 513

Query: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 37/64 (57%)

Query: 515 GIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQ 574
           G  +D    +W++M  MT  G  V P  + + +R  ++AKY IFLDM E Q+ YR+ +D 
Sbjct: 662 GRSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721

Query: 575 VFRS 578
             R+
Sbjct: 722 AVRN 725

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/581 (55%), Positives = 404/581 (69%), Gaps = 12/581 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YYIGVDVGTGS RA ++   G   +  E  I RQEL+ D ITQSS EIW AVC CV+ VV
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
            + G     VKGIGFDATCSLV VD VT   V VGP+F+DS Q+IILWMDHRA +ET  I
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           N+T D CLKYVGGQMS+EMELPKIKWLK HM +  F +C+F+DL DYLTF AT +  RSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESK--PKFLTAGQP 243
           CS VCKQG++P GV+GS+  WS +FL  + L EL   ++ +LGG+        FLTAG+ 
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFLTAGEY 246

Query: 244 VGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGA---KFDQSHKSSGLDVAITRLAL 300
           +  L  +A E+  LS  CIV SG+IDAYAGW+G+VG+     +Q  +  G+  AI RLA 
Sbjct: 247 IAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGSGTVDLEQLFR-VGMANAIGRLAA 305

Query: 301 IAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEEL 360
           +AGTSTCHI+LSK P FVPGVWGPY+D +  GYWC EGGQSCTGALL H+L+THP+++EL
Sbjct: 306 VAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHPSYKEL 365

Query: 361 VRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATV 420
             ++ K  ++ F+YL   L  +  +   R+VL L++  F YGD HGNRSPLADPSM+  +
Sbjct: 366 EEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPSMKGAI 425

Query: 421 IGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI 480
           +G SMD S+++LA  YLAACEFIA Q RQI+E M   GH +  +YMSGGQCRNSLLM+L+
Sbjct: 426 VGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSLLMKLL 485

Query: 481 ADSVGVPVVLPKYTDCCVVFGAALLACCASK--GCDGIEADQSTR----LWDIMTAMTPM 534
           AD  G+ V++P+Y D  VVFGAA+L   ASK    +G E+D        LW  M  MT +
Sbjct: 486 ADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMNKMTKV 545

Query: 535 GTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           G+ ++P      +R  +DAKY IFLDM +RQK YR+ +D V
Sbjct: 546 GSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAV 586

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/520 (58%), Positives = 388/520 (74%), Gaps = 8/520 (1%)

Query: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62
           E  +Y+GVDVGTGSARA ++   G  L+L E PIKR+ELR +FITQSS EIW AVCHCV+
Sbjct: 36  EVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVK 95

Query: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122
            V+ +S V+P  V G+GFDATCSLV V A     V VGP+F  + QNIILWMDHRA +ET
Sbjct: 96  AVIQESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKET 155

Query: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182
           + IN++ D+CLKYVGGQMSVEME+PKIKWLK ++    F  CKFFDLPDYLTF AT K+ 
Sbjct: 156 EEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKEN 215

Query: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242
           RSF SAVCKQG LP GV+GS   WS EFL  +GLSELI+++F +LGG+   K  FL+AG+
Sbjct: 216 RSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKKNFLSAGE 275

Query: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK--------FDQSHKSSGLDVA 294
            +G L  +A+ + GL+ +C+V+SG+IDAYAGW+G+V AK         +    +   + A
Sbjct: 276 CIGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGA 335

Query: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354
           I RLA +AGTSTCHI+LSK P FV G+WGPYRDVL  G+W AEGGQSCTG LL H+++ H
Sbjct: 336 IGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIH 395

Query: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414
           PA+ EL +L     VS FEYL  ML+T++ KR  R+V+ L+R  F YGD+HGNRSP+AD 
Sbjct: 396 PAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADS 455

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474
           +MRA +IGQSMD S+E LA+ YL+ACEFI+ QTRQIVE M+++GH ++ ++MSGGQCRN 
Sbjct: 456 NMRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRND 515

Query: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           LL +L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 516 LLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFD 555

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 31/57 (54%)

Query: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT 580
           LW +M  +T     V PN  +  +R  +D KY IFLDM E QK YR  +D +  S +
Sbjct: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFS 713

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/520 (59%), Positives = 387/520 (74%), Gaps = 11/520 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YYIGVDVGTGSARA ++   G  L+L E PI+R++L+ +FITQSS EIW AVCHCV+ VV
Sbjct: 34  YYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKSVV 93

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV    + GIGFDATCSLV V+  +   V VGP+F ++ QNIILWMDHRA  ET+ I
Sbjct: 94  RDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETEQI 153

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           NATGD+CLKYVGGQMSVEME+PKIKWLK H+P  +F +CKFFDL DYLTF A+ K+ RSF
Sbjct: 154 NATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETRSF 213

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK---FLTAGQ 242
           CS VCKQGLLP GV+GS+  WS EFL  +GL + I+ +F ++GG+ ++  K   FL+AG+
Sbjct: 214 CSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSAGE 273

Query: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLDVA 294
            VG +    +E+ GLS  C+V SGVIDAYAGW+G+V A+ D S         +  G+D A
Sbjct: 274 FVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMDRA 333

Query: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354
             RLA +AGTSTCHI +S+ P FV GVWGPYRD L   +WCAEGGQSCTGALLAH++ TH
Sbjct: 334 TGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMTTH 393

Query: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414
           PA+ EL +LA    VS F+YL   L+TL  +++ R+V+ L+R  F YGD+HGNRSP+ADP
Sbjct: 394 PAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIADP 453

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474
           SMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN 
Sbjct: 454 SMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCRNG 513

Query: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+  D
Sbjct: 514 LLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFD 553

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 39/64 (60%)

Query: 515 GIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQ 574
           G  +D    +W++M  MT  G  V P  + + +RK +D KY IFLDM E Q+ YR+ +++
Sbjct: 662 GRSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNE 721

Query: 575 VFRS 578
           V +S
Sbjct: 722 VEKS 725

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/594 (52%), Positives = 411/594 (69%), Gaps = 20/594 (3%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           +YIGVDVGT S RA ++   G  L+L   PI RQE++ +++TQSS+EIW A+C C+R ++
Sbjct: 4   HYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKII 63

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             S V    + GIGFDATCSLV ++ VT   V VGPNFDD  Q+IILWMDHRA  E + I
Sbjct: 64  CDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNEI 123

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           N+TG RCLKYVGG+MS+EM++PKIKWLK ++P+G+F KC+F+DLPD+LT+ AT    RSF
Sbjct: 124 NSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRSF 183

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT-SESKPKFLTAGQPV 244
           CS VCK GLLP GVDGS   W  +  E +GL+EL    F +LGG  S +   FL+AG  V
Sbjct: 184 CSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDYV 243

Query: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALIAGT 304
           G L+ EA+   GL+T CIVASG+IDAYAGW+G++ A           ++A +RLA +AGT
Sbjct: 244 GHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAAGITLGSDGQESELASSRLATVAGT 303

Query: 305 STCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLA 364
           STCHI +SK P F+ GVWGPYRD L+PGYW  EGGQSCTGALLAH+L++HPA++ L +LA
Sbjct: 304 STCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHPAYDTLCKLA 363

Query: 365 AKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQS 424
             Q +S F+++   L+ L  +R  ++V  L +  F YGD+HGNRSP+ADP+MRAT+IGQS
Sbjct: 364 KNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPNMRATIIGQS 423

Query: 425 MDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSV 484
           MDVS++ LA+  L ACEFIA QTRQIVE + ++GH +  +YMSGGQCRN +L++L+A+  
Sbjct: 424 MDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLVLIKLLANCT 483

Query: 485 GVPVVLPKYTDCCVVFGAALLACCASK----GCDGIEA-----DQ----------STRLW 525
            +P+VLPKY D  VVFG+ALL   AS+    GC    +     DQ           + LW
Sbjct: 484 KLPIVLPKYIDAAVVFGSALLGVAASEKYLHGCSDTASVSTIVDQQRITSELKPKQSILW 543

Query: 526 DIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSI 579
            +M  +T +G  + P++    E + +D KY IFLDMIE QK YR  + +   S+
Sbjct: 544 TVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRDLVTRAENSV 597

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  645 bits (1664), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/523 (58%), Positives = 387/523 (73%), Gaps = 14/523 (2%)

Query: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62
           E  +Y+GVDVGTGS RA ++   G  L+L E PIKR+EL  +FITQSS EIW+AVC+CVR
Sbjct: 27  ETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVR 86

Query: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122
            V+ ++GV+P  + GIGFDATCSLV V A     + VGP+F ++ QNIILWMDHRA +ET
Sbjct: 87  KVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKET 146

Query: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182
           + IN +G+ CLKYVGGQMSVEME+PKIKWLK ++  G F  CKFFDLPDYLTF AT K+ 
Sbjct: 147 EEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKEN 206

Query: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242
           RSF S VCKQG LP GV+GS   WS +FL+++GLSEL D +F +LGG+  ++  FL+AG+
Sbjct: 207 RSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGE 266

Query: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK-----------FDQSHKSSGL 291
            +G L  +A+ Q GL+  C+V+SG+IDAYAGW+G+V AK            D  H  +G 
Sbjct: 267 CIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNG- 325

Query: 292 DVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHIL 351
             AI RLA +AGTSTCHI+LSK   FV G+WGPYRDVL  G+W AEGGQSCTG LL H++
Sbjct: 326 --AIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVI 383

Query: 352 ETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPL 411
            THPA  +L +LA    VS FEYL  +L+ L+ KR+ R+V+ L++  F YGD+ GNRSP+
Sbjct: 384 TTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPI 443

