Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032408.262ON51951926150.0
KAFR0B055408.262ON5193626812e-82
Smik_4.3568.262ON5763786512e-77
YDR110W (FOB1)8.262ON5663786502e-77
NCAS0B038508.262ON5884646444e-76
Suva_2.2708.262ON6323676456e-76
Skud_4.3718.262ON5803676392e-75
TDEL0F038908.262ON4763826261e-74
NDAI0J013808.262ON6243626272e-73
ZYRO0C01650g8.262ON5863645519e-63
CAGL0B01771g8.262ON5364125173e-58
Kpol_543.388.262ON4423465095e-58
Kwal_56.237998.262ON4883665126e-58
TPHA0A018108.262ON4573624913e-55
KLTH0G13684g8.262ON5083724865e-54
SAKL0H17028g8.262ON5503774842e-53
KLLA0F19140g8.262ON5273894804e-53
Kpol_392.68.262ON4573554661e-51
Ecym_43088.262ON5294044393e-47
AGR086C8.262ON5343144228e-45
TBLA0E044308.262ON4813673662e-37
TPHA0J007408.262ON4083593421e-34
TBLA0F030708.262ON4452653317e-33
TPHA0H00240singletonON829124732.4
NDAI0A041305.515ON35667713.4
SAKL0E13442g2.48ON83095689.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03240
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...  1011   0.0  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   266   2e-82
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   255   2e-77
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   254   2e-77
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   252   4e-76
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   253   6e-76
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   250   2e-75
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   245   1e-74
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   246   2e-73
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   216   9e-63
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   203   3e-58
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   200   5e-58
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   201   6e-58
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   193   3e-55
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   191   5e-54
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   191   2e-53
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   189   4e-53
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   184   1e-51
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   173   3e-47
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   167   8e-45
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   145   2e-37
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   136   1e-34
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   132   7e-33
TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON}                 33   2.4  
NDAI0A04130 Chr1 (934094..935164) [1071 bp, 356 aa] {ON} Anc_5.5...    32   3.4  
SAKL0E13442g Chr5 (1110895..1113387) [2493 bp, 830 aa] {ON} simi...    31   9.6  

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score = 1011 bits (2615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/519 (93%), Positives = 486/519 (93%)

Query: 1   MTPRVIRGFTEEFERNPYDVDRIESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGE 60
           MTPRVIRGFTEEFERNPYDVDRIESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGE
Sbjct: 1   MTPRVIRGFTEEFERNPYDVDRIESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGE 60

Query: 61  RDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDAN 120
           RDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDAN
Sbjct: 61  RDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDAN 120

Query: 121 GMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEY 180
           GMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEY
Sbjct: 121 GMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEY 180

Query: 181 CSVCNPSLKLTPKVQPKPYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRF 240
           CSVCNPSLKLTPKVQPKPYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRF
Sbjct: 181 CSVCNPSLKLTPKVQPKPYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRF 240

Query: 241 EWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLG 300
           EWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLG
Sbjct: 241 EWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLG 300

Query: 301 CXXXXXXXXXXXXINRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSE 360
           C            INRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSE
Sbjct: 301 CTTRSSAAQATARINRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSE 360

Query: 361 TQLKAKFRAKRAFILKHSPSSCVMNRGMGTLYLESPNGIQXXXXXXXXXXXXXXXXXXXX 420
           TQLKAKFRAKRAFILKHSPSSCVMNRGMGTLYLESPNGIQ                    
Sbjct: 361 TQLKAKFRAKRAFILKHSPSSCVMNRGMGTLYLESPNGIQEDAAASSADELSSAKDAEDE 420

Query: 421 XRDNSTREGSGNGEESDTEPAVDHSRRSKKKKIAGVKEEPQRSFSPMKDSQRTLFEEDSE 480
            RDNSTREGSGNGEESDTEPAVDHSRRSKKKKIAGVKEEPQRSFSPMKDSQRTLFEEDSE
Sbjct: 421 ERDNSTREGSGNGEESDTEPAVDHSRRSKKKKIAGVKEEPQRSFSPMKDSQRTLFEEDSE 480

Query: 481 QNDSMELPTPSTSHQNLARSLQRRKFEISKSDTADTSEL 519
           QNDSMELPTPSTSHQNLARSLQRRKFEISKSDTADTSEL
Sbjct: 481 QNDSMELPTPSTSHQNLARSLQRRKFEISKSDTADTSEL 519

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  266 bits (681), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 214/362 (59%), Gaps = 2/362 (0%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           +VP +G+ +++Y D  +++E  KRGER++  +  +  G +++E Y L + D +T E +A 
Sbjct: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
             P         + +++ RRYY+D NG+I D    ++IV +P++ FD+IM CHLMN H  
Sbjct: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY-LFEKALPLERITIE 213
            ++++  L  FY+N    L  + L++CSVCNP  K+    + K   ++ + +PLER+ IE
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227

Query: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273
           I EPFPNEK+E KYS+++  +D+  R+ W+ PLKNTKFK++VP +A + LSF R PI++E
Sbjct: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287

Query: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCXX-XXXXXXXXXXINRDLNDHHDECLFDFNNC 332
           + +LDW D+FDI E I  +Y ++IGLG              +   L  H +ECL  +N C
Sbjct: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347

