Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032508.261ON58558527350.0
SAKL0H17050g8.261ON58454716440.0
YLR088W (GAA1)8.261ON61458216220.0
Kpol_543.378.261ON57857016110.0
TDEL0F038808.261ON57954716060.0
Smik_12.1478.261ON61358015740.0
Skud_12.1568.261ON61257915720.0
NCAS0B038608.261ON58358715590.0
TBLA0F030808.261ON58353815530.0
Suva_10.1728.261ON61458115510.0
CAGL0L12232g8.261ON59155315420.0
KLTH0G13706g8.261ON58453715350.0
AGR087C8.261ON57755215310.0
Ecym_43098.261ON57754915280.0
NDAI0J013908.261ON58357315160.0
KLLA0F19118g8.261ON57854815130.0
Kwal_56.238048.261ON57854814980.0
ZYRO0C01672g8.261ON56958814880.0
KAFR0B055508.261ON55552614750.0
TPHA0A018208.261ON58159313750.0
Kwal_26.71547.86ON121344733.4
TBLA0A078003.45ON41341698.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03250
         (585 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {O...  1058   0.0  
SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]...   637   0.0  
YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subun...   629   0.0  
Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON} (82589..8...   625   0.0  
TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.2...   623   0.0  
Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088...   610   0.0  
Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088...   610   0.0  
NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {O...   605   0.0  
TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {O...   602   0.0  
Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088...   602   0.0  
CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON} sim...   598   0.0  
KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]...   595   0.0  
AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON} S...   594   0.0  
Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}...   593   0.0  
NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {...   588   0.0  
KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} simi...   587   0.0  
Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {...   581   0.0  
ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {...   577   0.0  
KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa] ...   572   0.0  
TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {O...   534   0.0  
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    33   3.4  
TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa] ...    31   8.6  

>KNAG0H03250 Chr8 complement(605885..607642) [1758 bp, 585 aa] {ON}
           Anc_8.261 YLR088W
          Length = 585

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/585 (89%), Positives = 523/585 (89%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           MGLFETLQRK                           MILIIPMNGQYRNTYISENALMP
Sbjct: 1   MGLFETLQRKAVKLGLLPKLLAALPLLSALTAVVSVVMILIIPMNGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD
Sbjct: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
           TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS
Sbjct: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV
Sbjct: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW
Sbjct: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300

Query: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360
           RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL
Sbjct: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360

Query: 361 PSAVLLSITFAIAAVDATVNNAYASALHITYTXXXXXXXXXXXXXXXXXXHWFLYSTTSP 420
           PSAVLLSITFAIAAVDATVNNAYASALHITYT                  HWFLYSTTSP
Sbjct: 361 PSAVLLSITFAIAAVDATVNNAYASALHITYTLLAALASVISLLVSFLVAHWFLYSTTSP 420

Query: 421 LYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPLAFSIGL 480
           LYLILGSVVLAVSPLVMSRSNNALREPVCYRMR                 NFPLAFSIGL
Sbjct: 421 LYLILGSVVLAVSPLVMSRSNNALREPVCYRMRTLGYIYYSLILTSLLMLNFPLAFSIGL 480

Query: 481 FGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALF 540
           FGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALF
Sbjct: 481 FGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALF 540

Query: 541 SAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585
           SAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN
Sbjct: 541 SAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585

>SAKL0H17050g Chr8 complement(1497051..1498805) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/547 (57%), Positives = 396/547 (72%), Gaps = 12/547 (2%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           + L IP +GQ+R TYISENALMPSQAYSYFRETEWN+LRGYRT+IE+   +  S  +R +
Sbjct: 39  LALFIPTDGQFRRTYISENALMPSQAYSYFRETEWNVLRGYRTQIELF--KKSSTHERNE 96

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
            V+ WL +FGAKTA+Y NEE G+TLYG+LHAPRGDGTEAMVL APW NSE ++N GG AL
Sbjct: 97  EVSSWLQQFGAKTAIYTNEEYGETLYGILHAPRGDGTEAMVLAAPWYNSENQYNTGGIAL 156

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
           A++LSR+FSRWPVWSKNII+V S++P  ALRSWVEAYHTSLDLTGGSIEAAV++D+P +N
Sbjct: 157 AVSLSRFFSRWPVWSKNIIIVLSEDPQAALRSWVEAYHTSLDLTGGSIEAAVVMDFPGSN 216

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           D+F Y EIHF+GLNGELPNLDLVNVAVHIT+HEGMKVSLHG+   EL KN+++SR+K + 
Sbjct: 217 DFFKYVEIHFDGLNGELPNLDLVNVAVHITEHEGMKVSLHGISEEELGKNDFFSRMKTII 276

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLE 336
           LG+K+  L+G+KK+HGNEVFSGWRI +VTLKA G +G  DITTFGRIPEA+FRS+NNLLE
Sbjct: 277 LGVKNMALSGIKKSHGNEVFSGWRIHSVTLKACGTDGPFDITTFGRIPEAIFRSVNNLLE 336

Query: 337 KFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXX 395
           KFHQSFFFY LL+P  FVSI SYLP+AV LS++FA+A+++  +NN Y S  L  TY    
Sbjct: 337 KFHQSFFFYLLLAPRLFVSIGSYLPAAVALSVSFALASLNTILNNEYTSLPLLSTYNVFA 396

Query: 396 XXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXX 455
                            FLY+   P  L+  +V+L + P++ +R    +R P  YR++  
Sbjct: 397 LLGFAVALFVSFITAQAFLYA-PQPELLLSLNVLLLLMPIIFTRVK--IRTPFSYRLKSF 453

Query: 456 XXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPF 515
                          NF LAF +G   +PMTLV+     +   +  +L+N VLL+ISNPF
Sbjct: 454 AYLYFSVVLTSLLVVNFSLAFGLGCLAFPMTLVRT----TSGNLRARLKNCVLLLISNPF 509

Query: 516 VATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPA 575
           +A WL    V+  E   + VF  L SAWKDL CWTWFV+C+GWLP+WLLV +S   S+  
Sbjct: 510 IAIWLFAICVDR-ELQGVQVFYGLTSAWKDLGCWTWFVICIGWLPSWLLVAYSGIDSVSI 568

Query: 576 AETTIEK 582
                EK
Sbjct: 569 VVPQDEK 575

>YLR088W Chr12 (316107..317951) [1845 bp, 614 aa] {ON}  GAA1Subunit
           of the GPI (glycosylphosphatidylinositol):protein
           transamidase complex, removes the GPI-anchoring signal
           and attaches GPI to proteins in the ER
          Length = 614

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/582 (55%), Positives = 399/582 (68%), Gaps = 42/582 (7%)

Query: 39  ILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEI-EVLNSRGVSASDRYD 97
           I I+PM+GQYR TYISENALMPSQAYSYFRE+EWNILRGYR++I E++N   +++ +R +
Sbjct: 39  IAILPMDGQYRRTYISENALMPSQAYSYFRESEWNILRGYRSQIKEMVN---MTSMERNN 95

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
           ++  WL EFG KTA+Y NE+ G+TLYGV+HAPRGDGTEAMVL  PW NS+ EFNIGG+AL
Sbjct: 96  LMGSWLQEFGTKTAIYENEQYGETLYGVMHAPRGDGTEAMVLAVPWFNSDDEFNIGGAAL 155

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
            ++L+R+FSRWPVWSKNIIVVFS+NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  
Sbjct: 156 GVSLARFFSRWPVWSKNIIVVFSENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSTE 215

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           D+F Y EI ++GLNGELPNLDLVN+A+ IT+HEGMKVSLHGLP  +L  NN+WSRLK+L 
Sbjct: 216 DFFEYVEISYDGLNGELPNLDLVNIAISITEHEGMKVSLHGLPSDQLTNNNFWSRLKILC 275

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEK 337
           LG++D  L+G+KK HGNE FSGWRIQ+VTLKA G    DITTFGRIPEAMFRSINNLLEK
Sbjct: 276 LGIRDWALSGVKKPHGNEAFSGWRIQSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEK 335

Query: 338 FHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXX 396
           FHQSFFFY LL+P  FVSISSYLPSAV LSI FAI++++A +NNAYA+ +L   Y     
Sbjct: 336 FHQSFFFYLLLAPRQFVSISSYLPSAVALSIAFAISSLNAFINNAYANISLFSEYNLVAL 395

Query: 397 XXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXX 456
                           FL   +S L + + S+     PL++SR  + + EP+ YR++   
Sbjct: 396 LVWFVSLVISFVVSQAFLLIPSSGLLMTI-SMASCFLPLILSRKIH-ISEPLSYRLKNVA 453