Query: 412 ADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQC 471
           ADP+MRA +IGQSMD SI+ LAV YL ACEFI+ QTRQI+E M+++GH +  V+MSGGQC
Sbjct: 444 ADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQC 503

Query: 472 RNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514
           RN LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   ASK  D
Sbjct: 504 RNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 511 KGCDGIEADQSTR---LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKL 567
           KG + +E ++      LW +M  +T     + PN  +  +R  +D KY IFLDM+E Q+ 
Sbjct: 631 KGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRN 690

Query: 568 YRSQMDQV 575
           YR  +D+V
Sbjct: 691 YRRMVDKV 698

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/584 (53%), Positives = 400/584 (68%), Gaps = 12/584 (2%)

Query: 2   GEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCV 61
           G+  ++IGVDVGTGS RA ++   G  LAL + PI R+EL+  FITQSS EIW ++C CV
Sbjct: 16  GDNFHFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCV 75

Query: 62  RGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRE 121
           R V+  + +    V GIGFDATCSL  VD  T + + VGP F  + QNII+WMDHRA++E
Sbjct: 76  RKVIADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQE 135

Query: 122 TDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKD 181
           TD IN+  D  LKYVGG+MS+EME+PKIKWLK HMPR  F K  FFDLPDYLTF AT   
Sbjct: 136 TDEINSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQ 195

Query: 182 RRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAG 241
            RS CSAVCKQGLLP GV+GS   WS  FL   GL ELI+  F ++GG   +   FL+AG
Sbjct: 196 NRSLCSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAG 255

Query: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKS----SGLDV--AI 295
           + V  L+  + EQ GL+ SC+V SG+IDAYAG IG++ A+ D+S ++    +G D+  AI
Sbjct: 256 EYVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESARTQDDANGQDLQNAI 315

Query: 296 TRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHP 355
            RLA +AGTSTCHI LS  P FV GVWGPY+D+L   YWCAEGGQSCTG LL H++ THP
Sbjct: 316 GRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHP 375

Query: 356 AHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415
           A+EEL   AAK ++  FE L  ++  L  ++    +LEL++  FLYGD+HGNRSP+ADP 
Sbjct: 376 AYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPR 435

Query: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSL 475
           MRA++IGQSMD ++ESLA+ YLAACEFIA QTR I+  M   GH +  +YMSGGQCRN++
Sbjct: 436 MRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNI 495

Query: 476 LMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQST------RLWDIMT 529
           LM+L+AD  G+PVV+PKY D  VVFGAAL+   A    +  E +          LW+ M 
Sbjct: 496 LMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAMV 555

Query: 530 AMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMD 573
            MT  GT + P  +    +  ++ KY I++DM + QK YRS +D
Sbjct: 556 KMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  645 bits (1665), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/518 (59%), Positives = 382/518 (73%), Gaps = 12/518 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YY+GVDVGTGSARA ++ + G  L+L E PI+RQEL+  +ITQSS EIW A+C+CV+ VV
Sbjct: 34  YYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKSVV 93

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV P  + GIGFDATCSLV V+  +   V VGP+F ++ QNIILWMDHRA  ET  I
Sbjct: 94  KDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETKEI 153

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           NAT D+CLKYVGGQMSVEME+PKIKWLK ++PR +F KCKFFDL DYLTF AT  + RS+
Sbjct: 154 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETRSY 213

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESK----PKFLTAG 241
           CS VCKQGLLP GV+ S+  WS EFL  +GL +L   +F +LGG+ +S       FL+AG
Sbjct: 214 CSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLSAG 273

Query: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKSSGLDV 293
           + +G L   A+E+ GL   C+V SGVIDAYAGW+G+V A+ D          ++ +G+D 
Sbjct: 274 ECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGIDH 333

Query: 294 AITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILET 353
           A  RLA +AGTSTCHI +SK P FV GVWGPYRDV+ PG+WCAEGGQSCTGALLAH+L  
Sbjct: 334 ATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLTI 393

Query: 354 HPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLAD 413
           HPA+ EL  L+    VS F+YL   L+ L  +R  R+V+ L++  F YGD+HGNRSP+AD
Sbjct: 394 HPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPIAD 453

Query: 414 PSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRN 473
           PSMRA VIGQSMD SI+ LA+ YL ACEFIA QTRQIVE M  +GH +  ++MSGGQCRN
Sbjct: 454 PSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQCRN 513

Query: 474 SLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511
            LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   AS+
Sbjct: 514 GLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASE 551

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 33/52 (63%)

Query: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           LWD+M  MT  G  V P+ D   +R  +DAKY IFLDM E Q+ YR  +D+V
Sbjct: 676 LWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKV 727

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/577 (52%), Positives = 395/577 (68%), Gaps = 5/577 (0%)

Query: 5   GYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGV 64
           GYYIGVDVG+GS RA ++   GA L++    I ++E     +TQSS+EIW AVC+CV+  
Sbjct: 2   GYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSA 61

Query: 65  VTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDA 124
           +  S VN   + GIGFDATCSLV ++  + + V  GPNFD++ QNII+WMDHRA  ET  
Sbjct: 62  IGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKE 121

Query: 125 INATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRS 184
           IN +GD CLKYVGGQMSVEME+PKIKWLK HM   +F K  F DLPDYLTFMA+  + RS
Sbjct: 122 INRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRS 181

Query: 185 FCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQPV 244
           +CSAVCKQG LP GV+GS   WS EFL  +GL E+  +NF  LGG +ES   F  AG  +
Sbjct: 182 YCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNESG-NFTYAGNQL 240

Query: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGA---KFDQSHKSSGLDVAITRLALI 301
             ++    +   ++  CIV SG+IDAYAGWIG+V +   +   + +   ++    RLA +
Sbjct: 241 STVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVPNNKEVVDIEECAGRLAAV 300

Query: 302 AGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELV 361
           AGTSTCHI+LSK   FVPGVWGPYRDVL+P YWCAEGGQS TGALLAHIL  HP+  EL 
Sbjct: 301 AGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSANELS 360

Query: 362 RLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVI 421
            L  ++ V  F +L   +  L  K  +   L L++ FFLYGD+HGNRSP+ADP+MRA +I
Sbjct: 361 NLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMRAAII 420

Query: 422 GQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIA 481
           GQSMD S++ LA  YLAACEFIA QT+ I++T++  GH ++ +YMSGGQCRN++LMQLIA
Sbjct: 421 GQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILMQLIA 480

Query: 482 DSVGVPVVLPKYTDCCVVFGAALLACCA-SKGCDGIEADQSTRLWDIMTAMTPMGTRVLP 540
           +  G+P+++PKY D  VVFG+A+L   A S   +  +   +  LW  M+ MTP GT V P
Sbjct: 481 NCTGLPLIIPKYIDSAVVFGSAILGAMAYSSSKNNSDKGGADLLWSTMSNMTPDGTTVFP 540

Query: 541 NDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFR 577
             + S ERK ++ K+ IFLDM + Q+ YR  ++   R
Sbjct: 541 ATEDSIERKLINVKHKIFLDMAKTQQTYRQLVENAIR 577

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  630 bits (1624), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/586 (52%), Positives = 409/586 (69%), Gaps = 19/586 (3%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YYIGVDVGTGSARA ++  +G  L+++E  I RQEL+  +ITQS+++IW+ +C C+R ++
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 66  TKSGVN--PRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETD 123
            +S V+     +KGIGFDATCSLV +++ T   V VGPNF+D+ QN+ILWMDHRA  ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 124 AINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRR 183
            IN+T  +CLKYVGGQMSVEME+PKIKWLK +M    +  CKF DLPD+LT+ AT    R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 184 SFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGG----TSESKPKFLT 239
           SFCSAVCKQGLLP GV+GS   W+ EFL  +GL +L++ NFV+LGG     S+ K  F T
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 240 AGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQ--------SHKSSGL 291
           AG+ +G L+ ++S+  G+S+ C V+SG+IDAYAGWIG++ A   +            +G+
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLNGM 302

Query: 292 DVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHIL 351
             +  RLA++AGTSTCHI L+  P FVPGVWGPYRDVL   +WCAEGGQSCTGALL H+L
Sbjct: 303 ICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQHVL 362

Query: 352 ETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPL 411
           ETHPA++EL  ++ +Q +S FE L   +  L  +R + + + L ++ F YGDFHGNRSP+
Sbjct: 363 ETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRSPV 422

Query: 412 ADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQC 471
           AD +MR  +IG SMD S+  L   YL ACEFIA QTR IV+ M ++G+ +  +YMSGGQC
Sbjct: 423 ADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGGQC 482

Query: 472 RNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTR----LWDI 527
           RN LLMQLI++ VG+PVV+PK  D  VVFG+AL+  CAS+      +D + +    LWD+
Sbjct: 483 RNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSKS-HSDNTKKPDQILWDV 541

Query: 528 MTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMD 573
           M  MT  G  V P D SS   K +  KY I+LDMI  QK YRS ++
Sbjct: 542 MCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/519 (57%), Positives = 382/519 (73%), Gaps = 13/519 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YYIGVDVGTGSARA ++   G  ++L E PI+R+EL+  +ITQSS EIWSA+C+CV+ VV
Sbjct: 33  YYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKTVV 92

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV+   + GIGFDATCSLVAV++  G  VPVGP+F++  QNIILWMDHRA +ET  I
Sbjct: 93  RDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETAEI 152

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           N+T    LKYVGGQMS+EME+PKIKWLK HMPR +F    FFDL D+LT+ AT    RSF
Sbjct: 153 NSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTRSF 212