Query: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTLY 392
           LKYG   +N          P D++S    +   KF+ K   IL+++ S  V+    G ++
Sbjct: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGLIF 407

Query: 393 LE 394
           LE
Sbjct: 408 LE 409

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  255 bits (651), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 222/378 (58%), Gaps = 4/378 (1%)

Query: 24  ESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFK 83
           ES  S++    ++P +G+ ++ Y D  L++E  +RGER+   +  +   +++Q++Y L K
Sbjct: 38  ESRDSSKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIK 97

Query: 84  NDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDII 143
              +T + + ++           K++++ R+YY D  G +RD   N++I  +P H +D++
Sbjct: 98  TKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMV 157

Query: 144 MSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFE 202
           M+ HL+NKHL  + ++  L  ++AN    +I    ++CS CN   K+ P K   +P +++
Sbjct: 158 MATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYD 217

Query: 203 KALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMI 262
           K LP+ERI IE+ EPF  E +EGKYS +++ +D+   F WL PLK+TKFK+++PV++ + 
Sbjct: 218 KLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLF 277

Query: 263 LSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXX-INRDLNDH 321
           LSF RVPI+V S+TLD  DL+DI E I +KYG++IGLG              I+  LN +
Sbjct: 278 LSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSY 337

Query: 322 HDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSS 381
            +ECL D+  CL+YGP ++N+ +     + P  ++        AKF  KR  +++++ S 
Sbjct: 338 KEECLADWGKCLRYGPYRFNRRRNKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSR 397

Query: 382 CVMNR--GMGTLYLESPN 397
            +     G G +YLE  N
Sbjct: 398 NMFKTAGGKGLIYLEDVN 415

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  254 bits (650), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/378 (35%), Positives = 220/378 (58%), Gaps = 4/378 (1%)

Query: 24  ESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFK 83
           ES  S++    ++P +G+ ++ Y D  L++E  +RGER+   +  +   +++Q++Y L K
Sbjct: 36  ESRESSKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIK 95

Query: 84  NDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDII 143
              +T + + ++           K++++ R+YY D  G +RD   N++I  +P H +D++
Sbjct: 96  TKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMV 155

Query: 144 MSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFE 202
           M+ HLMNKHL  + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++
Sbjct: 156 MATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYD 215

Query: 203 KALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMI 262
           K LP+ERI IE+ EPF  E +EGKYS +++ +D+   F WL PLK+TKFK+++PVV+ + 
Sbjct: 216 KLLPMERIHIEVFEPFNGEAIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLF 275

Query: 263 LSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXX-INRDLNDH 321
           L+F RVPI+V S+TLD  DL+DI E I +KYG++IGLG              I   LN +
Sbjct: 276 LTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSY 335

Query: 322 HDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSS 381
             ECL D+  CL+YGP ++N+ +     + P  ++        AKF  KR  +++++ S 
Sbjct: 336 KKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSR 395

Query: 382 CV--MNRGMGTLYLESPN 397
            +  M  G G +YLE  N
Sbjct: 396 NMFKMAGGKGLIYLEDVN 413

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  252 bits (644), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 155/464 (33%), Positives = 239/464 (51%), Gaps = 44/464 (9%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENI-A 93
           L+P IG+K+ +Y DE +D+ F +RGER+   +  T  G++++  Y L K + +T+E + A
Sbjct: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142

Query: 94  RLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHL 153
                D+    SR ++++ RRY  D  G +RD    NR+V +P+  +D+IM+ HL+N H 
Sbjct: 143 TALKMDKFRAASR-LVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHG 201

Query: 154 GSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITI 212
              + ++ L   Y+N     ++R  ++CSVCNPS +  P K       F+  LPLER+ +
Sbjct: 202 RPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQV 261

Query: 213 EIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWV 272
           E+ EPFP EK+ GKY  ++  +D+  RF W+ PL+N+KF ++V +++KMI S  R+PI+ 
Sbjct: 262 EVFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFF 321

Query: 273 ESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXX-XINRDLNDHHDECLFDFNN 331
           E+ T++  D FDIFE IV KY I IGLG              I + L  H +ECL D+  
Sbjct: 322 ETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIM 381

Query: 332 CLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTL 391
           CLKYGP  +N          P D+++     L  K   K   IL+  P+  ++  G G +
Sbjct: 382 CLKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKIGRGCI 441

Query: 392 YLESPNGIQXXXXXXXXXXXXXXXXXXXXXRDNSTREGSGNGEESDTEPAVDHSRRSKKK 451
           YLE  N                         D      +   +ESDTE  V+H R+  ++
Sbjct: 442 YLEDRN-----------------------PEDPEAEYEANTDDESDTEDNVEH-RQEDEE 477

Query: 452 KIAGVKEEPQRSFSPMKDSQRT---------LFEEDSEQNDSME 486
            I  +        SPM D+ RT           E+D+  ND+ E
Sbjct: 478 DIGAM-------MSPMIDNTRTEDELENGEKSHEDDNHSNDNEE 514

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  253 bits (645), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 127/367 (34%), Positives = 215/367 (58%), Gaps = 4/367 (1%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           ++P++G+ ++ Y D  L++E  +RGER+   +  +   +++Q++Y L K   +T E + +
Sbjct: 100 ILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQ 159