Query: 457 XXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVK-----------------PLNIYSKSQM 499
                         NF +A  IG   +PMT VK                 P+    K ++
Sbjct: 454 FLYFSLVSTSLLMINFAMALLIGTLAFPMTFVKTIVESSSEHEVTTQSSNPIKTEPKDEI 513

Query: 500 SL-----------------KLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALFSA 542
            L                 KL+N VLL+++NPF++  L     ++ EF   D+   L SA
Sbjct: 514 ELVENHMDTTPATPQQQKQKLKNLVLLILTNPFISITLFGLFFDD-EFHGFDIINKLVSA 572

Query: 543 WKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584
           W DL CW+WFVLC+GWLP WLL+  SSF S      + EK+S
Sbjct: 573 WLDLKCWSWFVLCIGWLPCWLLILASSFESKSVVVRSKEKQS 614

>Kpol_543.37 s543 (82589..84325) [1737 bp, 578 aa] {ON}
           (82589..84325) [1737 nt, 579 aa]
          Length = 578

 Score =  625 bits (1611), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/570 (54%), Positives = 392/570 (68%), Gaps = 7/570 (1%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           M + E LQR+                           ++L +PM+GQ+R TYISENALMP
Sbjct: 1   MSILENLQRRLIDAGLLPKFLAALPKLSMLLVSVSVMLMLYLPMDGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRETEWNILRGYR EIEVL+S   S+ +R  I++ WL EFG KT+VY+N+E GD
Sbjct: 61  SQAYSYFRETEWNILRGYRKEIEVLSSH--SSIERNAIMSSWLEEFGLKTSVYKNQEYGD 118

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
           +LYGV +APRGDGTE+MVL  PW N+E EFN+ G+AL ++L+R+ SRWPVWSKNIIVVFS
Sbjct: 119 SLYGVFNAPRGDGTESMVLAVPWYNAEDEFNVSGAALGVSLARFLSRWPVWSKNIIVVFS 178

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           +NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDYP  +DYF Y E+H+ G NG LPNLDLV
Sbjct: 179 ENPREALRSWVEAYHTSLDLTGGSIEAAVVLDYPGVSDYFEYIEVHYNGYNGVLPNLDLV 238

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           N+A+ I +HEG+KVSLHGL   E+   +YWSRLK++ LG K+  L G+++ +GNE FSGW
Sbjct: 239 NIAISIAEHEGLKVSLHGLTPDEMGNGDYWSRLKMISLGTKNLALTGVREVYGNEAFSGW 298

Query: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360
           RIQA+TLKARG+   D+TTFGR+ EAMFRSINNLLEKFHQSFFFYFLL+P  FVSI SYL
Sbjct: 299 RIQALTLKARGDTNHDVTTFGRVAEAMFRSINNLLEKFHQSFFFYFLLAPRYFVSIGSYL 358

Query: 361 PSAVLLSITFAIAAVDATVNNAYASALHITYTXXXXXXXXXXXXXXXXXXHWFLYSTTSP 420
           P+AV+LSI+FA+A++D+ VNN Y S +  +Y                            P
Sbjct: 359 PAAVVLSISFAVASIDSFVNNQYVSMVDSSYYNLLSFIFWAVSVIVCFFLGNSFTYYPQP 418

Query: 421 LYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPLAFSIGL 480
           L L+LG+VV++  PL   + N ++ EP+ YR++                 NFPLAF +GL
Sbjct: 419 LLLLLGNVVISTIPLAAPK-NLSISEPLAYRLKTISFMYLSLVMTSLLVVNFPLAFGMGL 477

Query: 481 FGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALF 540
           F YPMTLV    + +   + LK RNS+LL ISNPF+A WL  T+VE S+   ++    L 
Sbjct: 478 FAYPMTLVM---LNNTDNLRLKTRNSILLAISNPFIAFWLFITIVE-SKLDGIEAIYGLV 533

Query: 541 SAWKDLNCWTWFVLCLGWLPTWLLVTFSSF 570
            AW  L  WTWF+ C+GW P+W+LV  S+ 
Sbjct: 534 DAWNKLGSWTWFIFCIGWFPSWILVAISAL 563

>TDEL0F03880 Chr6 (722770..724509) [1740 bp, 579 aa] {ON} Anc_8.261
           YLR088W
          Length = 579

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/547 (55%), Positives = 398/547 (72%), Gaps = 14/547 (2%)

Query: 41  IIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVA 100
           ++P+ G+YR TYISENAL+PSQAYSYFRETEWN LRGYRT+IE L +   ++ +R + VA
Sbjct: 41  LLPLEGRYRRTYISENALLPSQAYSYFRETEWNTLRGYRTQIERLANS--TSRERNEEVA 98

Query: 101 GWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIA 160
           GWL EFG KTA+Y++E+ GDTLYGVLHA RGDGTEA++L APW N++G  N+ G ++ IA
Sbjct: 99  GWLREFGVKTAIYQDEKHGDTLYGVLHAQRGDGTEAVILAAPWTNADGMVNLSGVSIGIA 158

Query: 161 LSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYF 220
           L+R+FSRWPVWSKNIIVV S+NP  ++RSWVEAYHTSLDLTGGSIEAAV+LDYP  NDYF
Sbjct: 159 LTRFFSRWPVWSKNIIVVLSENPKGSMRSWVEAYHTSLDLTGGSIEAAVVLDYPGVNDYF 218

Query: 221 NYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGM 280
           ++ EIH++GLNGE PNLDLVN+A+ IT+HEGMKVSLHG+   ++  N++WSRL ++  G+
Sbjct: 219 DHVEIHYDGLNGEEPNLDLVNIAISITEHEGMKVSLHGVSCDKISDNDFWSRLLIMLTGI 278

Query: 281 KDSTLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFH 339
           K++ L+G++K +GNE FSGWRIQAVTLKA G EG+ D+TTFGRIPEAMFRSINNLLEKFH
Sbjct: 279 KNAALSGLRKVNGNEAFSGWRIQAVTLKAHGTEGRHDVTTFGRIPEAMFRSINNLLEKFH 338

Query: 340 QSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXXXX 398
           QSFFFY LL+P  FVSISSYLP AV LSI+FA+A++DA +NN Y    L  TY       
Sbjct: 339 QSFFFYILLAPRYFVSISSYLPCAVTLSISFALASLDAMINNNYKKLPLSSTYNLLSLSM 398

Query: 399 XXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXX 458
                         FL    +P  LI  S +++  PL++ +    + EP+ YR++     
Sbjct: 399 WCISLLGCFGIAQLFL-RFDAPTILISFSALISFLPLLLKKK---IAEPLAYRLKSVAFL 454

Query: 459 XXXXXXXXXXXXNFPLAFSIGLFGYPMTLVK--PLNIYSKSQMSLKLRNSVLLVISNPFV 516
                       NF LAF++GL  +PMTLV+   LN YS   + +KL+NS+LL++SNPF+
Sbjct: 455 FFSLVLTSLLMVNFFLAFAMGLTAFPMTLVRTSSLNNYS---LRIKLKNSILLLLSNPFI 511

Query: 517 ATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAA 576
           A+++ C   E  + P   VF    +AWK+L CWTWFV+C+GWLP+WL+V  S+  + PA 
Sbjct: 512 ASYIFCQCFE-PDLPGFTVFTEFATAWKELGCWTWFVICIGWLPSWLMVALSTLNTQPAQ 570

Query: 577 ETTIEKK 583
               +KK
Sbjct: 571 LDDRKKK 577

>Smik_12.147 Chr12 (295948..297789) [1842 bp, 613 aa] {ON} YLR088W
           (REAL)
          Length = 613

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/580 (54%), Positives = 397/580 (68%), Gaps = 39/580 (6%)

Query: 39  ILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDI 98
           I I+PM+GQYR TYISENALMPSQAYSYFRE+EWNILRGYR++IE +    +++ +R +I
Sbjct: 39  IAILPMDGQYRRTYISENALMPSQAYSYFRESEWNILRGYRSQIEEM--VNMTSMERNNI 96

Query: 99  VAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALA 158
           +  WL EFG KTA+Y NE+ G+TLYGV+HAPRGDGTEAMVL  PW NS+ +FN+GG+AL 
Sbjct: 97  MGSWLQEFGTKTAIYENEQYGETLYGVMHAPRGDGTEAMVLAVPWFNSDDKFNVGGAALG 156

