Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032308.265ON28128112860.0
ZYRO0C01584g8.265ON2821931843e-15
TDEL0F039208.265ON3222601732e-13
Suva_2.2738.265ON3762921696e-13
Smik_4.3588.265ON3712951634e-12
KLLA0F19206g8.265ON2632101597e-12
YDR113C (PDS1)8.265ON3732991601e-11
SAKL0H16962g8.265ON3362611457e-10
Skud_4.3748.265ON3732941422e-09
AGR083W8.265ON2952381332e-08
Kpol_543.418.265ON3062191271e-07
NCAS0B038308.265ON3252581235e-07
KAFR0B055108.265ON2753061041e-04
Ecym_43058.265ON3111291041e-04
KLTH0G13618g8.265ON302229986e-04
Kwal_56.237818.265ON293221950.001
NDAI0J013508.265ON422146950.002
TPHA0A017808.265ON352264940.002
TBLA0E044608.265ON277139910.004
CAGL0C05599g2.2ON1034140721.6
Kwal_47.184505.567ON37040666.8
NOTE: 1 genes in the same pillar as KNAG0H03230 were not hit in these BLAST results
LIST: CAGL0L12298g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03230
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...   499   0.0  
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...    75   3e-15
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...    71   2e-13
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...    70   6e-13
Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...    67   4e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    66   7e-12
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...    66   1e-11
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...    60   7e-10
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...    59   2e-09
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    56   2e-08
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    54   1e-07
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...    52   5e-07
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    45   1e-04
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    45   1e-04
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    42   6e-04
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    41   0.001
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    41   0.002
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    41   0.002
TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {...    40   0.004
CAGL0C05599g Chr3 complement(538455..541559) [3105 bp, 1034 aa] ...    32   1.6  
Kwal_47.18450 s47 (830833..831945) [1113 bp, 370 aa] {ON} YML027...    30   6.8  

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score =  499 bits (1286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/281 (91%), Positives = 256/281 (91%)

Query: 1   MQDNEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNN 60
           MQDNEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNN
Sbjct: 1   MQDNEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNN 60

Query: 61  ASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSK 120
           ASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSK
Sbjct: 61  ASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSK 120

Query: 121 SVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQNRELEIRPQAQDE 180
           SVTKRLLLDEEIAKNSS          ILKIRSQLGGGLDRLVRQSQNRELEIRPQAQDE
Sbjct: 121 SVTKRLLLDEEIAKNSSDGDDDGDDTDILKIRSQLGGGLDRLVRQSQNRELEIRPQAQDE 180

Query: 181 LPYIPDGHIILHEADIAKLRDYAPRXXXXXXXXXXXXXXXKRQADGSSLQLLELEDIPDG 240
           LPYIPDGHIILHEADIAKLRDYAPR               KRQADGSSLQLLELEDIPDG
Sbjct: 181 LPYIPDGHIILHEADIAKLRDYAPRDIMIDDSGADDTDDDKRQADGSSLQLLELEDIPDG 240

Query: 241 PEHTQPEVHLNTLDRFPQIAGSEDWENGLTNDDIEDLINGI 281
           PEHTQPEVHLNTLDRFPQIAGSEDWENGLTNDDIEDLINGI
Sbjct: 241 PEHTQPEVHLNTLDRFPQIAGSEDWENGLTNDDIEDLINGI 281

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score = 75.5 bits (184), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 70/193 (36%), Positives = 98/193 (50%), Gaps = 20/193 (10%)

Query: 10  AVAVPQTPASNILDGSGVVLKPV-GSRGKQSFSVRKSPTRGGR-LPLASKDNNASGLVVS 67
           ++A+PQTP   +      VLKP   +  K+S SV  SP RG R LPLASKD+N S     
Sbjct: 22  SLALPQTPIHLLKRSQPNVLKPEENTPVKKSRSV--SPVRGQRRLPLASKDHNKSSAAGP 79