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
           +           K++++ R+YY D  G +RD   N++I  +P H +D++M+ HLMNKHL 
Sbjct: 160 ISDKYDGVAAENKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLR 219

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIE 213
            + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++K LP+ERI IE
Sbjct: 220 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 279

Query: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273
           + EP+  + +EGKY  +++ +D+   F WL PLK+TKFK+++PVV+ + LSF R+PI+V 
Sbjct: 280 VFEPYGGKAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVT 339

Query: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXX-INRDLNDHHDECLFDFNNC 332
           S+TLD  DL+DI E I +KYG++IGLG              I   LN + +ECL D+  C
Sbjct: 340 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 399

Query: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILK--HSPSSCVMNRGMGT 390
           L+YGP ++N+ +     + P  ++        AKF  KR  +++  ++ +   M  G G 
Sbjct: 400 LRYGPYRFNRRRNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGL 459

Query: 391 LYLESPN 397
           +YLE  N
Sbjct: 460 IYLEDVN 466

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  250 bits (639), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 128/367 (34%), Positives = 213/367 (58%), Gaps = 4/367 (1%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           ++P +G+ ++ Y D  L++E  +RGER+   +  +   +++Q++Y L K   +T + + +
Sbjct: 50  ILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQ 109

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
           +           K++++ R+YY D  G +RD   N++I  +P H +D++M+ HLMNKHL 
Sbjct: 110 ISDKYDGVVAENKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLR 169

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIE 213
            + ++  L   +AN    +I    ++CS CN   K+ P K   +P +++K LP+ERI IE
Sbjct: 170 GKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 229

Query: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273
           + EPF    +EGKY  +++ +D+   F WL PLK+TKFK+++PV++ + LSF RVPI+V 
Sbjct: 230 VFEPFTGGAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 289

Query: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXX-INRDLNDHHDECLFDFNNC 332
           S+TLD  DL+DI E I +KYG+ IGLG              I   LN + +ECL D+  C
Sbjct: 290 SSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKC 349

Query: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCV--MNRGMGT 390
           L+YGP ++N+ +     + P  ++        AKF  KR  +++++ S  +  M  G G 
Sbjct: 350 LRYGPYRFNRRRNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGL 409

Query: 391 LYLESPN 397
           +YLE  N
Sbjct: 410 IYLEDVN 416

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  245 bits (626), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 136/382 (35%), Positives = 213/382 (55%), Gaps = 7/382 (1%)

Query: 21  DRIESSFSTETNPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYA 80
           D+I   ++   +  L P +G+ +  YA+  +++E  +RGE+D+  Y  +  G++   +Y 
Sbjct: 26  DKILDEYNGVKSQFLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYE 85

Query: 81  LFKNDDVTKENIARLYPT-DRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHT 139
           L + + +T E +A      D+   ES K M++ RRYY + NG++RD    ++IV +P+  
Sbjct: 86  LIRTNSLTPETLASNSDKWDKDSAES-KYMFLMRRYYAE-NGIVRDRRKGDKIVCEPLCI 143

Query: 140 FDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP--KVQPK 197
           FD+IM  HLMN H+    +Y CL + Y+N     ++  + YCS CNP     P  K + K
Sbjct: 144 FDLIMCAHLMNDHMTYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHK 203

Query: 198 PYLFEKALPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPV 257
             +F+  LPLER+ IEI E F NE +  K++N++  +D+  RF WL PLKNTKFK++V  
Sbjct: 204 N-IFKGLLPLERVHIEIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSA 262

Query: 258 VAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXX-XXXXXXXINR 316
           V  ++L    VPI++ES+TLD  DLFDI E +  KY +K+GLG              + +
Sbjct: 263 VGTLLLGMTYVPIFMESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKK 322

Query: 317 DLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILK 376
            LN    +C+ D+N CL+YGP   N+         P D++ HS+   +  FR K+  I+ 
Sbjct: 323 LLNTRKVDCISDWNMCLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIID 382

Query: 377 HSPSSCVMNRGMGTLYLESPNG 398
             P+  V++   G LYLE  N 
Sbjct: 383 ELPAQNVVHVNKGLLYLEDENS 404

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  246 bits (627), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 130/362 (35%), Positives = 203/362 (56%), Gaps = 5/362 (1%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           L+P +G+ + +Y D ++D++  KRGE     +  +  G++ + +Y L +   +T+E +A 
Sbjct: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETLAA 151

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
            +P   +     +     RRY  D  G +RD    NRIV DP+  ++++M+CHLMN H  
Sbjct: 152 NFPHFHA---PTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKA-LPLERITIE 213
             R +  L   YAN     + + +++CSVCNPS  + P ++ K   + K  LPLER+ IE
Sbjct: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268

Query: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273
           I EPF  +K+EGKYS+++  +D+  R+  LEPLKNTKFKN+V  +AK++ + PR+PI++E
Sbjct: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328

Query: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXX-XXXXXXXINRDLNDHHDECLFDFNNC 332
           + +L+  D FDIFE IV KY I +GLG              +   L  H  ECL D+  C
Sbjct: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388

Query: 333 LKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTLY 392
           LKYGP  YN          P D+++ +   +  K   K   I++  P   ++  G G++Y
Sbjct: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQIGNGSIY 448