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESK-----PKFLTA 240
            S+VCKQGLLP GV+GS   WS EFL  + L EL+  +F +LGG+ + K       FL+A
Sbjct: 213 NSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFLSA 272

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQS--------HKSSGLD 292
           GQ VG L+ EA+   GL+  C+V SGVIDAYAGW+G+V A+ D+             G+D
Sbjct: 273 GQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLGVD 332

Query: 293 VAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILE 352
            A  RLA +AGTSTCH+ LS+ P FVPGVWGPYRDV+ PG+WCAEGGQSCTGALLAH+L 
Sbjct: 333 KATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVLS 392

Query: 353 THPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLA 412
           THPA+ +L  L+    +S F+YL   L+ L+  R+ R+V+ L++  F YGD+HGNRSP+A
Sbjct: 393 THPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSPIA 452

Query: 413 DPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCR 472
           D +MRA +IGQSMD S++ LA++YL ACEFIA QTRQIVE M ++GH +  ++MSGGQCR
Sbjct: 453 DNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQCR 512

Query: 473 NSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511
           N LLM+L+AD  G+P+++P+Y D  VVFG+ALL   AS+
Sbjct: 513 NGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 551

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 523 RLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
            LW +M  MT  G  V PN D++ +R  ++AKY IFLDM   Q+ YRS +D+V
Sbjct: 668 ELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRV 720

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/520 (57%), Positives = 376/520 (72%), Gaps = 15/520 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YY+GVDVGTGSARA ++ + G  L+L E PI+R+EL+ ++ITQSS EIW ++CHCV+ VV
Sbjct: 34  YYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKSVV 93

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
             SGV    + GIGFDATCSLV VD    + V VGP F ++ QNI+LWMDHRA  ET+ I
Sbjct: 94  RDSGVPVERIHGIGFDATCSLVVVDDEDKE-VGVGPVFANNDQNIVLWMDHRAIAETNEI 152

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           NAT D+CLKYVGGQMSVEME+PKIKWLK ++P+ QF KCKFFDL DYLTF AT KD RSF
Sbjct: 153 NATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTRSF 212

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQ------LGGTSESKPKFLT 239
           CS VCKQGL+P GV+GS+  WS +FL  + L EL++  F Q            +   FL+
Sbjct: 213 CSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSFLS 272

Query: 240 AGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFD--------QSHKSSGL 291
           AG+ VG L  EA+E+ GL   C+V SGVIDAYAGW+G+V A+ D              G+
Sbjct: 273 AGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKKGI 332

Query: 292 DVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHIL 351
           D A  RLA +AGTSTCHI LS+ P FV GVWGPYRDV+  G+W AEGGQSCTGALLAH++
Sbjct: 333 DRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAHVM 392

Query: 352 ETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPL 411
            THPA  EL  L+    +S F+YL   L+TL+ +R  R+V+ L++  + YGD+HGNRSP+
Sbjct: 393 STHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRSPI 452

Query: 412 ADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQC 471
           ADPSMRA +IGQSMD SI+ LA+ YL ACEFIA QTRQIVE M   GH +  ++MSGGQC
Sbjct: 453 ADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGGQC 512

Query: 472 RNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASK 511
           RN LLM+L+AD  G+P+++P+Y D  VVFG+ALL   AS+
Sbjct: 513 RNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASE 552

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 36/56 (64%)

Query: 524 LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSI 579
           LWD+M  MT  G  V P+ +   +R  ++AKY IFLDM + Q+ YR  +D+V ++I
Sbjct: 669 LWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAI 724

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/584 (53%), Positives = 397/584 (67%), Gaps = 14/584 (2%)

Query: 6   YYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           YY+GVDVGT  ARA ++   GA LA  ++PI R + + D ITQSSSEIW AVC  VR  V
Sbjct: 9   YYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAAV 68

Query: 66  TKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAI 125
            +S V    V GI FDATCSLV +D  +   V VGP+F D+ QN+ILWMDHRA  E   I
Sbjct: 69  AESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASEI 128

Query: 126 NATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSF 185
           N+TG   L+YVGG+MSVEM++PKIKWL+ HMPRG+F KCKF+DLPD+LT+ AT  + RSF
Sbjct: 129 NSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRSF 188

Query: 186 CSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGT-SESKPKFLTAGQPV 244
           CS VCK GL+P GVD S   WS EFLE +GL EL +  F +LGG   E   +F +AG+PV
Sbjct: 189 CSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEPV 248

Query: 245 GQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALIAGT 304
           G L+  A+   GL+  C+V SGVIDAYAGW+G+VGA  D + +S G++    RLA +AGT
Sbjct: 249 GLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEELAGRLAAVAGT 308

Query: 305 STCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLA 364
           STC IMLS+ P FV GVWGPYRDVL  GYWC EGGQSCTGALLAH L THPA+ EL + A
Sbjct: 309 STCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTHPAYTELHQAA 368

Query: 365 AKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQS 424
            ++ ++ F+Y+   LD L  +   R++  L++  FLYGD+HGNRSPLADPSMRA ++G S
Sbjct: 369 QQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADPSMRAAMVGLS 428

Query: 425 MDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSV 484
           MDVS + LA+  L A EFIALQ R I++ M   G  V+ VY+SGGQ RN LL QL+AD+V
Sbjct: 429 MDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNPLLTQLLADAV 488

Query: 485 GVPVVLPKYTDCCVVFGAALLACCASKG-CDGIEADQST------------RLWDIMTAM 531
             PVV P++    VVFG+ALLA  A +       A  S+            RLW IM+ +
Sbjct: 489 RRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPMHRLWQIMSRL 548

Query: 532 TPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           T  G  V P+ D+  + + ++AKY +FL+M E QKLYR  +D V
Sbjct: 549 TVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDV 592

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/582 (51%), Positives = 401/582 (68%), Gaps = 11/582 (1%)

Query: 7   YIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVVT 66
           YIGVDVGTGSARA +   +G  LA+E   I +QEL++ FITQSS+EIW A+   ++ V+ 
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 67  KSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDAIN 126
            S V+P  + GI FDATCSLV  D  + + + VGPNFDDS QNIILWMDHRA  ETD IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 127 ATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRSFC 186
           +T D+ LKYVGG+MSVE ELPKIKWLK H+    F +C F DL D+LT+ AT K   SF 
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 187 SAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKP-KFLTAGQPVG 245
           SAVCKQGLLP GV+GS+  WS EFLE +GL EL   NF +LGG+   K   FL  G  VG
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 246 QLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKF------DQSHKSSGLDVAITRLA 299
            +  + +    L   C+V +GVIDAY+GW+G+V +        D   + + ++ ++ R+A
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNKIEGSLGRIA 303

Query: 300 LIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETHPAHEE 359
           +++GTSTCHI+LSK P F+ GVWGPYRDVL    W  EGGQS TGALL +I+ETHPA++E
Sbjct: 304 VVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAYQE 363

Query: 360 LVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMRAT 419
           L R+ ++Q  + F YL   L+ L + R++ +V  L+++ F+YGD++GNRSPLADP M   
Sbjct: 364 LERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMSGM 423

Query: 420 VIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQL 479
           +IGQ+MD SI  LA++YLAACEFIALQTR I++T+V +GH +  +YMSGG C+N LLM+L
Sbjct: 424 IIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLMEL 483

Query: 480 IADSVGVPVVLPKYTDCCVVFGAALLACCASK----GCDGIEADQSTRLWDIMTAMTPMG 535
           I++   +P+VL KY D  VVFGAA+L   A+K      + +E   +  LW  M  MTP G
Sbjct: 484 ISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENKLEYSLNDVLWSQMKLMTPKG 543

Query: 536 TRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFR 577
           T ++P  + S  RKY+ AKY ++LDMI+    YR +M++V++
Sbjct: 544 TLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEVYK 585

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  227 bits (579), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 178/583 (30%), Positives = 274/583 (46%), Gaps = 66/583 (11%)

Query: 8   IGVDVGTGSARAVMLQHDGAAL---ALEEHPIKRQELRVDF-ITQSSSEIWSAVCHCVRG 63
           IG+DVG+ SAR  +  ++  AL   A E  P  +   R  +   Q S+EI  A+  C++ 
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVPYYQDSSRTSWKFWQRSTEIIKALQKCLQ- 92

Query: 64  VVTKSGVNPRLVKGIGFDATCSLVAV--DAVTGDAVPVGPNFDDSTQNIILWMDHRATRE 121
              K  +    VK  G  ATCSL     D   G  +P  PN D    N+I WMD  A  E
Sbjct: 93  ---KLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPY-PNED----NVIFWMDSSAIDE 144

Query: 122 TDAINAT-GDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180
              +NA    + L ++GG    EM +PK+K+        Q  +   FDL  Y+ +  +  
Sbjct: 145 CKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHL 204

Query: 181 DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA 240
            + +    + ++     GVDG    WSP F E   +  L     +   G +  K      
Sbjct: 205 YQWNNEVLLKRENNKMVGVDGEASGWSPSFYE--NIMHLPSNVIIGSNGATCKK------ 256

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL 300
                           +++S IV S  ID+YA W        +            T L +
Sbjct: 257 ----------------IASSAIVRS-CIDSYASWFAVSSPHLE------------TSLFM 287

Query: 301 IAGTSTCHIMLSKGPQF-VPGVWGPYRDVLIPG--YWCAEGGQSCTGALLAHILETHPAH 357
           IAGTSTC++  +      +PGVWGP+  +L     +     GQSCTG L+ H+  THP  
Sbjct: 288 IAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHPCA 347