Query: 159 IALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNND 218
           ++L+R+FSRWPVWSKNII+VFS+NP  ALRSWVEAYHTSLDLTGGSIEAAV++DY S  D
Sbjct: 157 VSLARFFSRWPVWSKNIIIVFSENPCAALRSWVEAYHTSLDLTGGSIEAAVVVDYSSAED 216

Query: 219 YFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFL 278
           +F Y EI ++GLNGELPNLDLVNVA+ IT+HEGMKVSLHGLP  +L  NNYWSRLK+L L
Sbjct: 217 FFEYVEISYDGLNGELPNLDLVNVAISITEHEGMKVSLHGLPLDQLTINNYWSRLKVLCL 276

Query: 279 GMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKF 338
           G++D  LAG+K  HGNE FSGWRIQ+VTLKA G    DITTFGRIPEAMFRSINNLLEKF
Sbjct: 277 GIRDWALAGVKNPHGNEAFSGWRIQSVTLKAHGNSGHDITTFGRIPEAMFRSINNLLEKF 336

Query: 339 HQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXXX 397
           HQSFFFY LL+P  FVSISSYLPSAV LS+ FAI++++A +NN YAS ++   Y      
Sbjct: 337 HQSFFFYLLLAPRQFVSISSYLPSAVALSVAFAISSLNAFINNTYASISIFSEYNLVALL 396

Query: 398 XXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXX 457
                          FL   ++ L + + S++    PL++S+  + + EP+ YR++    
Sbjct: 397 VWFISLVISFVVSQVFLLLPSAGLLMAI-SMISCFLPLILSKKVH-ISEPLSYRLKNVAF 454

Query: 458 XXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYS---------------------- 495
                        NF +A  IG   +PMTLVK +   S                      
Sbjct: 455 LYFSLVLTSLLMINFAMALLIGTLAFPMTLVKTIIESSGEHEVSAKPYISIKTEPKEETE 514

Query: 496 -----------KSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAALFSAWK 544
                      KSQ   +L+N +LLV++NPF++  +  +  ++ EF   DV   L SAW 
Sbjct: 515 LIENYEDIMPGKSQQRQELKNLLLLVLTNPFISITIFGSFFDD-EFQGFDVINKLVSAWL 573

Query: 545 DLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584
           DL CW+WFVLC+GWLP WLLV  SSF S      + EK+S
Sbjct: 574 DLKCWSWFVLCIGWLPCWLLVLASSFESKRVMLKSKEKQS 613

>Skud_12.156 Chr12 (299282..301120) [1839 bp, 612 aa] {ON} YLR088W
           (REAL)
          Length = 612

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/579 (54%), Positives = 395/579 (68%), Gaps = 38/579 (6%)

Query: 39  ILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDI 98
           I I+PM+GQYR TYISENALMPSQAYSYFRE+EWN+LRGYR++IE + +  +++S+R + 
Sbjct: 39  IAILPMDGQYRRTYISENALMPSQAYSYFRESEWNVLRGYRSQIEEMEN--MTSSERNNQ 96

Query: 99  VAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALA 158
           +  WL EFG KTA+Y +++ G+TLYGV+HAPRGDGTEAMVL  PW NS+ EFN+GG+AL 
Sbjct: 97  MGSWLQEFGTKTAIYESQQYGETLYGVMHAPRGDGTEAMVLAIPWFNSDDEFNVGGAALG 156

Query: 159 IALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNND 218
           ++L+R+FSRWPVWSKNIIVVFS+NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  D
Sbjct: 157 VSLARFFSRWPVWSKNIIVVFSENPRAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAED 216

Query: 219 YFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFL 278
           +F Y EI ++GLNGELPNLDLVN+A+ IT+HEGMKVSLHGLP  +L  N++WSRLK+L L
Sbjct: 217 FFEYVEISYDGLNGELPNLDLVNIAISITEHEGMKVSLHGLPYDQLANNDFWSRLKILSL 276

Query: 279 GMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKF 338
           G++D  L+G+K  HGNE FSGWRIQ+VTLKA G G  DITTFGRIPEAMFRSINNLLEKF
Sbjct: 277 GIRDWALSGVKNPHGNEAFSGWRIQSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKF 336

Query: 339 HQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXXX 397
           HQSFFFY LL+P  FVSISSYLPSAV  S+ FAI++++A +NNAYAS +L   Y      
Sbjct: 337 HQSFFFYLLLAPRQFVSISSYLPSAVAFSVAFAISSLNAFINNAYASISLFSEYNLVALL 396

Query: 398 XXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXX 457
                          FL   +  L + + S+     PLV+S   + + EP+ YR++    
Sbjct: 397 VWFISLVVSFIISQIFLLVPSVGLLMTI-SLATCFLPLVLSEKVH-ISEPLSYRLKNVAF 454

Query: 458 XXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPL--------NIYSKSQMSLKLR----- 504
                        NF +A  IG   +PMT ++ +         + +KS  S+K       
Sbjct: 455 LYFSLVSTSLLMINFAMALLIGSLAFPMTFIRTIVVGKSTEHEMGTKSHTSVKTESRDDL 514

Query: 505 -----NSVL--------------LVISNPFVATWLICTVVENSEFPNLDVFAALFSAWKD 545
                ++VL              LV++NPF++  L   V +N EF   D+   L SAW D
Sbjct: 515 FEHHGDTVLEKAKKRQQLKNLLLLVLTNPFISITLFALVFDN-EFHGFDIVNKLISAWLD 573

Query: 546 LNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584
           L CW WFVLC+GWLP WLL+  SSF S      + EK+S
Sbjct: 574 LKCWNWFVLCIGWLPCWLLILASSFESRSVVVKSKEKQS 612

>NCAS0B03860 Chr2 complement(687424..689175) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/587 (51%), Positives = 402/587 (68%), Gaps = 7/587 (1%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           MGLFE +QR+                           +I I+P  GQYRNTYISENALMP
Sbjct: 1   MGLFERVQRQVIARGLIPKVISLLPLISTLCIVLGIVIIGILPFEGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRE+EWNI+RGYR++I  L  R  SA +R  I++ WL +FG KT +Y+N E GD
Sbjct: 61  SQAYSYFRESEWNIVRGYRSQIVEL--RNASAVERNAIMSEWLQQFGTKTDIYQNHETGD 118

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
           TLYGV HAPRGDGTE+MVL  PW N++GEFN+ G+AL +AL+RYFSRWPVWSKNIIVVF+
Sbjct: 119 TLYGVFHAPRGDGTESMVLAIPWFNADGEFNVNGAALGVALARYFSRWPVWSKNIIVVFT 178

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           +NP  ALRSWVEAYHTSLDLTGGSIEAA++LD+    D F+Y EI+++GLNGELPNLD+V
Sbjct: 179 ENPKAALRSWVEAYHTSLDLTGGSIEAAIVLDFAGEGDLFDYMEIYYDGLNGELPNLDMV 238

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           N+ V   +HEGMKVSLHG P  +++++  +SRLK+L   +K+S L+G+KK +GNE FSGW
Sbjct: 239 NIGVFTAEHEGMKVSLHGTPFDKIKEDTLFSRLKILMSSIKNSALSGVKKTYGNEAFSGW 298

Query: 301 RIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359
           RIQ+VTL+ARG+ G  D+T+FGR+PEAMFRSINNLLEKFHQSFFFY +L+P +FVSISSY
Sbjct: 299 RIQSVTLRARGQNGPFDVTSFGRVPEAMFRSINNLLEKFHQSFFFYLMLAPRHFVSISSY 358

Query: 360 LPSAVLLSITFAIAAVDATVNNAYASALHIT-YTXXXXXXXXXXXXXXXXXXHWFLYSTT 418
           LPS V +SI FA+A++++  NN Y +    + YT                  + F+YS  
Sbjct: 359 LPSTVAISIGFALASLNSYFNNPYYTLPFFSLYTLLSILFWFVSLVVTFIVSNIFIYSPF 418

Query: 419 SPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPLAFSI 478
            P  L+  ++++ + P ++ + N  +++ + YR+R                 NFPLAF +
Sbjct: 419 -PTILLAVNIIICLYPAIL-KGNAFMKDLLSYRLRSTAFLFMSLLLTSLLMVNFPLAFGM 476

Query: 479 GLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFAA 538
           GL  +PMT VK +   + +    +++NSVLL++SNPF+ATWL   + +N EF  LDVF  
Sbjct: 477 GLLSFPMTQVKTITSDTPTISRTRVKNSVLLLVSNPFIATWLFSLLCDN-EFSGLDVFER 535