Query: 68  GKLGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSKSVTKRLL 127
            K  RQP  Q    ++ RKL++YGS+LGY +  L R+KSL+LKD +  ++  +     L 
Sbjct: 80  VK-KRQPTLQGELLSNPRKLQKYGSVLGYTD--LPRTKSLVLKDGDDEDDDEEEENSELQ 136

Query: 128 LDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQNRELEIRPQAQDELPYIPDG 187
              + A N                     GGL +LVR +++ ++E  P     L Y PDG
Sbjct: 137 KKLQDAMNRREDSNEGL------------GGLAKLVRDTKD-DIEYAPHRLPPLEYAPDG 183

Query: 188 HIILHEADIAKLR 200
           H    + DI KL+
Sbjct: 184 HTRWEDEDIVKLK 196

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score = 71.2 bits (173), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/260 (30%), Positives = 113/260 (43%), Gaps = 73/260 (28%)

Query: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVR------- 43
           M  NE+KEN           V+ PQTPA  +      ++KP G     + + R       
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSGEENPSNLTYRDCDAPVK 60

Query: 44  -KSPTR---GGRLPLASKDNN-ASGLVVSGKLGRQPADQVREANSS-------------- 84
             SP+R    GR PLASKDNN ++G +   +  +Q     R  + S              
Sbjct: 61  RASPSRRVQQGRPPLASKDNNRSTGFLPQLQKLQQQPSLKRNLSQSKKRNANVVDGQLLT 120

Query: 85  --RKLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSKSVTK--------RLLLDEEIAK 134
             R+LK+YGS+LGY+   L + KSL+LKD +   E  +            RL L   I +
Sbjct: 121 NPRRLKKYGSVLGYN--ALPKMKSLVLKDVDQVGEQGEDENDDEDEDHILRLKLHNAIDR 178

Query: 135 NSSXXXXXXXXXXILKIRSQLGG-----GLDRLVRQS-------QNRELEIRPQAQDELP 182
           +                  ++GG     GL  LVR S       ++RE+E  PQ  + LP
Sbjct: 179 SDEEG-------------EEVGGLFDKSGLLHLVRDSKKDEDDWEDREIEYGPQRHEPLP 225

Query: 183 YIPDGHIILHEADIAKLRDY 202
           YIP+GH+ L + D  KL+ +
Sbjct: 226 YIPEGHLSLAQEDYDKLKTF 245

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score = 69.7 bits (169), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 118/292 (40%), Gaps = 94/292 (32%)

Query: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKP----------VGSRGKQSF 40
           M  NEDKEN          + + PQTPA  +      VLKP          V S   ++ 
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 41  SVRK-----SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69
              +     SPT+         GRLPLA+KDNN S   V                     
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 70  LGRQPADQVREA----------------NSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113
           L  +  DQ+R+                 N+SRKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYN--ALPKMKSLVLKDLA 178

Query: 114 AP---------NESSKSVTKRLL--LDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRL 162
            P         ++ S+    +L   L     +  S          I    +Q  GGL +L
Sbjct: 179 DPAKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQ--GGLQQL 236

Query: 163 VRQS------------QNRELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
           ++ +             + ++EI PQ Q+ LPY+PDG+    + DI KL+ +
Sbjct: 237 IKNTAKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTF 288

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score = 67.4 bits (163), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 82/295 (27%), Positives = 120/295 (40%), Gaps = 100/295 (33%)

Query: 1   MQDNEDKENAVA----------VPQTPASNILDGSGVVLKP----------VGSRGKQSF 40
           M  NEDKEN +            PQTPA  +      VLKP          V S    + 
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 41  SVRK-----SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69
              +     SPT+         GRLPLA+KDNN +   +                     
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 70  LGRQPADQVRE----------------ANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113
           L  +  DQ+R+                 N++RKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYN--ALPKMKSLVLKDLV 178

Query: 114 APNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQ---------LG-----GGL 159
            P ++ +S       D++ ++ S           +L+  S          +G     GGL
Sbjct: 179 DPGKNEESSD-----DDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGL 233

Query: 160 DRLVRQS-QNR-----------ELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
            +L++ S QN            E+EI PQ  D LPY+PDG+    + DI KL+ +
Sbjct: 234 QQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSF 288