Query: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSMR 417
           +E+++  A      ++ L   +  +  K+  ++V   ++  F YGD+ GNR+P ADP M+
Sbjct: 348 KEILKRGADI----YQVLERTIHDI-EKQNGQSVHVFTKDIFFYGDYEGNRTPFADPRMK 402

Query: 418 ATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRN--GHVVECVYMSGGQCRNSL 475
            + IG++ D SI +L  +Y+   EF++ QTR I++T  R   G  ++ + +SG Q +N  
Sbjct: 403 GSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELRISGSQAKNKR 462

Query: 476 LMQLIA-DSVGVPVVLPK-YTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIMTAMTP 533
           L+ LI+  + G+ +  PK   D   V GA LLA  A++G   I+  +     D      P
Sbjct: 463 LLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQIIDVIRERDTSDDNEKFEP 522

Query: 534 MGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVF 576
           +    L N DSS  R+ + AKY I LDM ++Q+ Y   +D+VF
Sbjct: 523 LPEYQLLN-DSSLLRRLLWAKYRIHLDMAKQQQRYHKLIDEVF 564

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  207 bits (526), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 162/586 (27%), Positives = 275/586 (46%), Gaps = 74/586 (12%)

Query: 8   IGVDVGTGSARA-VMLQHDGAALALEEHPIKRQELRVDFITQS------SSEIWSAVCHC 60
           IG+D+G+ SAR  +   ++ A L + + P+   +   DF  +S      S+EI  A+  C
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQ---DFTKKSWKFWQKSTEIIEALQKC 65

Query: 61  VRGVVTKSGVNPRLVKGIGFDATCSLVAVDAV-TGDAVPVGPNFDDSTQNIILWMDHRAT 119
            +    K  +    VK  G  ATCSL   + V T +A+   PN      N+I WMD  AT
Sbjct: 66  FQ----KLKITEYNVKSCGVSATCSLAIFERVHTSEALIPYPN----ENNVIFWMDSSAT 117

Query: 120 RETDAINAT-GDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMAT 178
            E + +NA    + L Y+GG+   EM +PK+K+        Q  +   FDL  Y+ +   
Sbjct: 118 DECEWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELG 177

Query: 179 AKDRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFL 238
              + +    +  + +   G DG    WS  F + +                  + P  +
Sbjct: 178 RLYQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI-----------------MNIPSNV 220

Query: 239 TAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRL 298
             G PVG ++ +         S  V    ID+YA W        ++S            L
Sbjct: 221 IIG-PVGLVSKKV-------ISTTVVRSCIDSYASWFAVSPPFLERS------------L 260

Query: 299 ALIAGTSTCHIMLSK-GPQFVPGVWGPYRDVLIPG--YWCAEGGQSCTGALLAHILETHP 355
            +IAGTS+C++  +      +PGVWGP+ ++L     +     GQSCTG L+ H+ E+HP
Sbjct: 261 FMIAGTSSCYMYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGKLIEHLFESHP 320

Query: 356 AHEELVRLAAKQQVSHFEYLGLMLDTL--MMKRQVRNVLELSRSFFLYGDFHGNRSPLAD 413
              ++++  A       +   ++  T+  + K++  ++  L++  F YGD+ GNR+P AD
Sbjct: 321 CARKILKSGA-------DIYQVLEQTIHGIEKKKGLSIHILAKDMFFYGDYEGNRTPFAD 373

Query: 414 PSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVEC--VYMSGGQC 471
           P M+ + IG++ D SI +L  +Y++  EF++ QT+ I++T       +    + +SG Q 
Sbjct: 374 PRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQELRISGSQA 433

Query: 472 RNSLLMQLIA-DSVGVPVVLPK-YTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIMT 529
           RN  L+ LI+  + G+ +  P+   D   + GA +LA  A++    ++  +   + D   
Sbjct: 434 RNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRERDVGDDNE 493

Query: 530 AMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
              P+    L N DS+  +  +  KY I LDM ++QK Y   +D+V
Sbjct: 494 KFQPLSEYCLGN-DSTLLKNLLCVKYRIHLDMAKQQKYYYKLVDEV 538

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  204 bits (518), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 169/604 (27%), Positives = 271/604 (44%), Gaps = 102/604 (16%)

Query: 8   IGVDVGTGSAR-AVMLQHDGAALALEEHPI---KRQELRVDFITQSSSEIWSAVCHCVRG 63
           IG+DVG+ SAR  V   ++ A L + + P+   +    +     Q S+EI  A+  C++ 
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVPYYQDSSKKSWKFWQKSTEIIKALQKCLQ- 67

Query: 64  VVTKSGVNPRLVKGIGFDATCSLVAV--DAVTGDAVPVGPNFDDSTQNIILWMDHRATRE 121
              K  +    VK  G  ATCSL     D  +   +P  PN D    N+I WMD  A  E
Sbjct: 68  ---KLNIREYEVKSCGVSATCSLAIFERDRTSNMLIPY-PNED----NVIFWMDSSAVNE 119

Query: 122 TDAINAT-GDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180
              +N     + L Y+GG+   EM +PK+K+        +      FDL  Y+ +  +  
Sbjct: 120 CQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRL 179

Query: 181 DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA 240
              +    + ++ L   G DG    WS  F +          N + L            +
Sbjct: 180 YEWNIEGLLGRENLNGIGNDGEVSGWSSSFYK----------NIINL-----------PS 218

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL 300
              +G  +L A++      S  V    ID+YA W        +            T L +
Sbjct: 219 NVSIGTTSLVANKHI----STTVVRSCIDSYASWFAVASPHLE------------TSLFM 262

Query: 301 IAGTSTCHIM-LSKGPQFVPGVWGPYRDVLIP--GYWCAEGGQSCTGALLAHILETHPAH 357
           IAGTS+C++   +     +PGVWGP+  +L     +     GQSCTG L+ H+ E+HP  
Sbjct: 263 IAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKLIEHLFESHPCA 322

Query: 358 EELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLE---LSRSFFLYGDFHGNRSPLADP 414
            ++++  A         +  +L+  +   +  N L    L++  F YGD+ GNR+P ADP
Sbjct: 323 RKILKDGAD--------IYQVLEQTIRDIEKNNGLSIHILTKDMFFYGDYEGNRTPFADP 374

Query: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVR---NGHVVECVYMSGGQC 471
            ++ + IG+S D S+ +L  +Y+   EF++ QT+ I++T      N H+ E + +SG Q 
Sbjct: 375 RIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKE-LRISGSQA 433

Query: 472 RNSLLMQLIA-DSVGVPVVLPKYT-DCCVVFGAALLACCASKGCDGIEADQSTRLWDIMT 529
           +N  L+ LI+  + GV ++ PK   D   + GA +LA  A          +  +L D++T
Sbjct: 434 KNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAK---------EKKQLADVIT 484

Query: 530 AMTPMGTRVLPNDDSSFE--------------RKYMDAKYGIFLDMIERQKLYRSQMDQV 575
                  R + ND   FE              RK +  KY I LDM ++QK Y   +D+V
Sbjct: 485 E------RDISNDSEKFESLAEYRLGNDSILLRKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

Query: 576 FRSI 579
           F+ +
Sbjct: 539 FQHL 542

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  200 bits (509), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 165/586 (28%), Positives = 266/586 (45%), Gaps = 70/586 (11%)

Query: 8   IGVDVGTGSAR-AVMLQHDGAALALEEHPI---KRQELRVDFITQSSSEIWSAVCHCVRG 63
           IG+D+G+ SAR  +   ++   LA+ + P+        +     Q S+EI  A+ +C + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVPYYHDSSKKSWKFWQKSTEIIKALQNCFQE 68

Query: 64  VVTKSGVNPRLVKGIGFDATCSLVAV--DAVTGDAVPVGPNFDDSTQNIILWMDHRATRE 121
           +     +    V+  G  ATCSL     D   G+ +P  PN D    N+I WMD  A  E
Sbjct: 69  L----KITQYNVRSCGVSATCSLAIFQKDLTNGNLIPY-PNED----NVIFWMDSSAVDE 119

Query: 122 TDAINAT-GDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180
            + +N     + L Y+GG+   EM +PK+K+        Q  +   FDL  Y+ +     
Sbjct: 120 CEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRL 179

Query: 181 DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTA 240
            R +      ++ +   G DG    WS  F   +          ++L       P  +T 
Sbjct: 180 YRWNTDELSARENINGIGNDGEASGWSSSFYNDI----------MKL-------PSNVTI 222

Query: 241 GQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLAL 300
           G  +  L    S       SCI      D+YA W        + S            L +
Sbjct: 223 G--LTGLNSNNSSSTTTVCSCI------DSYASWFAVSSPNLEAS------------LFM 262

Query: 301 IAGTSTCHIMLSK-GPQFVPGVWGPYRDVLIPG--YWCAEGGQSCTGALLAHILETHPAH 357
           IAGTSTC++  S      +PGVWGP+  +L     Y     GQSCTG L+ H+ ++HPA 
Sbjct: 263 IAGTSTCYMYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGKLIEHLFKSHPA- 321

Query: 358 EELVRLAAKQQVSHFEYLGLMLDTL--MMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415
                 A K Q S  +   ++ +++  + K+  +++  L++  F YGD+ GNR+P AD  
Sbjct: 322 ------ARKIQRSGEDIYEVLENSIQDIEKKNRKSIHILAKHMFFYGDYEGNRTPFADSQ 375

Query: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETM--VRNGHVVECVYMSGGQCRN 473
           MR + IG+S D SI +L  +Y++  EF++ QT+ I++T     +G  +E + +SG Q +N
Sbjct: 376 MRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEELRVSGSQAKN 435