Query: 539 LFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585
           L SA ++L CWTW VLC+GW   WLLV  S+  ++  +  + + K  
Sbjct: 536 LVSASRELGCWTWLVLCVGWWTPWLLVAISALDTVKLSNDSEDFKKQ 582

>TBLA0F03080 Chr6 complement(747695..749446) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/538 (54%), Positives = 388/538 (72%), Gaps = 9/538 (1%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           + L++PM+GQYR+TYISENALMPSQAYSYFRE+EWNILRGYRTEI++  S  + + DR  
Sbjct: 38  LFLMLPMDGQYRHTYISENALMPSQAYSYFRESEWNILRGYRTEIDIFPS--MPSRDRNL 95

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
           ++  WL EFG KT+VY N+E GDTLYG+ +APRGDGTEA+VL  PW N++GEFN GG+AL
Sbjct: 96  VMTQWLEEFGTKTSVYHNDEYGDTLYGIFNAPRGDGTEAIVLAIPWYNADGEFNTGGAAL 155

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
            IALSR+FSRWP+WSKNIIVVFS+NP  ALRSWV+AYH SLDLTGGSIEAA+++DYPS++
Sbjct: 156 GIALSRFFSRWPIWSKNIIVVFSENPDGALRSWVDAYHHSLDLTGGSIEAAIVMDYPSSS 215

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           D+F+Y EI++ G+NGELPNLDL+N+A+ IT+HEGM+VSLHGLP+  L +NNY+SRL+ L 
Sbjct: 216 DFFDYVEIYYHGINGELPNLDLLNIAIQITEHEGMQVSLHGLPKESLHQNNYFSRLRTLL 275

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKAR---GEGQIDITTFGRIPEAMFRSINNL 334
           LG KD+ L+G+K  HGNE FSG+RIQA+TLKA+        DIT+FGRI EA FRS+NNL
Sbjct: 276 LGTKDALLSGIKPRHGNEAFSGFRIQAITLKAKFTPDNNDHDITSFGRIAEASFRSVNNL 335

Query: 335 LEKFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYASALHITYTXX 394
           LEKFHQSFFFY +L+P  FVSISSYLPSAV  S+ FAI+++ + +NN+Y++    +    
Sbjct: 336 LEKFHQSFFFYLILAPKYFVSISSYLPSAVTFSVAFAISSLSSYINNSYSTLPIFSEYNL 395

Query: 395 XXXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRX 454
                                  T P  L+LGSV L+V P ++  +   + EP+ YR++ 
Sbjct: 396 LAGLLFTISITFSFFVARLSLLFTEPRLLVLGSVFLSVLPHLLG-NRFTIPEPLSYRLKS 454

Query: 455 XXXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNP 514
                           NF LAF IG+ G+ MT VK + I+  S M +++RN++ L++SNP
Sbjct: 455 IAFLYISLVLTSLLVLNFSLAFGIGILGFAMTAVKTITIH--SSMRVRVRNTMHLLLSNP 512

Query: 515 FVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTS 572
           F +  L+ T + + +   + +F     +W  LNCWTWF++C+GWLP W+LV+ SS  +
Sbjct: 513 FTSV-LLFTYIFDKDIYGIKIFYEFIHSWNTLNCWTWFIICVGWLPPWILVSISSIQT 569

>Suva_10.172 Chr10 (320928..322772) [1845 bp, 614 aa] {ON} YLR088W
           (REAL)
          Length = 614

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/581 (51%), Positives = 391/581 (67%), Gaps = 40/581 (6%)

Query: 39  ILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDI 98
           I I+PM+GQYR TYISENALMPSQAYSYFRETEWNILRGYR++IE   +  +++++R ++
Sbjct: 39  IAILPMDGQYRRTYISENALMPSQAYSYFRETEWNILRGYRSQIE--ETVNMTSTERNNL 96

Query: 99  VAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALA 158
           +  WL EFG KTA+Y NE+ G+TLYGV+HAPRGDGTEAMVL  PW NSE EFN+GG++L 
Sbjct: 97  MGSWLQEFGTKTAIYENEQYGETLYGVMHAPRGDGTEAMVLAIPWFNSEKEFNVGGASLG 156

Query: 159 IALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNND 218
           ++L+R+FSRWPVWSKNIIVVFS+NP  ALRSWVEAYHTSLDLTGGSIEAAV+LDY S  D
Sbjct: 157 VSLARFFSRWPVWSKNIIVVFSENPHAALRSWVEAYHTSLDLTGGSIEAAVVLDYSSAED 216

Query: 219 YFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFL 278
           +F Y E+ ++GLNGELPNLDLVNVA+ I +HEGMKVSLHGLP  +L  N+++SRLK+L L
Sbjct: 217 FFEYVEVSYDGLNGELPNLDLVNVAISIIEHEGMKVSLHGLPYEQLGDNDFFSRLKILCL 276

Query: 279 GMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKF 338
           G++D  L+G+K  HGNE FSGWRIQ+VTLKA G G  DITTFGRIPEAMFRSINNLLEKF
Sbjct: 277 GIRDWALSGVKNPHGNEAFSGWRIQSVTLKAHGHGGHDITTFGRIPEAMFRSINNLLEKF 336

Query: 339 HQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXXX 397
           HQSFFFY LL+P  FVSISSYLPSAV LS+ FA+++++A +NN YAS +L   Y      
Sbjct: 337 HQSFFFYLLLAPRQFVSISSYLPSAVALSVAFAMSSLNAFINNDYASISLFSEYNLVAVL 396

Query: 398 XXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXX 457
                          FL    + L + + S+ +   P+ +S   + + EP+ YR++    
Sbjct: 397 VWFIAMVVSFVISQLFLSVLPAGLLMTI-SLAICFLPIALSGKVH-ISEPLSYRLKNVAF 454

Query: 458 XXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLL-------- 509
                        NF +A  IG   +PMT +K + +   ++     R+++ +        
Sbjct: 455 LYFSLVSTSLLMINFAMALLIGTLAFPMTFIKTIAVERPAEPETGTRSNISIKTEPNDET 514

Query: 510 --------------------------VISNPFVATWLICTVVENSEFPNLDVFAALFSAW 543
                                     +++NPF++  +   + ++ EF   D+   L SAW
Sbjct: 515 QLNKHYKEGTLEKNQQRQKLKNLLLLILTNPFISITVFGLLFDD-EFQGFDIINKLVSAW 573

Query: 544 KDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584
            DL CW+WF+LCLGWLP WLL+  SSF S      + EK+S
Sbjct: 574 IDLKCWSWFILCLGWLPCWLLILASSFESKSVVVKSKEKQS 614

>CAGL0L12232g Chr12 (1324754..1326529) [1776 bp, 591 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088w required for attachment of GPI anchor onto
           proteins
          Length = 591

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/553 (53%), Positives = 384/553 (69%), Gaps = 14/553 (2%)

Query: 43  PMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGW 102
           P++GQYR TYISENALMPSQAYSYFRETEWNILRGYR++IE L    V    R ++VA W
Sbjct: 43  PLDGQYRRTYISENALMPSQAYSYFRETEWNILRGYRSQIETLEHSSVD--QRNEVVAEW 100

Query: 103 LNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALS 162
           L E G KTA+Y +E+ G TLYGVLHA RGDGTEAMVL  PW N + +FN+GG+AL ++LS
Sbjct: 101 LQEQGLKTALYEHEKWGKTLYGVLHASRGDGTEAMVLAIPWKNVDDQFNLGGAALGVSLS 160

Query: 163 RYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNY 222
           ++F RWPVWSKNIIVVFS++   ALR+WV+AYHTSLDLT GSIEAAV+LDYPS +D+F Y
Sbjct: 161 QFFKRWPVWSKNIIVVFSEDSGAALRAWVDAYHTSLDLTAGSIEAAVVLDYPSKSDFFEY 220

Query: 223 TEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKD 282
            EI ++GLNGELPNLDLVN+AV IT+HEGMKVSLHGLP +E+   +Y++RLK++F+G+K+
Sbjct: 221 VEISYDGLNGELPNLDLVNIAVSITEHEGMKVSLHGLPPNEMYNTDYFARLKIMFVGIKN 280

Query: 283 STLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQS 341
             L+G+K+ HGNE FSGWRIQ+VTL+A G EGQ+DIT FGRIPEAMFRS+NNLLEKFHQS
Sbjct: 281 WALSGVKRIHGNEAFSGWRIQSVTLRAHGNEGQLDITCFGRIPEAMFRSVNNLLEKFHQS 340