Query: 393 LE 394
           LE
Sbjct: 449 LE 450

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  216 bits (551), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 197/364 (54%), Gaps = 4/364 (1%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           +VP +  K+ +     +++   ++G  +   +  T  G+++Q++Y L ++D ++  N+ R
Sbjct: 39  IVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLER 98

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
            +       E       +R +  + NGM+ D   ++RIV +P   F ++M  HL N H+ 
Sbjct: 99  CHKWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVT 158

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY--LFEKALPLERITI 212
           S  ++R L + YAN     I   + YCS CNP LK  P  Q K +  ++ + LPLER+ I
Sbjct: 159 SYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKP-FQKKRHKNVYWELLPLERVHI 217

Query: 213 EIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWV 272
           E+ EPF  EK++G++S+++  +D+  R+ W+ PL+N K K+++  ++  +L  PR+PI++
Sbjct: 218 EVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFL 277

Query: 273 ESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXXINRD-LNDHHDECLFDFNN 331
           ES T+D   LFD+   I   Y +K+GLG               ++ L  H +ECL D+N 
Sbjct: 278 ESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNL 337

Query: 332 CLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTL 391
           CLKYGP   NQ   +     P D++  S      KF  KR  ++  +PS  V++ G G L
Sbjct: 338 CLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHLGEGVL 397

Query: 392 YLES 395
           +LE+
Sbjct: 398 FLEN 401

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  203 bits (517), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 210/412 (50%), Gaps = 25/412 (6%)

Query: 6   IRGFTEEFERNPYDVDRIESSFSTETNPKLVPVIGDKWSNY---ADEKLDIEFCKRGERD 62
           I GF    +R P     + S+     N  ++P + + + +Y    D  +D++F KRGE+D
Sbjct: 33  IDGFRAT-KRRPAGTSNMSSTELELYNKFVMPALDETYEDYLVGEDSTIDVDFLKRGEKD 91

Query: 63  ITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGM 122
           +  +A    G+++QE Y L  N+++T E + +            K   + +R+YKD  G 
Sbjct: 92  MRRFAEGLAGKLTQETYTLLMNNNLTMETVMKAMNIWPPNAAETKYSNLIKRFYKDKEGN 151

Query: 123 IRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCS 182
           IRDA ++N IV +P   F++I++ HL N HL +  +++CLRE YAN     ++  L YC+
Sbjct: 152 IRDAKVDNNIVLEPDKLFNLILTAHLKNGHLKTAVLFQCLREVYANCTRDFVQTALFYCN 211

Query: 183 VCNPSLKLTP--KVQPKPYLFEKALPLERITIEIIEPFPNE--------------KVEGK 226
            CNP   + P  KV+ +  + E+ LPLER+ IE+  PF  E              K+EGK
Sbjct: 212 RCNPDRYIKPIEKVRHRN-INEELLPLERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGK 270

Query: 227 YSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILS-FPRVPIWVESNTLDWSDLFDI 285
           YS++   +DF  R+ W  PLKN KFK +V  +A   ++     PI+VES+T+D  DL +I
Sbjct: 271 YSHVFYCRDFRTRYVWCFPLKNMKFKTLVDNIATFFMTVLYDPPIFVESSTIDRDDLKEI 330

Query: 286 FEMIVTKYGIKIGLG-CXXXXXXXXXXXXINRDLNDHHDECLFDFNNCLKYGPTKYNQIK 344
           FE++ +KYG+K+GLG                  L+    EC  D+  CLK G    N++ 
Sbjct: 331 FELLASKYGLKLGLGFANFTKFHAQGIKRFKTHLHRAKSECADDWLMCLKQGTYSANRVI 390

Query: 345 YLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMN--RGMGTLYLE 394
                K+   + +    Q +   R K+   ++ S S  +    +  G +++E
Sbjct: 391 ERQLGKASNILFTELMGQFERDMRKKKLKYIEQSFSENIKTYPKSGGCIFIE 442

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  200 bits (509), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 185/346 (53%), Gaps = 5/346 (1%)

Query: 37  PVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLY 96
           P +G     Y D    + F + G      Y  +  G +SQ +Y L ++D +  + ++   
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSEKT 105

Query: 97  PTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSE 156
              R  + + K +Y+ RRY     G + D T  N+IVY+P   +D I+S H++N+HLG +
Sbjct: 106 RWSRI-NANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 157 RVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYL--FEKALPLERITIEI 214
            +++ L+  Y+N     IK  L++CS CNP  K+ P ++   ++  +EK LPLER+ ++I
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPD-KVIPNLEKTVHMNIYEKYLPLERVQLDI 223

Query: 215 IEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVES 274
            EPF NEK++ +YS+++ ++D+  RF W+ PLKNTKFK +   +  ++L  PR+PI++++
Sbjct: 224 FEPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDT 283

Query: 275 NTLDWSDLFDIFEMIVTKYGIKIGLGCXX-XXXXXXXXXXINRDLNDHHDECLFDFNNCL 333
            T++  D+  I + I  KY I +G+G              +   LN++ D+CL D+N CL
Sbjct: 284 TTIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCL 343

Query: 334 KYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSP 379
           K G   YN+         P ++           F +KR  I+   P
Sbjct: 344 KLGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLP 389