Query: 474 SLLMQLIA-DSVGVPVVLPKYT-DCCVVFGAALLACCASKGCDGIEADQSTRLWDIMTAM 531
             L+ LI+  + G+ +  P    D   V GA +L   A++    I+  +           
Sbjct: 436 GRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIIDIIRERDANADSEEF 495

Query: 532 TPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFR 577
            P GT  L N D    ++ +  KY I LDM ++Q+ Y   +D+   
Sbjct: 496 EPFGTYQLGN-DCILLKRLLSVKYRIHLDMAKQQQQYHRLVDEALN 540

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  183 bits (464), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 178/590 (30%), Positives = 269/590 (45%), Gaps = 78/590 (13%)

Query: 8   IGVDVGTGSARAVM--LQHDGAALALEEHPIKRQEL-RVDFITQSSSEIWSAVCHCVRGV 64
           +GVD+G+ S R  +  L++D + L + E P++          TQS+ EI +A+  C+  +
Sbjct: 13  VGVDLGSSSVRVGIYSLEND-SLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQECLDEL 71

Query: 65  VTKSGVNPRLVKGIGFDATCSLV--AVDAVTGDAVPVGPNFDD--STQNIILWMDHRATR 120
             + G   R +   G  ATCS+    V+A  G   P+  +  D  S +N++ WMD  A+ 
Sbjct: 72  GLRPG--GRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVASE 129

Query: 121 ETDAINATGDRCLKY-VGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATA 179
             DA++      +K  + G    EM +PK+  L G  P       + FDL  Y+ +    
Sbjct: 130 ACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPGRSL---EVFDLHKYIAYDLAR 186

Query: 180 K---DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPK 236
           +   D  +  +     G+   G DG  G W  EF            N ++L  T    P 
Sbjct: 187 RYGWDMAALANRPNSNGI---GHDGEVGGWPQEFYR----------NVLKLPATVAVGPA 233

Query: 237 FLTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAIT 296
               GQ VG              SCI      D YA W G    + +QS           
Sbjct: 234 STFKGQRVG------------VASCI------DCYASWFGVCSTQPEQS----------- 264

Query: 297 RLALIAGTSTCHIMLSKGPQFV-PGVWGPYRDVLI--PGYWCA-EGGQSCTGALLAHILE 352
            L L+AGTSTC++  S   + V PG+WGP+ ++L      W   E GQS TG LL H+ E
Sbjct: 265 -LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGRLLEHLFE 323

Query: 353 THPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLA 412
           THPA     R  A      F+ L   +  +       ++  L+R  FLYG+  GNR+P A
Sbjct: 324 THPA----ARDYAGDTGRLFKDLEDRIADMEADSGC-SIHHLARHMFLYGELQGNRTPYA 378

Query: 413 DPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVEC--VYMSGGQ 470
           DP M    +G++ D S  +LA++Y+   EF+A QTRQIVE   R G       + ++G Q
Sbjct: 379 DPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGF-RTGAAAAIGELRVAGSQ 437

Query: 471 CRNSLLMQLIADSVG-VPVVLP-KYTDCCVVFGAALLACCASKGCDGIEADQSTRLWDIM 528
            RN  L+ L++   G +PV +P +      V GA LL    ++  D    D   +    +
Sbjct: 438 ARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLG--KARYLDVSLLDVVRKPGATI 495

Query: 529 TAMTPMGTRVLPNDDSSFE--RKYMDAKYGIFLDMIERQKLYRSQMDQVF 576
             +    +   P   ++ E  R+ ++AKY I LDM + Q+ YRS++D V 
Sbjct: 496 PTVEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEIDAVI 545

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  180 bits (457), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 159/583 (27%), Positives = 259/583 (44%), Gaps = 75/583 (12%)

Query: 8   IGVDVGTGSARAVM--LQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           +G+D+G+ + R  +  L+ D   + +   P+       + +TQSS++I SA+  C++ + 
Sbjct: 11  LGIDLGSTAVRVGIYDLKTD-KLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCIQDL- 68

Query: 66  TKSGVNPRL--VKGIGFDATCSLVAVDAVTGDAVPVGPN--FDDSTQNIILWMDHRATRE 121
                NP L  V   G  ATCSL        D  P+  +    +   N++ WMD  AT E
Sbjct: 69  -----NPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLE 123

Query: 122 TDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKD 181
            + +N T  R  +++GG    EM +PK+  +    P  +  K + FDL  Y+ +    K 
Sbjct: 124 CEIVNKTAGRLKEFMGGSFVPEMGIPKLASI-FKKPEAEGHKLEVFDLHSYIAYELAIKY 182

Query: 182 RRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAG 241
                  + K      G DG    W   F   V    L     V++G             
Sbjct: 183 GWDTSRIINKPNENRIGHDGELKGWDAGFYNDV----LKLPANVKIG------------- 225

Query: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALI 301
            P+  L  E         S +  +  ID Y+ W     +  + S            L + 
Sbjct: 226 -PIHALNTE---------SPVRVASCIDCYSNWFSMCSSSPNNS------------LFMA 263

Query: 302 AGTSTCHIML-SKGPQFVPGVWGPYRDVL----IPGYWCAEGGQSCTGALLAHILETHPA 356
           AGTSTC++   ++    +PGVWGP+ ++L       +   E GQS TG L+ H+ ETHPA
Sbjct: 264 AGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIEHLFETHPA 323

Query: 357 HEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPSM 416
                R  +  +   F  +   ++ L       +V   S+  F YG+  GNR+P  D SM
Sbjct: 324 ----ARAYSMDKSKLFSAIESAIEKLEQDFG-ESVHFRSKHMFTYGELQGNRTPYCDSSM 378

Query: 417 RATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNSLL 476
               IG++ D S + L ++Y+   EF+A Q + I E        ++ + ++G Q +N+ L
Sbjct: 379 SGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKAE---IKDIRIAGSQAKNTRL 435

Query: 477 M---QLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIE-ADQSTRLWDIMTAMT 532
           +    L+ D + V +   + TD   V GA LL   A K  + I+  D+  RL   +  + 
Sbjct: 436 LTLFSLVNDQITVKIPAQR-TDYMGVEGAYLLGKAAHKNINIIDLIDKRDRLQSHILELG 494

Query: 533 PMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575
           PM    L N ++   ++ ++AKY I+LDM + Q  YR+ +D V
Sbjct: 495 PMK---LGNHNTKL-KQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  180 bits (457), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 159/605 (26%), Positives = 261/605 (43%), Gaps = 98/605 (16%)

Query: 1   MGEAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDF--------ITQSSSE 52
           M +AG  IG+D+G+ S R  +   +   +        +Q++   +         TQS+ E
Sbjct: 1   MKDAG--IGIDLGSSSVRVGLFTLEDDLMV----QCVKQKISYYYHGDSALWEYTQSTDE 54

Query: 53  IWSAVCHCVRGVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIIL 112
           I   +  C+  +     ++   +K  G  ATCS+           P         QN+I 
Sbjct: 55  IMKVIERCLHDL----KIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIF 110

Query: 113 WMDHRATRETDAINATGDRCLK-YVGGQMSVEMELPKIKWLKGHMPRG---QFTKCKFFD 168
           WMD+ +  E   +N   ++ L+ ++GG+   EM +PKI  L  ++      Q       D
Sbjct: 111 WMDNSSKTECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMD 170

Query: 169 LPDYLTFMATAKDRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLG 228
           L  YL +    + + +F   +        G DG    WS +F         IDT  +   
Sbjct: 171 LHRYLAYEIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY--------IDTLKI--- 219

Query: 229 GTSESKPKFLTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKS 288
                 P  +T G P   L  +     G+  SCI      D Y+ W+       ++S   
Sbjct: 220 ------PSNITIG-PEPPLEDDFEYCKGIVASCI------DCYSSWLSLCSPTPEES--- 263

Query: 289 SGLDVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPG--YWCAEGGQSCTGAL 346
                    L ++ GTSTC++  +   + +PGVWGP+ D+L     Y   EGGQSCTG L
Sbjct: 264 ---------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTGKL 314

Query: 347 LAHILETHPAHEELVR-------LAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFF 399
           + H+L+THPA   + +          +Q++S  E           ++  R++   ++  F
Sbjct: 315 IEHLLQTHPASSSIAKDDWPLLLEKIEQEISAIE-----------EQTGRSIHFKTKHMF 363

Query: 400 LYGDFHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVR--- 456
            YGDF GNR+P ADP M    IG++ DVS  +L + Y+   EF+A Q + ++    +   
Sbjct: 364 FYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQG 423

Query: 457 NGHVVECVYMSGGQCRNSLLMQLIA-DSVGVPVVLPKYTDCCV--VFGAALL---ACCAS 510
              + E + + G Q +N  L+ LI+    G  + LPK TD  +  V GA LL   A    
Sbjct: 424 QDKITE-IRICGSQAKNKRLLSLISLLHEGGTIKLPK-TDVELSGVSGAFLLGKSALLNK 481

Query: 511 KGCDGIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRS 570
              D I+     +  DI    + +   +            ++AKY I LDM ++Q +YR 
Sbjct: 482 SPLDLIQEKDDQKQVDIFETPSSINQPL---------SMLLEAKYEIHLDMAKQQLIYRE 532

Query: 571 QMDQV 575
            ++++
Sbjct: 533 MINKI 537

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  172 bits (437), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 157/589 (26%), Positives = 251/589 (42%), Gaps = 89/589 (15%)

Query: 8   IGVDVGTGSAR--AVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGVV 65
           +G+D+G+   R  A  L+ D   +A+    +   E      TQSS+EI  A+  C   + 
Sbjct: 8   LGIDLGSTGVRVGAYNLETD-EPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVECFESL- 65