Query: 342 FFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYASALHITYTXXXXXXXXX 401
           +FFY LL+P NFVSIS+YLPSAV++S+ FA+ ++D+ +NN Y S    +           
Sbjct: 341 YFFYLLLAPRNFVSISNYLPSAVIISVAFAVISLDSAINNDYLSIPFSSVNTLVPFIILS 400

Query: 402 XXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSN-NALREPVCYRMRXXXXXXX 460
                       L        L+ GSV L   PLVMS+ N + + + V YR++       
Sbjct: 401 ASVFVSFLISRVLIMLPIVESLLFGSVALTFLPLVMSKKNIHVINQAVAYRLKSIGSIYY 460

Query: 461 XXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLK--LRNSVLLVISNPFVAT 518
                     NF L F IGL  +P+T +  ++  + +  S K  L+N+ +L I+NPF++ 
Sbjct: 461 SLILTSLLMVNFALTFMIGLLAFPLTKLAVISTKTIADESRKSILKNTFILFITNPFISL 520

Query: 519 WLICTVVE---NSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPA 575
           WL    ++   N  F    ++  + ++W  L CWTWF++CLGWLP WL+   SS  S P 
Sbjct: 521 WLFTATMDTDFNGSFSV--IYNRMITSWDTLGCWTWFIICLGWLPYWLISVISSIPSQPI 578

Query: 576 AETTI---EKKSN 585
            E T    +KK N
Sbjct: 579 VERTSILDDKKEN 591

>KLTH0G13706g Chr7 complement(1173326..1175080) [1755 bp, 584 aa]
           {ON} similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 584

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/537 (54%), Positives = 379/537 (70%), Gaps = 21/537 (3%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           + L++P+ GQYR+TYISENALMPSQAYSYFRETEWNILRGYRT+I+VL  +  S+ +R +
Sbjct: 39  LTLLLPLEGQYRHTYISENALMPSQAYSYFRETEWNILRGYRTQIQVLEEK--SSKERNE 96

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
           +VA W  EFGAKTA Y ++  G+T+YGVLHAPRGDGTEAMVL APW N +GE+NIGG+AL
Sbjct: 97  VVASWFQEFGAKTAFYEDDLHGNTMYGVLHAPRGDGTEAMVLAAPWYNGDGEYNIGGAAL 156

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
           A ALSR+FSRWPVWSKNII+VFSD+P  +LRSWV AYHTSLDLTGGSIE+AV+LDYP +N
Sbjct: 157 ATALSRFFSRWPVWSKNIIIVFSDDPEASLRSWVHAYHTSLDLTGGSIESAVVLDYPGSN 216

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           D+F Y EI++ GLNGELPNLDLVNVAVHIT+HEGMKVSL+G+   E+EK NY+S++K + 
Sbjct: 217 DFFKYVEIYYAGLNGELPNLDLVNVAVHITEHEGMKVSLNGVSEEEMEKRNYFSKMKTMM 276

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLE 336
           +G+K   L+G++  +GNE FSGWRIQA+ L+ARG +G  DITTFGRIPEA FRS+NNLLE
Sbjct: 277 VGVKKMALSGVQSCYGNEAFSGWRIQAIVLRARGTDGPFDITTFGRIPEATFRSVNNLLE 336

Query: 337 KFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATV----NNAYASALH-ITY 391
           KFHQSFFFY LL+P  FVSI+SYLP+AV  S++F +A +D  +    +N  A ++H ++ 
Sbjct: 337 KFHQSFFFYLLLAPRYFVSIASYLPAAVAFSVSFIVATLDCVLKSGASNTPAFSVHNLSA 396

Query: 392 TXXXXXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYR 451
                              HW  YS+     LI  + V+AV P +  R    +     Y+
Sbjct: 397 VIGFTVALLLSFALSILFSHW-QYSSL----LISCNAVIAVLPAIFGR--QGIEASHSYQ 449

Query: 452 MRXXXXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVI 511
            +                 NF LAF IGL  +P+ LVK     +      +++N++LL++
Sbjct: 450 FKSVAFLYLSVVLTSLLVINFALAFGIGLLAFPLILVK-----APMTSRQRVKNTILLIL 504

Query: 512 SNPFVATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFS 568
           SNPF++T L     E  +   L +F  L  AW+ L CWTW V+C+GWLP+WLLV  S
Sbjct: 505 SNPFISTLLFVNTFE-PQLSGLQLFHRLVQAWQKLGCWTWSVVCIGWLPSWLLVACS 560

>AGR087C Chr7 complement(890706..892439) [1734 bp, 577 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR088W
           (GAA1)
          Length = 577

 Score =  594 bits (1531), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/552 (54%), Positives = 382/552 (69%), Gaps = 17/552 (3%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           + L +PM GQYR TYISENALMPSQAYSYFRE+EWNILRGYR+EI+ +  R ++A +R  
Sbjct: 39  LTLFLPMEGQYRRTYISENALMPSQAYSYFRESEWNILRGYRSEIDGM--RTLTADERNR 96

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
           IVA W+ E+GAK AVY ++  G+TLY VLHA RGDGTEAMVL APW   EG++N GG AL
Sbjct: 97  IVASWMEEYGAKAAVYNDDRHGETLYAVLHATRGDGTEAMVLAAPWETVEGQYNTGGVAL 156

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
           A+A+ RYFSRWPVWSKNII+V S++P  +LRSWV+AYHT LDLTGGSIEAA++LDYP  N
Sbjct: 157 AVAMGRYFSRWPVWSKNIIIVLSEDPHASLRSWVQAYHTKLDLTGGSIEAAIVLDYPGTN 216

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           DYF + EI +EGLNG +PNLDL+NVAVHIT+HEGMKV+LHG P  EL  + Y+SR++LL 
Sbjct: 217 DYFQHVEISYEGLNGGMPNLDLLNVAVHITEHEGMKVALHGTPWEELGTDTYFSRMRLLL 276

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLE 336
            G+KD  L+G+K+  GNE FSGWRIQ+VTLKARG  G  DITTFGR+PEAMFRS+NNLLE
Sbjct: 277 KGIKDMALSGIKRTSGNEAFSGWRIQSVTLKARGTNGSFDITTFGRVPEAMFRSVNNLLE 336

Query: 337 KFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYASALHIT-YTXXX 395
           KFHQSFFFY LL+P  FVSI SYLP+AV LSI+FA+ A D+ +NN +AS   I+ Y    
Sbjct: 337 KFHQSFFFYLLLAPRYFVSIGSYLPAAVGLSISFAVMACDSVLNNEFASLPLISIYNIWA 396

Query: 396 XXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXX 455
                            F Y   +P  L+  +VV++  P  + +    +++P  +R +  
Sbjct: 397 LLAFSVALLVSAITAEVFFY-LPAPALLLAFNVVVSFMPFALVKYK--IQKPFSHRFKAA 453

Query: 456 XXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPF 515
                          NF LAF +GL  +PMT V+     S  Q   K++NS+LL++SNPF
Sbjct: 454 AYLYFSTVLSSLLVMNFQLAFMVGLLAFPMTFVRTTVHASVRQ---KMKNSLLLLLSNPF 510

Query: 516 VATWLICTVVE--NSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSI 573
           ++   IC  V     E     VF +L  AW DL CWTW+VLCLGW P W++V +SS  S+
Sbjct: 511 IS---ICVFVHLFEPELTGFSVFYSLIDAWNDLGCWTWYVLCLGWYPAWIMVAYSSIDSV 567

Query: 574 PAAETTIEKKSN 585
           P A     KKS+
Sbjct: 568 PIAAPA--KKSS 577

>Ecym_4309 Chr4 complement(656032..657765) [1734 bp, 577 aa] {ON}
           similar to Ashbya gossypii AGR087C
          Length = 577

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/549 (53%), Positives = 380/549 (69%), Gaps = 13/549 (2%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           + L +P+ GQYR TYISENALMPSQAYSYFRE+EWNILRGYR E+E  N + +   +R  
Sbjct: 39  LTLFLPLEGQYRRTYISENALMPSQAYSYFRESEWNILRGYRRELE--NLKDLDIHERNT 96

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
           IVA W+ E+GAKT++  N + G+TLYG++H  RGDGTEAMVL APW  ++G +N GG+AL
Sbjct: 97  IVASWMEEYGAKTSINTNNQYGETLYGIVHTSRGDGTEAMVLAAPWTTTDGLYNNGGAAL 156