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  201 bits (512), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 117/366 (31%), Positives = 192/366 (52%), Gaps = 9/366 (2%)

Query: 36  VPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARL 95
           +P +G+    Y +  L+ E   RG  D   Y  +  G+++QE + L ++  +T EN+   
Sbjct: 21  MPKVGETLEKYGN-GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMST 79

Query: 96  YPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGS 155
                SG+   K + + RR+Y DA+G +RD   ++ +V +P   FD+IM  HL N H+  
Sbjct: 80  SDKLHSGNIETKFLLLKRRFYVDADGTVRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHW 139

Query: 156 ERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPK-PYLFEKALPLERITIEI 214
            R++  LR  YAN      +  + YCS CNP   L P  + +   ++   LPLER+ +EI
Sbjct: 140 RRLHHYLRRKYANTTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEI 199

Query: 215 IEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVES 274
           I PFP + +EG YS+++ ++D+  RF W++PL + +   I       +LS PRVPI+VE+
Sbjct: 200 IAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVET 258

Query: 275 NTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXXINRDLNDHHDE-CLFDFNNCL 333
           +TL   DLF++ E I ++YG+ IGLG               R L   ++E CL  ++ CL
Sbjct: 259 STLKRQDLFEVCENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCL 318

Query: 334 KYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVM-----NRGM 388
           K+G T +N          P +++  + +    +F  KR  +++   +S V+      R  
Sbjct: 319 KFGVTNHNMTYNARVLGLPGNLLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRR 378

Query: 389 GTLYLE 394
           G +YLE
Sbjct: 379 GMIYLE 384

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  193 bits (491), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 110/362 (30%), Positives = 192/362 (53%), Gaps = 5/362 (1%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
           ++P IG K+ +     LD +  ++GE    A A ++   +S+ELY L KNDD+T++N+A 
Sbjct: 32  IIPRIGQKYDSLITPLLDKQLLQKGE---IAVANSKTNYLSKELYDLVKNDDLTRKNVAV 88

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
               D     +R ++ +  RYY+D+  M+ D +  N+IV DP H F ++M+ HL+N HL 
Sbjct: 89  ALNLDEKNAITR-LIPLKHRYYRDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHLT 147

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLK-LTPKVQPKPYLFEKALPLERITIE 213
              +YR L + +AN     IK ++EYCS+CN + K +  K +P+       L  ER+ ++
Sbjct: 148 RGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLILD 207

Query: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273
           ++ PF  +K++ +Y++++ + DF  +F W  PLKN K + I+  V + I++ P  P+++ 
Sbjct: 208 VVAPFGAKKIQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVFIS 267

Query: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXXINRDLNDHHDECLFDFNNCL 333
           S TL  +D+F++   +  +Y I IGLG             + R LN H  ECL  +  CL
Sbjct: 268 SFTLSLNDIFELCCYLAREYNISIGLGTRNMQKAYSKNPYVTRILNSHKTECLKSWFMCL 327

Query: 334 KYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNRGMGTLYL 393
           K+   + +  K+     +    +    T    K+  +   I+   PS   +N   G+ ++
Sbjct: 328 KWLADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINIDEGSHFI 387

Query: 394 ES 395
            S
Sbjct: 388 YS 389

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  191 bits (486), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/372 (31%), Positives = 193/372 (51%), Gaps = 21/372 (5%)

Query: 36  VPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARL 95
           +P +G+    Y +  L++E  +RG  D   Y  +  G+++Q+ + L ++  +T++N+   
Sbjct: 21  MPAVGEPIEKYHN-GLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTT 79

Query: 96  YPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGS 155
                +G+   K + + RRYY DA+G++RD   ++ +V +P   FD+IM  HL N HL  
Sbjct: 80  SDKLHAGNVETKFLLLKRRYYVDADGIVRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHW 139

Query: 156 ERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIEI 214
            R++  LR  YAN      +  ++YCS CNP  +L P K      ++   LPLER+ +EI
Sbjct: 140 RRLHSYLRHNYANTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEI 199

Query: 215 IEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVES 274
           I PF +E +EG YS+++  +D+  RF W++PLK    ++I   +   +L  PR+PI++E+
Sbjct: 200 ISPF-SEAIEGTYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIFIET 258

Query: 275 NTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXXXINRDLNDHHDE-CLFDFNNCL 333
           +T+D  DLF+  E +  +Y + IGLG               R L   ++E CL  +  CL
Sbjct: 259 STIDRQDLFEACEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCL 318

Query: 334 KYGPTKYN---QIKYLG-----FHKSPCDIISHSETQ---LKAKFRAKRAFILKHSPSSC 382
           KYG T +N     + LG      H + CD     E +   L  K  A+    +K      
Sbjct: 319 KYGATNHNLNYNARILGVPGNLLHSTVCDYGRQFELKREDLIEKLFARNVVEIK------ 372

Query: 383 VMNRGMGTLYLE 394
           V  R  G +YLE
Sbjct: 373 VSGRRRGIIYLE 384

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  191 bits (484), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 118/377 (31%), Positives = 201/377 (53%), Gaps = 14/377 (3%)