Query: 66  TKSGVNPRLVKGIGFDATCSL-VAVDAVTGDAVPVGPNFDD----STQNIILWMDHRATR 120
               ++   V+  G  ATCSL V +   T    P G  ++D    + QN++ WMD  A  
Sbjct: 66  ---NIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGV-YEDLRPLNDQNVVFWMDSNAIE 121

Query: 121 ETDAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAK 180
           E   IN        Y GG    EM +PK+        +   +  + FDL  Y+ +    +
Sbjct: 122 ECSNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN-SDFEVFDLHTYVAYDLANR 180

Query: 181 ---DRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKF 237
              D     +     G+   G DG    W  EF E                     K   
Sbjct: 181 YGWDASFLINRPNHNGI---GHDGEIKGWKDEFYE---------------------KTLK 216

Query: 238 LTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITR 297
           L     +G L +  + +F    S +  +  ID Y+ W     +  ++S            
Sbjct: 217 LPPNVRIGPLCI--NRRF----SPVKVASCIDCYSSWFSMFSSTPERS------------ 258

Query: 298 LALIAGTSTCHIMLSKGP-QFVPGVWGPYRDVL----IPGYWCAEGGQSCTGALLAHILE 352
           L + AGTSTC++  +  P + +PG+WGP+ D+L     P +   E GQS TG L+ H+ E
Sbjct: 259 LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTGKLIEHLFE 318

Query: 353 THPAHEELVRLAAKQQVSHFEYLGLMLDT---LMMKRQVRNVLELSRSFFLYGDFHGNRS 409
           +HP        AAK  +     L   L+T   L+ ++   +V   ++  F YG+  GNR+
Sbjct: 319 SHP--------AAKPYLEDRNVLFNRLETEINLIEQQSAESVHFKTKHMFNYGELQGNRT 370

Query: 410 PLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGG 469
           P  DP M    IG+S D S   L ++Y+   EF+A Q R I E +   G  +  + ++G 
Sbjct: 371 PYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDIRVAGS 427

Query: 470 QCRNSLLMQLIA-----DSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTRL 524
           Q +N+ L+ LI+       V +P     Y     V GA LL      G + +E       
Sbjct: 428 QAKNNRLLSLISFVNHGSRVRIPATRADYVG---VQGAYLLGKAKHLGLNVVELITQENG 484

Query: 525 WDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMD 573
            +  + M  +  R+  N+++   R   + KY I+L+M + Q+ YR  ++
Sbjct: 485 GE--SPMKDIEVRIEKNEENKL-RALFEIKYKIYLNMAQTQRQYREMVN 530

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  169 bits (428), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 162/594 (27%), Positives = 264/594 (44%), Gaps = 92/594 (15%)

Query: 8   IGVDVGTGSAR-AVMLQHDGAALALEEHPI----KRQELRVDFITQSSSEIWSAVCHCVR 62
           IG+D+G+ S R  +   HD + L +   P+    +     +   TQ S+EI +A+  C  
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWEYTQDSAEILTAIKECF- 66

Query: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122
                + +    VK  G  ATCSLV  +    D      + +  ++N++ WMD  A  ET
Sbjct: 67  ---DMADLQKYDVKSCGVAATCSLVLCERSGDDTFQ---HCEGDSRNVVFWMDSMAKEET 120

Query: 123 DAINATGDRC----LKYVGGQMSVEMELPKI-KWLKG--HMPRGQFTKCKFFDLPDYLTF 175
           +++NA   RC    L ++GG    EM +PK+ ++LK     P+G   + + FDL  Y+ +
Sbjct: 121 NSLNA---RCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNI-QWEVFDLHKYVAY 176

Query: 176 MATAKDRRSFCSAVCKQGLLPP----GVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTS 231
               K  + +C    +    P     G DG    WS  F + +          V+L    
Sbjct: 177 ----KLAQEYCWNTERLSNHPNSNGIGHDGELAGWSKSFYDKI----------VRL---- 218

Query: 232 ESKPKFLTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGL 291
              P  +T G P    T+E  +   +  SCI      D Y+ W   + +           
Sbjct: 219 ---PPNVTIGCPK---TIENEDSLVIVDSCI------DCYSSWFSPLQS----------- 255

Query: 292 DVAITRLALIAGTSTCHIM---LSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLA 348
            +    L L+AGTSTC+I      K    V G+WGP+ D+L       E G SC+G L+ 
Sbjct: 256 -LNKNTLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVYESGSSCSGKLIE 314

Query: 349 HILETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNR 408
           H+  +HP+   L  L+  Q +S  E    + +T    +   ++   + + FLYGD  GNR
Sbjct: 315 HLFTSHPSAISL-NLSTGQLISKLEEEINIWET----QNATSIHFEACNNFLYGDLDGNR 369

Query: 409 SPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSG 468
           +P  DP MR   IG+S D S   L V+Y+   E +A QT+ +V+   +   + E +++ G
Sbjct: 370 TPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNFEKLNSINE-LFICG 428

Query: 469 GQCRNSLLMQLIA--DSVGVPVVLPKYTDCCVVFGAALLACCASKGCDGIEADQSTRLWD 526
            Q +N+ L++LI+  +   + +V  +  D   V GA LL      G        S  L  
Sbjct: 429 SQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYLG-------TSVDLVP 481

Query: 527 IMTAMTPMGTRVLPNDDSSFER----KYMDAKYGIFLDMIERQKLYRSQMDQVF 576
           +      +  +   ND    ++    K +  KY I L+M E+Q+ +R  + +  
Sbjct: 482 VSEPREYISVK-YTNDSDKIQQTKLYKLLLTKYIIHLEMAEQQQRFRKMVSKAL 534

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  161 bits (407), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 148/589 (25%), Positives = 253/589 (42%), Gaps = 77/589 (13%)

Query: 8   IGVDVGTGSARAVML--QHDGA-ALALEEHPIKRQELRVDF-ITQSSSEIWSAVCHCVRG 63
           IG+D+G+ S R  +   Q+D   A  ++  P        ++  TQSS EI +A+  C + 
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQCFQE 69

Query: 64  VVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETD 123
           +     ++   +K  G  ATCSL      T D   +  N DD  +N++ WMD  A +ET 
Sbjct: 70  L----NIDKHEIKSCGVGATCSLAIFQ--TKDNALIPWNLDDPDKNVVFWMDSIAIKETQ 123

Query: 124 AINATGDRCLK-YVGGQMSVEMELPKIKW----LKGHMPRGQFTKCKFFDLPDYLTFMAT 178
            +N      ++ ++GG    EM +PK++     LK       F   +  DL  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTF---EIIDLHRYIAMSLA 180

Query: 179 AKDRRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFL 238
            ++   + +      L   G DG    WS  F E V     +  N V +G T  S+    
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV---LQLPPNIV-IGPTKHSQ---- 232

Query: 239 TAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRL 298
                       +S+Q    +SCI      D Y+ W   + +    S            L
Sbjct: 233 -----------HSSKQGLKVSSCI------DCYSNWFALLPSNLQNS------------L 263

Query: 299 ALIAGTSTCHIMLS-KGPQFVPGVWGPYRDVLIPG--YWCAEGGQSCTGALLAHILETHP 355
            ++ GTSTC++  S +    +PGVWGP+ ++      +   E GQSCTG L+ H+ +THP
Sbjct: 264 FIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTGKLIEHLFKTHP 323

Query: 356 AHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADPS 415
           A      +  +     F  +   ++ +    Q  ++   ++  F YGD  GNR+P ADPS
Sbjct: 324 ASS---HIDTRDWPHLFSQINDFIEKVEQNTQ-DSIHMQTKHMFFYGDLDGNRTPYADPS 379

Query: 416 MRATVIGQSMDVSIESLAVEYLAACEFIALQTRQI--VETMVRNGHVVECVYMSGGQCRN 473
           M    IG++ D S  +L  +Y++  EFIA Q + +  +   +     +  +   G   +N
Sbjct: 380 MSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDISNLQFCGSLAKN 439

Query: 474 SLLMQLIADSVGVPVVLPKYTDCCVV--FGAALLACCASKGCDGIEADQSTRLWDIMTAM 531
             L+ L+A       +     D  ++  +G+ L+   ++       +D+S     +  A 
Sbjct: 440 KRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKAST-------SDKSI----VEVAH 488

Query: 532 TPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQVFRSIT 580
               +   P        + ++ KY I+ +M E+Q+ YR Q++ V  + T
Sbjct: 489 NQTYSYRPPEKTDGLLVELLEVKYQIYFNMAEQQRKYRKQVNNVIENRT 537

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  120 bits (300), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 121/489 (24%), Positives = 206/489 (42%), Gaps = 75/489 (15%)

Query: 8   IGVDVGTGSARAVMLQHDGAALALEEH---PIKRQELRVDFITQSSSEIWSAVCHCVRGV 64
           IGVD+G+   R  +  +   +L  E     P  R    +  ITQ +S+I +AV      +
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHGNGI--ITQCTSDILTAVEKAFNTL 63

Query: 65  VTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDS--TQNIILWMDHRATRET 122
                +    +  +G  ATCS+V       + +P     D +    +II WM   A  ET
Sbjct: 64  Y----IQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 123 DAINA-TGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKD 181
           + +N  T +  L + GG+   EM +PK+  L         T     DL  +L +  + K 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKDDGLT---VLDLHIWLLWKISLKL 176

Query: 182 RRSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAG 241
                  V +      G DG    WS EF E + L+++   N                  
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKIFIGN------------------ 218