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
           AI+L+RYF+RWPVWSKNIIVV S +P  +LR+WV+AYHT LDLTGGSIE+AV+LDYP  N
Sbjct: 157 AISLARYFARWPVWSKNIIVVLSADPQASLRAWVKAYHTKLDLTGGSIESAVVLDYPGTN 216

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           DYF Y EI + GLNG LPNLDL+N AVHI++HEGMKVSLHG+P  EL ++ Y  RLK L 
Sbjct: 217 DYFKYIEIGYNGLNGGLPNLDLINTAVHISEHEGMKVSLHGMPFVELSQDTYKLRLKTLL 276

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLE 336
            G+KD TLAG+K   G+E F+GWRIQ+VTLKA G+ G  D+TTFGR+PEA+FRS+NNLLE
Sbjct: 277 SGIKDMTLAGIKNTTGHEAFNGWRIQSVTLKAHGQDGPFDVTTFGRVPEAIFRSVNNLLE 336

Query: 337 KFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXX 395
           KFHQSFFFY LLSP +FVSI SYLP+A+ LS +FAIA+ D+ +NN Y+   L   Y    
Sbjct: 337 KFHQSFFFYLLLSPRSFVSIGSYLPAAIALSASFAIASADSILNNEYSKLPLLSIYNIWA 396

Query: 396 XXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXX 455
                            F Y    PL  +L +  +A+S +  +     +++P  YR +  
Sbjct: 397 LFAFAVALMISFVTAEAFAY---MPLPSLLLAFNVALSFISFTVIKYKIQKPFSYRFKAF 453

Query: 456 XXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPF 515
                          NF LA ++G+  +PM+L K     + + M  KLRNS+LL+ SNPF
Sbjct: 454 AHLYFSIVLTSLLVVNFALALAVGVLAFPMSLTKTT---TNATMQQKLRNSLLLMSSNPF 510

Query: 516 VATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPA 575
           +A+W++C + E ++     +F +L  AW  L CWTW+VLC+GW P+W+LV +SS  SIP 
Sbjct: 511 IASWILCQLFE-AQLAGTSLFHSLIDAWTQLGCWTWYVLCIGWYPSWILVAYSSIDSIPI 569

Query: 576 AETTIEKKS 584
             T+  KKS
Sbjct: 570 VTTS--KKS 576

>NDAI0J01390 Chr10 complement(319754..321505) [1752 bp, 583 aa] {ON}
           Anc_8.261 YLR088W
          Length = 583

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/573 (51%), Positives = 378/573 (65%), Gaps = 12/573 (2%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           MGL E +QR                            MI I+PM+GQYRNTYISENALMP
Sbjct: 1   MGLLERVQRVIVSRGLIPKIMAQLPKISIIFVAISILMIAILPMDGQYRNTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRETEWNI+RGYR E+  ++    ++ +R  I+  WLNEFG KT +Y N +  +
Sbjct: 61  SQAYSYFRETEWNIVRGYRNEL--VHMENSTSRERNQIMESWLNEFGVKTQIYENRD-NE 117

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
            LYGV HAPRGDGTEA+VL  PW N +GEFN  G+A+ +AL+RYFSRWPVWSKNIIVVFS
Sbjct: 118 VLYGVFHAPRGDGTEAIVLAVPWFNVDGEFNTNGAAVGVALARYFSRWPVWSKNIIVVFS 177

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           +NP  ALRSWVEAY+TSLDLTGGSIEAA++LD P  NDYF+Y E++++GLNGELPNLDLV
Sbjct: 178 ENPDSALRSWVEAYYTSLDLTGGSIEAAIVLDSPGENDYFDYLEVYYDGLNGELPNLDLV 237

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           N+ ++I +HEGM+VSLHG P  ++++NNYW+RLK+L   ++ S  +G+ K HGNE FSGW
Sbjct: 238 NIGIYIAEHEGMRVSLHGTPFDQIKENNYWTRLKILVASIQSSAFSGLTKTHGNEAFSGW 297

Query: 301 RIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSY 359
           RIQ++TLK +G  G +DIT FGR+PEAMFRSINNLLEKFHQSFFFY LL+P  FVSISSY
Sbjct: 298 RIQSITLKTKGNSGPLDITCFGRVPEAMFRSINNLLEKFHQSFFFYLLLAPRQFVSISSY 357

Query: 360 LPSAVLLSITFAIAAVDATVNN-AYASALHITYTXXXXXXXXXXXXXXXXXXHWFLYSTT 418
           LPSAV+LS+ F IA +D+ +NN ++A      YT                     L+   
Sbjct: 358 LPSAVILSVAFVIAFMDSYINNPSFALPFFSNYTLIPAIVWTVTLVACFILAQ--LFLIL 415

Query: 419 SPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPLAFSI 478
               L+L   ++     ++ ++    +  V  R+R                 NFPL+F I
Sbjct: 416 PIPSLLLLINIVISISSIIIQNKKLFKPAVSNRLRSFAFLHLSLILTSLLMVNFPLSFMI 475

Query: 479 GLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLD---V 535
           GL  +PMT V+ +   +  Q  +KL N +LL+ISNPF+A  +   V  NS    L    V
Sbjct: 476 GLMAFPMTKVRSITANTAPQ--IKLENIILLMISNPFIALIIYNNVSSNSGLQGLQGLRV 533

Query: 536 FAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFS 568
              L SAWKD+ CWTWFVLCLGWLP+W++V  S
Sbjct: 534 INRLISAWKDMRCWTWFVLCLGWLPSWIMVAIS 566

>KLLA0F19118g Chr6 (1771250..1772986) [1737 bp, 578 aa] {ON} similar
           to uniprot|P39012 Saccharomyces cerevisiae YLR088W GAA1
           Subunit of the GPI:protein transamidase complex removes
           the GPI-anchoring signal and attaches GPI
           (glycosylphosphatidylinositol) to proteins in the ER
          Length = 578

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/548 (52%), Positives = 381/548 (69%), Gaps = 10/548 (1%)

Query: 38  MILIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYD 97
           ++ ++P +GQ+R TYISENAL+PSQAYSYFRE+EWNILRGYRT++++      +     +
Sbjct: 39  LVFMLPSDGQFRRTYISENALLPSQAYSYFRESEWNILRGYRTQLDLFQYVSTTHDSNAE 98

Query: 98  IVAGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSAL 157
            V+ WL EFG KTA+Y +E+ G+TLYG+ HAPRGDGTEAMV+ APW N   E+N GG+AL
Sbjct: 99  -VSKWLQEFGVKTAIYDDEQYGETLYGIFHAPRGDGTEAMVIAAPWYNENREYNTGGAAL 157

Query: 158 AIALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNN 217
           AI+L R+FSRWPVWSKNII+V S++P  +LRSWV AYHTSLDLTGGSIE+A++LDYP  +
Sbjct: 158 AISLVRFFSRWPVWSKNIIIVLSEDPKASLRSWVTAYHTSLDLTGGSIESAIVLDYPGTS 217

Query: 218 DYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLF 277
           D F+Y EIH++GLNGE PNLDLVNVAVHI +HEG+KVSLHGLP SEL++N+Y SRLK + 
Sbjct: 218 DRFDYMEIHYDGLNGETPNLDLVNVAVHIAEHEGIKVSLHGLPFSELDRNDYNSRLKTML 277

Query: 278 LGMKDSTLAGMKKAHGNEVFSGWRIQAVTLKARG-EGQIDITTFGRIPEAMFRSINNLLE 336
           LG+KDS L+G+K  +GNE FSGWRIQ++TLKA+G +G  DITTFGR+PEA+ RS+NNLLE
Sbjct: 278 LGIKDSVLSGIKNCYGNEAFSGWRIQSLTLKAKGIDGPHDITTFGRVPEALSRSVNNLLE 337

Query: 337 KFHQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXX 395
           KFHQSFFFY LL+P  F+SI +YL +AV +S+ F  AA++  +NN Y    L   Y    
Sbjct: 338 KFHQSFFFYLLLAPRYFISIGTYLATAVAVSVAFVFAALNQILNNKYGELPLLSIYNIWS 397

Query: 396 XXXXXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXX 455
                            F+Y    P  L+  S + +V PL +SR+   ++EP  YR +  
Sbjct: 398 ILTFCISLVFAFATSQLFVYFPL-PRVLLGLSGIFSVLPL-LSRTRLRIQEPFSYRFKAF 455

Query: 456 XXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPF 515
                          NF LA  +GL  +PMT    +    +S + L ++N VLL+ISNPF
Sbjct: 456 AYIYMAIVLTSLLVLNFSLAIVMGLLAFPMTRTTTI---IESNLRLSIKNLVLLIISNPF 512