Query: 32  NPKLVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKEN 91
           N  + P +G+    Y+ + L++E  +RG RD   Y  +  G+++Q  Y L K D +T E 
Sbjct: 24  NDYVTPKLGESQVTYSTD-LNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLET 82

Query: 92  IARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNK 151
           +  +       +   K +++ RRYY D++ ++RD   ++ IV +P   +++I+S HL+N 
Sbjct: 83  LLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNN 142

Query: 152 HLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPK-PYLFEKALPLERI 210
           HL   +++R L+  Y+N     ++    YCS CNP  ++ P  + K    ++  LPLERI
Sbjct: 143 HLHWRKLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERI 202

Query: 211 TIEIIEPF-PNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVP 269
            +EI +PF  +E +E KYS+++  +D+  RF WL PL    F+ +VP + + +LS PR+P
Sbjct: 203 HVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLP 262

Query: 270 IWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXX-XXXXXXXINRDLNDHHDECLFD 328
           I++E+ TLD  D+FD+ E I  KY + IGLG              +   L  +  +C  D
Sbjct: 263 IFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKD 322

Query: 329 FNNCLKYGP----TKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKH--SPSSC 382
           +  CLKYG     T YN  + +GF     D++ +  +    KF+ KR  I+    + +  
Sbjct: 323 WGMCLKYGSYHNNTAYNP-RIMGFSN---DLLCNEVSSCGKKFKLKREKIIHELFAHNVV 378

Query: 383 VMNRGMGTLYLESPNGI 399
            +    G +Y+E+ N +
Sbjct: 379 TLKDTGGMVYVENENSV 395

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  189 bits (480), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 123/389 (31%), Positives = 191/389 (49%), Gaps = 17/389 (4%)

Query: 25  SSFSTETNPKLV-PVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFK 83
           S+ STE + K V PV G    ++  E LD +    G   +     T  G+++Q +Y L  
Sbjct: 47  STESTEPDFKFVLPVKGFDLGSFCGE-LDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLH 105

Query: 84  NDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDII 143
           +D +TKEN+ R      +     K + + RRYY   N ++ D    + +VY+P   FD+I
Sbjct: 106 SDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQEN-LLHDVKRKDLVVYEPNELFDLI 164

Query: 144 MSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSL-KLTPKVQPKPYLFE 202
           MS H++N H+ S+ +Y  L  FYAN      K    +CS CN S  K++ K      +  
Sbjct: 165 MSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHA 224

Query: 203 KALPLERITIEIIEPFPNE----------KVEGKYSNMVVMKDFIGRFEWLEPLKNTKFK 252
             +PL R  +EI  PF +           K+EGKY  ++  +D+  R+ WLEPLK+    
Sbjct: 225 NLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLS 284

Query: 253 NIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXXX 312
           +++PV+ K++ S  R+PI++++ TLD  D+FD+ E I   Y IKIGLG            
Sbjct: 285 DLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGI 344

Query: 313 XINRDLN-DHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKR 371
              + L   H +ECL D+N CLK   ++ NQ         P D++  ++  L  KFR  +
Sbjct: 345 KRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQQDLHKKFRTLQ 404

Query: 372 AFILKHSPSSCVMN--RGMGTLYLESPNG 398
             ++       V+      G +YLE  N 
Sbjct: 405 RNVISRLLGHHVVQFEEAGGMIYLEDENS 433

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  184 bits (466), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 107/355 (30%), Positives = 190/355 (53%), Gaps = 8/355 (2%)

Query: 47  ADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESR 106
           ++  L+ E   RG +D+  +  T  G +SQ +Y L   D +T + ++R      +   + 
Sbjct: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR-EKVKWANKSNE 131

Query: 107 KMMYITRRYY-KDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREF 165
           K  ++  RYY  D    +RD   +++I+  P    ++++  HL+N+H   + V+R L + 
Sbjct: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191

Query: 166 YANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIEIIEPFPNEK-V 223
           YAN    + + +L YCS CNPS  + P K   K  ++E  LP ERI IEI +PF +EK +
Sbjct: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251

Query: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283
           EG YS+++ ++D+  R+ WL PLK T FK +   +     +  + PI++ES+T++ +DL 
Sbjct: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311

Query: 284 DIFEMIVTKYGIKIGLGCXXXXX-XXXXXXXINRDLNDHHDECLFDFNNCLKYGPTKYNQ 342
            + + I  KY ++IG+G              + + L  H DECL D+  CLKYG   +N 
Sbjct: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371

Query: 343 IKYLGFHKSPCDIISHSE-TQLKAKFRAKRAFILKHS--PSSCVMNRGMGTLYLE 394
           +K       P +++ +S  ++   K+++K+  ++  +   +  V++ G   +YLE
Sbjct: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLE 426

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  173 bits (439), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/404 (29%), Positives = 199/404 (49%), Gaps = 18/404 (4%)

Query: 10  TEEFERNPYDV----DRIESSFS----TETNPKLVPVIGDKWSNYADEKLDIEFCKRGER 61
           ++E   NPYD     D  ES F     TE   K VP         A E LD ++   G  
Sbjct: 4   SDEMLLNPYDAQVGSDGSESFFVFQKITEEGFK-VPRFDLNVYQLAPE-LDHDWLDTGRN 61