Query: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQSHKSSGLDVAITRLALI 301
                  ++ +EQFG   SCI      D YA W         Q   ++ L+     L ++
Sbjct: 219 ----NAVIKKNEQFG--DSCI------DCYASWF--------QCWSTAMLN---RTLFVV 255

Query: 302 AGTSTCHIMLSK-GPQFVPGVWGPYRDVLI--------PGYWCAEGGQSCTGALLAHILE 352
           AGTSTC +  S     F+PG+WGP++D+L+          Y   E G S TG LL  +L 
Sbjct: 256 AGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISRTGVLLEKLLS 315

Query: 353 THPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLA 412
           THPA            V+  E +   +D L+ +   +++  + ++ F + D+    S   
Sbjct: 316 THPA-------VKDSDVNFLETVEHKID-LIEQSDTQSIHLMIKNTFFHEDYEEFESSFV 367

Query: 413 DPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHV-VECVYMSGGQC 471
                 +++ +  + +++ LA++Y+   E +A Q   ++      GH+ +  + ++G Q 
Sbjct: 368 QKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAF-EEGHITISKLLITGSQA 426

Query: 472 RNSLLMQLI 480
           +NS L+Q++
Sbjct: 427 KNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 63.2 bits (152), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 109/517 (21%), Positives = 197/517 (38%), Gaps = 102/517 (19%)

Query: 8   IGVDVGTGSARAVMLQH-DGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHC------ 60
           IG+DVG+ S R  +  + DG  +      I ++ L   +  +  S++W    +       
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTIK----TIVKEML---YKHEPDSKLWHYTQNAFVMRDS 57

Query: 61  VRGVVTKSGVNPRLVKGIGFDATCSLVAV--DAVTGDAVPVGPNFDDS--TQNIILWMDH 116
           +   + +  VN  +VK  G  ATCS+V +  D+      P+    +++  T +II W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 117 RATRETDAIN-----------ATGDRCLKYVGGQMSV--EMELPKIKWLKGHMPRGQFTK 163
            A  E   +N              ++ L  +G +     EM +PK+  L   +  G +  
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 164 CKFFDLPDYLTFMATAKDRRSFCSAV---CKQGLLPPGVDGSEGHWSPEFLEAVGLSELI 220
               ++ D   ++A    ++   + V    K  +   G+DG    W              
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGW-------------- 223

Query: 221 DTNFVQLGGTSESKPKFLTAGQPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGA 280
           D +F        S P  +   + + +            TS +     ID YA W  +   
Sbjct: 224 DLSFYVWALPETSFPICIGPSKVINE------------TSIVRPKSCIDCYASWFSTDAC 271

Query: 281 KFDQSHKSSGLDVAITRLALIAGTSTCHI---------MLSKGPQFVPGVWGPYRDVLIP 331
             D +            L + AGTSTC +            +  Q +   WGP+ +VL  
Sbjct: 272 TKDDT------------LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWGPFTNVLDK 319

Query: 332 GYWCA-EGGQSCTGALLAHILETHPAHEELVRLAAKQQVSHFEYLGLMLDTL-MMKRQVR 389
               + E G S TG LL  +   H       ++ A   V+  E +  + + + + +R+  
Sbjct: 320 DKKSSFEIGFSETGILLEKLFNKH-------QITASWSVA--ESINYVENQIAIYERKKS 370

Query: 390 NVLELSRSFFLYGDFHGNRSPLADPSMRAT-----VIGQS-MDVSIESLAVEYLAACEFI 443
           + + L    +L+  +      L  PS R T     + G   +  S   L  +Y+A  E++
Sbjct: 371 HSIYLEPEIYLFLKY----LTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAILEYL 426

Query: 444 ALQTRQIVETMVRNGHVVECVYMSGGQCRNSLLMQLI 480
           A Q   ++    +   ++  + +SG Q +N  L+ LI
Sbjct: 427 AYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 58/119 (48%), Gaps = 11/119 (9%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETM----VRNGH 459
           F+G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M    + +G+
Sbjct: 616 FNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGDKIEDGY 672

Query: 460 ---VVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKYTDC-CVVFGAALLACCASKGCD 514
               V  + + GG  ++  +MQ+ AD +G  + L +     C   GAA+ A  A K  +
Sbjct: 673 EKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRRSPIVECTALGAAIAANMAYKNVE 731

>NCAS0C05900 Chr3 (1214812..1216923) [2112 bp, 703 aa] {ON} Anc_4.9
           YHL032C
          Length = 703

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 122/314 (38%), Gaps = 59/314 (18%)

Query: 220 IDTNFVQLGGTSESKPKFLTAGQPVGQLTLEASEQFGLST-----------SCIVASGVI 268
           ID   V L       PK ++  +  GQLT+    +  LST           S +   G I
Sbjct: 347 IDPKLVHL-------PKIVSCSEYYGQLTIPEFTKNLLSTEIWEELNRFKNSRVPIQGCI 399

Query: 269 -DAYAGWIGSVGAKFDQSHKSSGLDVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRD 327
            D  A  +G +  K   +  + G     T   L+  T T  ++   G    P  W P   
Sbjct: 400 GDQSASLVGQLAFKTGSAKCTYG-----TGCFLLYNTGTEKMISEHGALTTPAYWFPNST 454

Query: 328 VLIPGYWCAEGGQSCTGALLAHILETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQ 387
                ++  EG  +  G+++  + +        +RL  K      E++G       +  +
Sbjct: 455 EQPEPHFALEGSIAVGGSVVQWLRDN-------LRLIPKS-----EHIG------PLASR 496

Query: 388 VRNVLELSRSFFLYGDFHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQT 447
           VR+    S        F+G  +P  DP  RAT++G S   +   +A    AA E +  Q 
Sbjct: 497 VRD----SGGVVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQV 549

Query: 448 RQIVETMVRNGHVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKYTDC-C 497
           R I++ M  +    +  Y         + GG  +++ +MQ+ AD +G  + L +     C
Sbjct: 550 RAILKAMGSDEVYGDSAYEKKNLATLAVDGGMSKSNEVMQIQADILGPCIKLRRSPIVEC 609

Query: 498 VVFGAALLACCASK 511
              GAA+ A  A K
Sbjct: 610 TALGAAIAANMAYK 623

>YHL032C Chr8 complement(36379..38508) [2130 bp, 709 aa] {ON}
           GUT1Glycerol kinase, converts glycerol to
           glycerol-3-phosphate; glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p; derepression of
           expression on non-fermentable carbon sources is mediated
           by Opi1p and Rsf1p
          Length = 709

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 25/133 (18%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 459 -------HVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFG 501
                   + +  Y         + GG  R++ +MQ+ AD +G  V + +  T  C   G
Sbjct: 558 KDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG 617

Query: 502 AALLACCASKGCD 514
           AA+ A  A K  +
Sbjct: 618 AAIAANMAFKDVN 630

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 17/125 (13%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRN------ 457
           F G  +P  DP+ RA+++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 472 FSGLFAPYWDPNARASIMGMSQYTTAAHIA---RAAVEGVCFQARAILKAMSSDVLQESG 528

Query: 458 -------GHVVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFGAALLACCA 509
                     +  + + GG  R+  +MQ+ A+ +G  V + +  T  C   GAA+ A   
Sbjct: 529 DFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTSECTALGAAIAANMG 588

Query: 510 SKGCD 514
            K  D
Sbjct: 589 FKNPD 593

>Skud_8.12 Chr8 complement(24374..26506) [2133 bp, 710 aa] {ON}
           YHL032C (REAL)
          Length = 710

 Score = 38.9 bits (89), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 56/130 (43%), Gaps = 25/130 (19%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 459 -------HVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFG 501
                   + +  Y         + GG  R++ +MQ+ AD +G  V + +  T  C   G
Sbjct: 558 KDRDFLEEISDVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG 617

Query: 502 AALLACCASK 511
           AA+ A  A K
Sbjct: 618 AAIAANMAFK 627

>Suva_8.19 Chr8 complement(37989..40187) [2199 bp, 732 aa] {ON}
           YHL032C (REAL)
          Length = 732

 Score = 38.5 bits (88), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 36/130 (27%), Positives = 55/130 (42%), Gaps = 25/130 (19%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I+  M  +      
Sbjct: 524 FSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILRAMSSDAFGEGS 580

Query: 459 -------HVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFG 501
                   + +  Y         + GG  R++ +MQ+ AD +G  V + +  T  C   G
Sbjct: 581 KDRDFLEEISDVTYEKTPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG 640

Query: 502 AALLACCASK 511
           AA+ A  A K
Sbjct: 641 AAIAANMAFK 650

>Smik_8.9 Chr8 complement(20054..22180) [2127 bp, 708 aa] {ON}
           YHL032C (REAL)
          Length = 708

 Score = 38.1 bits (87), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 55/130 (42%), Gaps = 25/130 (19%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 501 FSGLFAPYWDPDARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSSDAFGEGS 557

Query: 459 ----------------HVVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFG 501
                             +  + + GG  R++ +MQ+ AD +G  V + +  T  C   G
Sbjct: 558 KDVDFLEEISGVTYEKSPLSVLAVDGGMSRSNEVMQIQADILGPCVKVRRSPTAECTALG 617

Query: 502 AALLACCASK 511
           AA+ A  A K
Sbjct: 618 AAIAANMAFK 627

>TDEL0G01820 Chr7 (364972..367068) [2097 bp, 698 aa] {ON} Anc_4.9
           YHL032C
          Length = 698

 Score = 38.1 bits (87), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 55/128 (42%), Gaps = 23/128 (17%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 489 FSGLFAPYWDPEARATIMGMSQFTTASHIA---RAAVEGVCFQARAILKAMSSDALGTKD 545