Query: 516 VATWLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPA 575
           +ATW +   VE        VF AL  A + L CWTW+++CLGW P+WLLVT++S  +I  
Sbjct: 513 IATWAVVNFVE-PRLSGFKVFYALIEASQQLGCWTWYIICLGWYPSWLLVTYASIDAI-E 570

Query: 576 AETTIEKK 583
            +T I+K+
Sbjct: 571 VQTPIKKE 578

>Kwal_56.23804 s56 complement(710216..711952) [1737 bp, 578 aa] {ON}
           YLR088W (GAA1) - Possible component of GPI:protein
           transamidase [contig 173] FULL
          Length = 578

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/548 (53%), Positives = 386/548 (70%), Gaps = 12/548 (2%)

Query: 40  LIIPMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIV 99
           L++P+ GQYR+TYISENALMPSQAYSYFRETEWNILRGYRT+I+ L ++  S+ +R +I+
Sbjct: 41  LLLPLEGQYRHTYISENALMPSQAYSYFRETEWNILRGYRTQIQTLENK--SSLERNEIL 98

Query: 100 AGWLNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAI 159
             WL EFG KTA+Y +E  G+TLYGVLHAPRGDGTEAMVL APW N +GEFN GG+AL +
Sbjct: 99  GSWLQEFGVKTALYEDESCGNTLYGVLHAPRGDGTEAMVLSAPWFNGDGEFNKGGTALVV 158

Query: 160 ALSRYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDY 219
           AL+RYFSRWPVWSKNIIVVFSD+P  +LRSWV+AYHTSLDLTGGSIE+AV+LDYP  ND+
Sbjct: 159 ALARYFSRWPVWSKNIIVVFSDDPKASLRSWVQAYHTSLDLTGGSIESAVVLDYPGVNDF 218

Query: 220 FNYTEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLG 279
           F Y EI++ GLNGELPNLDLVNVA+H+T+HEGMKVSL+G+P  E++  +Y++R+K + +G
Sbjct: 219 FKYVEIYYAGLNGELPNLDLVNVAIHVTEHEGMKVSLNGIPEDEMQNRDYFARMKTMVVG 278

Query: 280 MKDSTLAGMKKAHGNEVFSGWRIQAVTLKARGE-GQIDITTFGRIPEAMFRSINNLLEKF 338
           +K   L+G+++ +GNE FSGWRIQAV L+ARG+ G  DITTFGR+PEA+FRS+NNLLEKF
Sbjct: 279 IKKMALSGVQRCYGNEAFSGWRIQAVVLRARGDHGPFDITTFGRVPEAVFRSVNNLLEKF 338

Query: 339 HQSFFFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYASALHITYTXXXXXX 398
           HQSFFFY LL+P  FVSI+SYLP+AV  S++F +AA+D  +    +++            
Sbjct: 339 HQSFFFYLLLAPRYFVSIASYLPAAVAFSVSFIVAALDNVLCQGASTSQSGILPNIAAVV 398

Query: 399 XXXXXXXXXXXXHWFLYSTTSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXX 458
                                P+ LI  SV+ A++P++++R    ++    +R++     
Sbjct: 399 GFTVALLFSFTVSVTFARFHHPVILISWSVMTALAPILLNRVR--IQSSYAHRLKAVAYL 456

Query: 459 XXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVAT 518
                       NF LAF IGL  +P+ LVK     + +   L  +NS+LL++SNPF++T
Sbjct: 457 YLSVVLTSLLVVNFALAFGIGLLAFPLILVK-----NSTTPRLLFKNSLLLLLSNPFIST 511

Query: 519 WLICTVVENSEFPNLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSF-TSIPAAE 577
            L     E    P L +   L  AW +  CWTW V+C+GWLP+WLL+ +SS  T +    
Sbjct: 512 CLFAYFFE-PLLPGLQILEQLVQAWNEFGCWTWCVVCIGWLPSWLLIAYSSMITDVSTLL 570

Query: 578 TTIEKKSN 585
            + EKKS+
Sbjct: 571 NSAEKKSS 578

>ZYRO0C01672g Chr3 complement(119344..121053) [1710 bp, 569 aa] {ON}
           similar to uniprot|P39012 Saccharomyces cerevisiae
           YLR088W GAA1 Subunit of the GPI:protein transamidase
           complex removes the GPI-anchoring signal and attaches
           GPI (glycosylphosphatidylinositol) to proteins in the ER
          Length = 569

 Score =  577 bits (1488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/588 (49%), Positives = 382/588 (64%), Gaps = 22/588 (3%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           M L E LQR+                            +  +P+ GQ+R TYISENALMP
Sbjct: 1   MALIEQLQRRVVEMGLVPKIIALLPLVSMICAMISSLWLATLPIEGQFRRTYISENALMP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRE+EWNILRGYR++IE      +S ++R + +A WL EFGAKT++Y NEE GD
Sbjct: 61  SQAYSYFRESEWNILRGYRSQIEHFGE--ISNNERNEQMAEWLQEFGAKTSIYNNEEYGD 118

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
           +LYG+LHA RGDGTEA++L  PW N+EG+ N+GG++L I+LSR+FSRWPVWSKNII+VFS
Sbjct: 119 SLYGILHAERGDGTEAILLAVPWYNAEGDLNVGGASLGISLSRFFSRWPVWSKNIIIVFS 178

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           +NP+VALRSWV+AYHTSLDLTGGSIEAA++LDYP  NDYF+Y EI + GLNGELPNLDLV
Sbjct: 179 ENPNVALRSWVQAYHTSLDLTGGSIEAAIVLDYPGTNDYFDYAEISYGGLNGELPNLDLV 238

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           N+AV IT+HEG+ VSLHG+    +   +YWSRLK+L  G+     AG++   GNE FSGW
Sbjct: 239 NIAVSITEHEGVHVSLHGMTPESINDESYWSRLKILLCGIYRDAFAGLEPLQGNEAFSGW 298

Query: 301 RIQAVTLKARGE--GQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISS 358
           RIQ+VT+KA G+  G  DITTFGRIPEAMFRSINNLLEKFHQS+FFY L++P  FVSISS
Sbjct: 299 RIQSVTIKAHGKEGGNNDITTFGRIPEAMFRSINNLLEKFHQSYFFYMLVAPRYFVSISS 358

Query: 359 YLPSAVLLSITFAIAAVDATVNNAYAS-ALHITYTXXXXXXXXXXXXXXXXXXHWFLYST 417
           YLP+ V+L+  FA+A++++ + N Y++ + +  Y                     FLY  
Sbjct: 359 YLPATVVLTAGFALASLNSLLANQYSNLSFYSHYNLKALLFWLVSILVSFVFSQLFLY-V 417

Query: 418 TSPLYLILGSVVLAVSPLVMSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPLAFS 477
            S + L+   VV+ + PL   R    + EP+ +R++                 NF LAF 
Sbjct: 418 PSTILLVAFIVVMLLLPLAAGRLWT-ITEPLSHRLQMYAFLYMSLVVTSLMMVNFTLAFV 476

Query: 478 IGLFGYPMTLVKPLNIYSKSQMSLKLRNSVLLVISNPFVATWLICTVVENSEFPNLDVFA 537
           +G+  +PMT V        +Q SL  +   LL+ISNP V+ +++         P+  +  
Sbjct: 477 VGILAFPMTAV-------GTQRSLTFKKYALLIISNPLVSFFIVK--------PHPQLLQ 521

Query: 538 ALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKSN 585
            L SAW+DL CWTWFVLCLGWLP+W L+  S+ +S         KK  
Sbjct: 522 KLISAWQDLGCWTWFVLCLGWLPSWTLIALSACSSTNLDPVATSKKEQ 569

>KAFR0B05550 Chr2 complement(1136432..1138099) [1668 bp, 555 aa]
           {ON} Anc_8.261 YLR088W
          Length = 555

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/526 (56%), Positives = 367/526 (69%), Gaps = 40/526 (7%)

Query: 43  PMNGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGW 102
           P++GQYRNTYISENALMPSQAYSYFRETEWNILRGYRT++E  N   +  ++R DI+  W
Sbjct: 43  PIDGQYRNTYISENALMPSQAYSYFRETEWNILRGYRTQVE--NMVDLPLTERNDIMETW 100

Query: 103 LNEFGAKTAVYRNEEMGDTLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALS 162
           LN+ GAKT  + N     T+YG+ H+PRGDGTEA+VL  PW+NSEG+FN GG+AL ++L+
Sbjct: 101 LNDIGAKTDTHNN----STIYGIFHSPRGDGTEAIVLAIPWHNSEGQFNTGGAALGVSLA 156