Query: 62  DITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRKMMYITRRYYKDANG 121
           ++     T  G+++Q++Y L  ++ ++ + +        +G    K + + RRY     G
Sbjct: 62  ELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRY-SILQG 120

Query: 122 MIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTLEYC 181
            + D    +  V +P   FD+IM+ HL+N HL   ++++ L+  YAN           YC
Sbjct: 121 NVVDHKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYC 180

Query: 182 SVCNPSLKLTPKVQPKPY-LFEKALPLERITIEIIEPFP---NEKVEGKYSNMVVMKDFI 237
           S CN    +   ++ K Y +++K +PLER  +EI  PF    NEK+E KYS+++  +D+ 
Sbjct: 181 SHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYH 240

Query: 238 GRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLFDIFEMIVTKYGIKI 297
            RF W+ PL+   F+++VP + +++ S  R+PI++E+ TLD  D+FD+ E I  KY +KI
Sbjct: 241 SRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKI 300

Query: 298 GLGCXXXXX-XXXXXXXINRDLNDHHDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDII 356
           GLG              I     +H ++C+ ++N CL+   T+ NQ         P D++
Sbjct: 301 GLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLL 360

Query: 357 SHSETQLKAKFRAKRAFILKHSPSSCVMN--RGMGTLYLESPNG 398
            +  + +  KF+ K+  I+    +  V+      G +YLE  N 
Sbjct: 361 CNEISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  167 bits (422), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 98/314 (31%), Positives = 164/314 (52%), Gaps = 6/314 (1%)

Query: 48  DEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESRK 107
           D  L+ E+  RG  ++     T  G+++QE+Y L  +D ++ + +              K
Sbjct: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENK 101

Query: 108 MMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYA 167
            + + RRY     G++ D    +  V +P   FD+IMS HL+N H+   +VY+ ++  YA
Sbjct: 102 YVLLKRRYVAKG-GIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYA 160

Query: 168 NGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPY-LFEKALPLERITIEIIEPFPNE---KV 223
           N    L      YCS CN    +    + K Y + EK +PLER  +E+  PF +E   K+
Sbjct: 161 NVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKI 220

Query: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283
           +GKYS+ +  +D+  RF WL PL+   F+ ++P +A+++ +  RVPI++E+ TLD  D+F
Sbjct: 221 QGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMF 280

Query: 284 DIFEMIVTKYGIKIGLGCXXXXX-XXXXXXXINRDLNDHHDECLFDFNNCLKYGPTKYNQ 342
           DI E+I  +Y  KIGLG              + + L+++ +EC  D+N CL+   ++ NQ
Sbjct: 281 DICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQ 340

Query: 343 IKYLGFHKSPCDII 356
                    P D++
Sbjct: 341 TYADRVRGIPSDLL 354

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  145 bits (366), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 107/367 (29%), Positives = 180/367 (49%), Gaps = 21/367 (5%)

Query: 39  IGDKWSNYADEK---LDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARL 95
           +G  +++Y DEK   ++IE  ++G +D+  Y   +   ++QE   +     ++ ENI + 
Sbjct: 35  LGISYTDYLDEKNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPENIIK- 93

Query: 96  YPTDRSGDES--RKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHL 153
           Y T  +       K  + +RRYY + +  I D     RI+ +P + +DI+++ HL  K  
Sbjct: 94  YDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRIICEPKYMYDIVIAYHL--KLH 151

Query: 154 GSERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKA--------- 204
            S  V   L++F++N G   I    +YCS C P      K+      F+           
Sbjct: 152 SSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNIIDRPL 211

Query: 205 LPLERITIEIIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILS 264
            P+ERI IEI  PF + K+E KY  ++ ++D+  R+ W   LK  K K+I  ++ +  LS
Sbjct: 212 FPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILTEFFLS 271

Query: 265 FP-RVPIWVESNTLDWSDLFDIFEMIVTKYGIKIGLGCXXXXXXXXXX--XXINRDLNDH 321
               VPI+++S+T+D +DLFDI E I  +Y I +GLG                 + +N +
Sbjct: 272 IATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQLVNLN 331

Query: 322 HDECLFDFNNCLKYGPTKYNQIKYLGFHKSPCDIIS-HSETQLKAKFRAKRAFILKHSPS 380
             +CL  ++N L +G   +N          P DII+ ++  Q K KFR +R  I+K + +
Sbjct: 332 KSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRIIKQTIT 391

Query: 381 SCVMNRG 387
              +  G
Sbjct: 392 DNYVKLG 398

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  136 bits (342), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 95/359 (26%), Positives = 169/359 (47%), Gaps = 18/359 (5%)

Query: 51  LDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDV---TKENIARLYPTDRS---GDE 104
           +DIE    G  D           ++Q++Y L +  +    T E   + + TD     G  
Sbjct: 39  IDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGTA 98

Query: 105 SRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLRE 164
           ++K M +  RY  +  G I D   + +++  P   +D+IM CH +N HLGS +++  LRE
Sbjct: 99  NKKFMLMEDRYQLNELGQITDKRNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLRE 158

Query: 165 FYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPKPYLFEKALPLERITIEIIEPFPN-EKV 223
            Y+N    L++ +L+ CS CNP          + +  +K    E+I +EI +PF + +  
Sbjct: 159 KYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNFAFEKIHVEIFQPFEDVDTF 218