Query: 459 --------------HVVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFGAA 503
                          ++  + + GG  R+  +MQ+ A+ +G  V + +  T  C   GAA
Sbjct: 546 RDFLEEVSAGTYEKSLLSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTHECTALGAA 605

Query: 504 LLACCASK 511
           + A  A K
Sbjct: 606 IAAEMAFK 613

>Kpol_1070.2 s1070 complement(3357..5345) [1989 bp, 662 aa] {ON}
           complement(3357..5345) [1989 nt, 663 aa]
          Length = 662

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 54/129 (41%), Gaps = 24/129 (18%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  D   RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 465 FSGLFAPYWDQDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSSDAFGGDG 521

Query: 459 ------HVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVFGA 502
                  V E  Y         + GG  R+  +MQ+ AD +G  + + +  T  C   GA
Sbjct: 522 DKDFLEEVSEEAYEQSPLSTLAVDGGMSRSDEVMQIQADILGPCIKIRRSPTHECTALGA 581

Query: 503 ALLACCASK 511
           A+ A  A K
Sbjct: 582 AIAANMAFK 590

>CAGL0E03916g Chr5 (371422..373440) [2019 bp, 672 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032c GUT1
           glycerol kinase
          Length = 672

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 72/201 (35%), Gaps = 57/201 (28%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  R T++G S   +   +A    AA E +  Q R I+  M  +      
Sbjct: 467 FSGLFAPYWDPEARGTIMGMSQYTTASHIA---RAAVEAVCFQARAILLAMSNDAMGEAE 523

Query: 459 -----------------HVVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVF 500
                             ++  + + GG  R+  +MQ+ AD +G  V + +  T  C   
Sbjct: 524 KDSTFKTEISEEGSYQKSLLSTLAVDGGMSRSDEVMQIQADILGPCVKVRRSPTAECTAL 583

Query: 501 GAALLACCASKGCDGIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLD 560
           GAA+ A  A       E  Q   LW                      R   DAK  IF +
Sbjct: 584 GAAVAANMA------YERPQDRVLW----------------------RDLQDAKNWIFYE 615

Query: 561 MIERQKLYRSQMDQ---VFRS 578
            + + +    +  Q   +FRS
Sbjct: 616 GMTKSEYQAKETKQNLKIFRS 636

>KLLA0E00595g Chr5 complement(49243..51228) [1986 bp, 661 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 661

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/101 (28%), Positives = 44/101 (43%), Gaps = 22/101 (21%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 462 FSGLFAPYWDPDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSSDAFGSED 518

Query: 459 -----HVVECVY---------MSGGQCRNSLLMQLIADSVG 485
                 VV+  Y         + GG  R+  +MQ+ AD +G
Sbjct: 519 KDFLEEVVDETYEKTLLSTLAVDGGMSRSDEVMQIQADILG 559

>KLTH0E05654g Chr5 complement(499361..501421) [2061 bp, 686 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 686

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 49/196 (25%), Positives = 81/196 (41%), Gaps = 31/196 (15%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  D S RAT++G S   +   LA    AA E +  Q R I++ M  +      
Sbjct: 476 FSGLFAPYWDASARATIMGMSQHTTASHLA---RAAVEGVCFQARAILKAMSSDAAGEGR 532

Query: 459 -------HVVECVY---------MSGGQCRNSLLMQLIADSVG--VPVVLPKYTDCCVVF 500
                   V +  Y         + GG  R+  +MQ+ AD +G  V V     ++C  + 
Sbjct: 533 KDRDFLEEVADGTYEKAPLSMLAVDGGMSRSKEVMQIQADILGPCVKVRTSASSECTALG 592

Query: 501 GAALLACCASKGCDGI--EADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIF 558
            A   A    K  D +  +  +  + W +M   T  G R  P D+ SF  +   +K  I 
Sbjct: 593 AAIAAALAYEKREDRVLWKDLKDVKKW-VMYGGTEPGNRP-PVDEESFRTRIFRSK-SID 649

Query: 559 LDMIERQKLYRSQMDQ 574
            +   + KL+ + +++
Sbjct: 650 TERRRKWKLWEAAIER 665

>ACL069C Chr3 complement(232439..234373) [1935 bp, 644 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL032C
           (GUT1)
          Length = 644

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 43/190 (22%), Positives = 71/190 (37%), Gaps = 55/190 (28%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTR--------------- 448
           F G  +P  D + R T++G S   +   +A    AA E +  Q R               
Sbjct: 443 FSGLFAPYWDAAARGTILGMSQFTTASHIA---RAAIEGVCFQARAILKAMSSDAFGEGA 499

Query: 449 -------QIVETMVRNGHVVECVYMSGGQCRNSLLMQLIADSVGVPVVLPKY-TDCCVVF 500
                  +IV+T       +  + + GG  ++  +MQ+ AD +G  V + +  T      
Sbjct: 500 KDHDFLEEIVDTGTYEHSPLSVLAVDGGMSKSDEVMQIQADILGPCVKVRRSPTAESTAL 559

Query: 501 GAALLACCASKGCDGIEADQSTRLWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLD 560
           GAA+ AC A K       D + R+W                      +   DAK  IF  
Sbjct: 560 GAAIAACMAYK-------DPNERVW----------------------KDLNDAKKWIFYG 590

Query: 561 MIERQKLYRS 570
            +E+++  R+
Sbjct: 591 GLEKEEALRT 600

>KNAG0J02920 Chr10 (561449..563476) [2028 bp, 675 aa] {ON} Anc_4.9
           YHL032C
          Length = 675

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 55/136 (40%), Gaps = 32/136 (23%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRN------ 457
           F G  +P  D S RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 464 FSGLFAPYWDGSARATIMGISQFTTASHIA---RAAVEGVCFQARAILKAMSSDAYDGDI 520

Query: 458 -----------GHVVECVY---------MSGGQCRNSLLMQLIADSVGVPVVLPKYTDC- 496
                      GH   C Y         + GG  R+  +MQ+ AD +G P +  + +   
Sbjct: 521 SDDIDLLESGIGHDHTCAYEKSLLSTLSVDGGMSRSDEVMQIQADILG-PCIKIRRSPVL 579

Query: 497 -CVVFGAALLACCASK 511
                GAA+ A  A K
Sbjct: 580 ESTALGAAIAANMAYK 595

>SAKL0H25938g Chr8 (2281415..2283472) [2058 bp, 685 aa] {ON} similar
           to uniprot|P32190 Saccharomyces cerevisiae YHL032C GUT1
           Glycerol kinase converts glycerol to glycerol-
           3-phosphate glucose repression of expression is mediated
           by Adr1p and Ino2p-Ino4p derepression of expression on
           non- fermentable carbon sources is mediated by Opi1p and
           Rsf1p
          Length = 685

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 42/103 (40%), Gaps = 24/103 (23%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGH---- 459
           F G  +P  DP  RAT++G S   +   +A    AA E +  Q R I++ M  +      
Sbjct: 478 FSGLFAPYWDPDARATIMGMSQYTTASHIA---RAAVEGVCFQARAILKAMSSDAFGEGE 534

Query: 460 -----------------VVECVYMSGGQCRNSLLMQLIADSVG 485
                             +  + + GG  R+  +MQ+ AD +G
Sbjct: 535 KDRDFLEEIEDETYERTALSTLAVDGGMSRSDEVMQIQADILG 577

>ZYRO0G07700g Chr7 complement(609766..611880) [2115 bp, 704 aa] {ON}
           similar to uniprot|P32190 Saccharomyces cerevisiae
           YHL032C GUT1 Glycerol kinase converts glycerol to
           glycerol- 3-phosphate glucose repression of expression
           is mediated by Adr1p and Ino2p-Ino4p derepression of
           expression on non- fermentable carbon sources is
           mediated by Opi1p and Rsf1p
          Length = 704

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 48/125 (38%), Gaps = 25/125 (20%)

Query: 404 FHGNRSPLADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNG----- 458
           F G  +P  D   RAT++G S   +   +A    AA E +  Q R I+  M  +      
Sbjct: 452 FSGLFAPYWDADARATIMGMSQHTTASHIA---RAAVEGVCFQARAILSAMSADALGEGK 508

Query: 459 ----------------HVVECVYMSGGQCRNSLLMQLIADSVG-VPVVLPKYTDCCVVFG 501
                             +  + + GG  ++  +MQ+ AD +G    V    T  C   G
Sbjct: 509 RDKEFLNEMEDDSEEKSALSTLAVDGGMSKSDEVMQIQADILGPCTKVRRSPTSECTALG 568

Query: 502 AALLA 506
           AA+ A
Sbjct: 569 AAIAA 573

>TDEL0D06490 Chr4 complement(1163375..1164838) [1464 bp, 487 aa]
           {ON} Anc_3.581 YGL253W
          Length = 487

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/91 (23%), Positives = 38/91 (41%), Gaps = 4/91 (4%)

Query: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62
           E G Y+ +D+G  + R V++   G     +    K +       TQ+  E+W+ +  C+ 
Sbjct: 78  EKGDYLAIDLGGTNLRVVLISL-GGDRTFDSTQSKYRLPDAMRTTQNHEELWAFIADCLE 136

Query: 63  GVVTK---SGVNPRLVKGIGFDATCSLVAVD 90
             + +    GV   L  G  F   CS   ++
Sbjct: 137 AFIIEQFPDGVKGNLPLGFTFSYPCSQSKIN 167

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,554,092
Number of extensions: 2174647
Number of successful extensions: 4744
Number of sequences better than 10.0: 50
Number of HSP's gapped: 4738
Number of HSP's successfully gapped: 61
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)