Query: 163 RYFSRWPVWSKNIIVVFSDNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNY 222
           R+F RWP+WSKNIIVVFS++   +LRSWVEAYHTSLDLTGGSIEAAVILDY S +D+F+Y
Sbjct: 157 RFFWRWPIWSKNIIVVFSEDTGASLRSWVEAYHTSLDLTGGSIEAAVILDYASESDFFDY 216

Query: 223 TEIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKD 282
            EIH++GLNGELPNLDLVN+AV IT+HEGMKVSLHGLPR ELE+ + WSR K+L   +KD
Sbjct: 217 VEIHYDGLNGELPNLDLVNIAVSITEHEGMKVSLHGLPREELEERSLWSRFKMLLRSIKD 276

Query: 283 STLAGMKKAHGNEVFSGWRIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSF 342
           S+LAG+KK HGNE FSGWRIQA+TLKA GEG IDITTFGRIPEAMFRSINNLLEKFHQSF
Sbjct: 277 SSLAGIKKPHGNEAFSGWRIQALTLKACGEGGIDITTFGRIPEAMFRSINNLLEKFHQSF 336

Query: 343 FFYFLLSPNNFVSISSYLPSAVLLSITFAIAAVDATVNNAYASALHI-TYTXXXXXXXXX 401
           F+Y LL+P NFVSISSYLP+AV LS+ FA +++   VN+   S   I +YT         
Sbjct: 337 FYYLLLAPRNFVSISSYLPAAVGLSLAFACSSLGEFVNDNQDSIPFISSYTLEAIIV--- 393

Query: 402 XXXXXXXXXHWFLYST------------TSPLYLILGSVVLAVSPLVMSRSNNA-LREPV 448
                     WFL  T            T P+ L+   ++ +  PL+      A  +  V
Sbjct: 394 ----------WFLSITFSFCFAITYLKYTFPVMLMFICILFSFIPLISRGLPLAETKITV 443

Query: 449 CYRMRXXXXXXXXXXXXXXXXXNFPLAFSIGLFGYPMTLVKPLNIYSKSQMSLKLRNSVL 508
            +RM+                 NFPLA +IG+  +PMTLVK  N    S  +LK  NS+L
Sbjct: 444 AHRMKAFAFGYFSLVLTSLLMINFPLALTIGVLAFPMTLVKISNTLPTSSQALK--NSML 501

Query: 509 LVISNPFVATWLICTV--VENSEFPNLDVFAALFSAWKDLNCWTWF 552
           L++SNP+++   IC    + +SE   L     L  AW D+NCWTWF
Sbjct: 502 LLVSNPYIS---ICAFSNIFDSELTGLATLDRLIPAWNDMNCWTWF 544

>TPHA0A01820 Chr1 complement(367804..369549) [1746 bp, 581 aa] {ON}
           Anc_8.261 YLR088W
          Length = 581

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/593 (46%), Positives = 379/593 (63%), Gaps = 22/593 (3%)

Query: 1   MGLFETLQRKXXXXXXXXXXXXXXXXXXXXXXXXXXXMILIIPMNGQYRNTYISENALMP 60
           M L E L R+                           +IL +P++GQYR TYISENAL+P
Sbjct: 1   MALIEVLHRRATKLGLLPKVIGKLSIVSNILVLISIGLILCLPLDGQYRRTYISENALLP 60

Query: 61  SQAYSYFRETEWNILRGYRTEIEVLNSRGVSASDRYDIVAGWLNEFGAKTAVYRNEEMGD 120
           SQAYSYFRE+EWNILRGYRT IE L  +   A  R ++++ WL +FG K AVY N   GD
Sbjct: 61  SQAYSYFRESEWNILRGYRTAIEALIDK--PARVRNEVISSWLTDFGMKHAVYDNAADGD 118

Query: 121 TLYGVLHAPRGDGTEAMVLCAPWNNSEGEFNIGGSALAIALSRYFSRWPVWSKNIIVVFS 180
           TLYGV ++ RGDGTEA+VL  PW N++ E NIGG+AL I+LSRYFSRWP+WSKNII+V S
Sbjct: 119 TLYGVYNSQRGDGTEAIVLAVPWYNTDNEVNIGGAALGISLSRYFSRWPIWSKNIILVIS 178

Query: 181 DNPSVALRSWVEAYHTSLDLTGGSIEAAVILDYPSNNDYFNYTEIHFEGLNGELPNLDLV 240
           +NP  A++SWV+AYH SLDLTGGS+EAA++LD+PS ++YF + E++F G+NGELPNLD+V
Sbjct: 179 ENPHKAMKSWVDAYHNSLDLTGGSLEAAIVLDFPSKSEYFEFVELYFNGINGELPNLDIV 238

Query: 241 NVAVHITQHEGMKVSLHGLPRSELEKNNYWSRLKLLFLGMKDSTLAGMKKAHGNEVFSGW 300
           NVA+ + +HEG+KVSL GL  SE+  ++Y++RLK L  G+K+S L+G +K +GNE FSG 
Sbjct: 239 NVAISVIEHEGVKVSLQGLNLSEMYTSSYFNRLKTLLFGVKNSALSGTRKLYGNEAFSGR 298

Query: 301 RIQAVTLKARGEGQIDITTFGRIPEAMFRSINNLLEKFHQSFFFYFLLSPNNFVSISSYL 360
           RIQA+TLKA G    DITTFGRIPEA+FRS+NNLLEKFHQSFFFYFL++P +FVSI SYL
Sbjct: 299 RIQALTLKACGTEGHDITTFGRIPEAIFRSVNNLLEKFHQSFFFYFLVAPRHFVSIGSYL 358

Query: 361 PSAVLLSITFAIAAVDATVNNAYASALHITYTXXXXXXXXXXXXXXXXXXHWFLY----- 415
           PSAV LSI+F I+A  + +NN Y     IT                      F++     
Sbjct: 359 PSAVCLSISFGISAAHSYINNQY-----ITVPLSDNSSILALIIFFGSIAISFIFLQINE 413

Query: 416 STTSPLYLILGSVVLAVSPLV-MSRSNNALREPVCYRMRXXXXXXXXXXXXXXXXXNFPL 474
           +   P  +IL  ++++  PL  + +    ++  + YR++                 NF L
Sbjct: 414 TFLQPHLMILAFLLISFLPLTNIPQPLITIQPCLSYRLKSFAFIYISLVLTSLLVMNFAL 473

Query: 475 AFSIGLFGYPMTLVKPLNIYSKSQM---SLKLRNSVLLVISNPFVATWLICTVVENSEFP 531
           AF +GL  +P+T  K     S S+M     K+ N   L ISNPF+A ++  ++ E+ +  
Sbjct: 474 AFGMGLLAFPLTFTK-----SCSEMITFKSKVINCFYLAISNPFIAIFIFVSIFED-DIT 527

Query: 532 NLDVFAALFSAWKDLNCWTWFVLCLGWLPTWLLVTFSSFTSIPAAETTIEKKS 584
           N +VF+ L S++K +  WTW + C+GW  TW +V  ++  +  +A     KK+
Sbjct: 528 NFEVFSDLISSFKYMGNWTWAITCIGWFTTWQMVYIANLDTPRSALDGDTKKN 580

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%), Gaps = 1/44 (2%)

Query: 209  VILDYPSNNDYFNYTEIHFEGLNGELPNLDLVNVAVHITQHEGM 252
            ++LD+  ++DY+ Y E    G +G +   DL+ +   +T+HE M
Sbjct: 1023 MLLDFFEDDDYY-YIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

>TBLA0A07800 Chr1 complement(1921256..1922497) [1242 bp, 413 aa]
           {ON} Anc_3.45 YOL126C
          Length = 413

 Score = 31.2 bits (69), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 24/41 (58%)

Query: 224 EIHFEGLNGELPNLDLVNVAVHITQHEGMKVSLHGLPRSEL 264
           +I+ +G+NG   +L  ++ AVH+T H G    +  L  S+L
Sbjct: 78  DINKDGVNGVTTDLSHIDTAVHVTSHSGEDGLVESLTDSDL 118

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.135    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,516,364
Number of extensions: 2297539
Number of successful extensions: 5295
Number of sequences better than 10.0: 24
Number of HSP's gapped: 5337
Number of HSP's successfully gapped: 26
Length of query: 585
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 470
Effective length of database: 40,294,809
Effective search space: 18938560230
Effective search space used: 18938560230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)