Query: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283
             K+S+++ ++D+  R+ WL PL+    K +   +A  +L   R+PI++ES TLD S+L 
Sbjct: 219 ANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLL 278

Query: 284 DIFEMIVTKYGIKIGLGCXXXXXXXXXXXXINRDLNDHHDE-CLFDFNN----CLKYGPT 338
            I + I     + +G+G               ++L   + E C  ++N     C  +  T
Sbjct: 279 KILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNT 338

Query: 339 KYNQIKYLGFHKSPCDIISHSETQLKAKFRAK--RAFILKHSPSSCVMNRGMGTLYLES 395
            YN+  Y G    P ++++         ++ K  R  +L  S ++ ++  G   LY ES
Sbjct: 339 TYNKWIY-GI---PLNLMAQETLADNKTYKKKRQRTILLTLSKNTILLKNGKSALYKES 393

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  132 bits (331), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 81/265 (30%), Positives = 143/265 (53%), Gaps = 12/265 (4%)

Query: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94
             P IGD    Y D  +D +  KRGE++   +  T    ++ +LY   +++ + +++   
Sbjct: 29  FCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAP- 87

Query: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154
             P       S+KM Y+  RY K+++G + + T  N+++ +P + + + M  H MN H+ 
Sbjct: 88  -IPASLKIKTSKKM-YLQIRYSKNSDGDLIE-TKTNKLLCEPKYIYKLTMKAHFMNNHMR 144

Query: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKL----TPKVQPKPYLFEKALPLERI 210
           S ++YR L   Y N   LL+   L+YCS CN + K+    +   Q   Y+    LPLER+
Sbjct: 145 SNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYI--DYLPLERL 202

Query: 211 TIEIIEPFPNE--KVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRV 268
            I+I +PF +   K+  KYS++++++D+  R+ W+ PLK+   KNI   + K +++ PR 
Sbjct: 203 QIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRT 262

Query: 269 PIWVESNTLDWSDLFDIFEMIVTKY 293
           PI++ S  +  S L  I   I+ +Y
Sbjct: 263 PIFLHSIGIPESQLIKILTKILLEY 287

>TPHA0H00240 Chr8 (40339..42828) [2490 bp, 829 aa] {ON} 
          Length = 829

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 55/124 (44%), Gaps = 23/124 (18%)

Query: 1   MTPRVIRGFTEEFERNPYDVDRIESSFST----ETNPKLVPVIG-------DKWSNYADE 49
           + PR  RG    +E+  +      +SFST    E+NP     +          W+N+   
Sbjct: 279 IMPRYSRGDGVWYEKGSFPT--AFTSFSTYSDYESNPSETAFVDFTYDVKKSIWTNWNSI 336

Query: 50  KLDIEFCKRG-------ERDITAY---APTQPGRMSQELYALFKNDDVTKENIARLYPTD 99
              I   KRG        + +TA    A  +  +++  ++ +FKNDDV+KE + +L+   
Sbjct: 337 SDLIPSWKRGIIISMSDHQLVTALKWLAAARHAKVTLPIFFMFKNDDVSKETMHKLHRVA 396

Query: 100 RSGD 103
           RS D
Sbjct: 397 RSYD 400

>NDAI0A04130 Chr1 (934094..935164) [1071 bp, 356 aa] {ON} Anc_5.515
           YDR414C
          Length = 356

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 34/67 (50%), Gaps = 7/67 (10%)

Query: 119 ANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREFYANGGPLLIKRTL 178
           A  +I      + ++ +PI  FD+ ++   +       R+++CLRE+Y  G   ++   +
Sbjct: 170 AKPLIDFTLFTSLLISEPITHFDLFIASLPV-----LIRIFQCLREYYIAGNKSMLANAM 224

Query: 179 EYCSVCN 185
           +YC  CN
Sbjct: 225 KYC--CN 229

>SAKL0E13442g Chr5 (1110895..1113387) [2493 bp, 830 aa] {ON} similar
           to uniprot|P40164 Saccharomyces cerevisiae YNL201C PSY2
           Nuclear protein of unknown function deletion results in
           sensitivity to anticancer drugs oxaliplatin and
           cisplatin but not mitomycin C deletion is synthetically
           lethal with a chitin synthase (CHS1) null mutant
          Length = 830

 Score = 30.8 bits (68), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 106 RKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLM---NKHLGSERVYRCL 162
           ++M+Y+ +  Y        D TMN+ +V +  HT DI +S + +    KH   +R +  +
Sbjct: 738 KEMIYMAKEDYASLKEQDHDVTMNSSLVGE--HTVDIEVSENTIVTVGKHKEVKRTFSQV 795

Query: 163 REFYANGGPLLIKRTLEYCSVCNPSLKLTPKVQPK 197
           +E       L  KR ++  S  +P   ++ ++  K
Sbjct: 796 QETGNTEESLTFKRAMDRLSAVSPPASISEEMTEK 830

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,195,985
Number of extensions: 2602417
Number of successful extensions: 9240
Number of sequences better than 10.0: 69
Number of HSP's gapped: 9533
Number of HSP's successfully gapped: 69
Length of query: 519
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 405
Effective length of database: 40,409,475
Effective search space: 16365837375
Effective search space used: 16365837375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)