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 65.9 bits (159), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 103/210 (49%), Gaps = 35/210 (16%)

Query: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNNASG 63
           NE KEN ++V Q P +++       L+   ++ K++ S+     RG R PLASKDNN + 
Sbjct: 3   NEGKENIISV-QDPDNDL------GLRTPLNQMKRTDSL----VRGNRRPLASKDNNRTQ 51

Query: 64  LVVSGK----LGR------QPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113
            ++S K    LG+      +PA    +     KLK+YGS+LG  N  + R+KSL+LKD E
Sbjct: 52  SILSVKNNAALGKSDHPLKRPASSFMKNMPENKLKKYGSVLGM-NTFMPRTKSLVLKDTE 110

Query: 114 APNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQNR-ELE 172
              ++     +    D  I  +               +    G GL  L+R+ ++   +E
Sbjct: 111 LNEKNDDEDEEDEEDDLPIFPSGKS------------LNLGFGNGLKALIREKEDELNIE 158

Query: 173 IRPQAQDELPYIPDGHIILHEADIAKLRDY 202
             P+ Q ELPYIP+G+    +  I KL+ +
Sbjct: 159 YAPKRQKELPYIPNGYDPFDKESIEKLQHH 188

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score = 66.2 bits (160), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 86/299 (28%), Positives = 119/299 (39%), Gaps = 107/299 (35%)

Query: 1   MQDNEDKENAVA----------VPQTPA-------SNIL--------------DGSGVVL 29
           M  NEDKEN +            PQTPA       SNIL                +G  L
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 30  KPVGSRGKQSFSVRKSPTRG---GRLPLASKDNNASGLVVSGKLGRQPAD---------- 76
           K +   GK+    ++  T     GRLPLA+KDNN S   +  +   Q  D          
Sbjct: 62  KYIQG-GKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIFPETSNQSKDADLPQLQNTL 120

Query: 77  ------QVRE----------AN------SSRKLKRYGSLLGYDNRQLTRSKSLILKD--P 112
                 Q+R+          AN      +SRKL++YGS+LGY+   L + KSL+LKD   
Sbjct: 121 SIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYN--ALPKMKSLVLKDLAD 178

Query: 113 EAPNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLG--------------GG 158
              NE S         D+E  ++S           +LK  S  G              GG
Sbjct: 179 SGKNEESSD-------DDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGG 231

Query: 159 LDRLVRQSQNRE---------------LEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
           L +L++ S   E               +EI PQ Q+ LPY+P+G+    + DI KL+ +
Sbjct: 232 LQQLIKNSTKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTF 290

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score = 60.5 bits (145), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 115/261 (44%), Gaps = 71/261 (27%)

Query: 1   MQDNEDKENAVA----VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTR--GGRLPL 54
           M+ +E+KEN +     +P TP S++L  S   +KP+ S          SPT+  G RLPL
Sbjct: 1   MRTHENKENVIFSSENLPTTP-SHLLKRSQSFMKPLASN---------SPTKKSGKRLPL 50

Query: 55  ASKDNNASGLVVS-------------------GKLGRQ-----PADQVREANSSR----- 85
           ASKDNN S  +++                   GKL R              N+S+     
Sbjct: 51  ASKDNNKSNTLINNGQKSALVNLAPNNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPL 110

Query: 86  ----KLKRYGSLLGYDNRQLTRSKSLILKDPEAPNESSKSVTKRLLLDEEIAKNSSXXXX 141
               +LK+YGS+LGY+   L R KSL+LKD +   +  KS       +++  +       
Sbjct: 111 LPDSRLKKYGSVLGYNG--LPRVKSLVLKDVDE-RKVGKSEEGEEEEEDDDEEEEEDNPL 167

Query: 142 XXXXXXILKIRSQ----------LGG--GLDRLVR-------QSQNRELEIRPQAQDELP 182
                  L   ++          LG   GL +L++       ++ + E+EI P   +ELP
Sbjct: 168 AAKLLKALNNHNEDDKEEGSIGLLGSNTGLQQLLKHRNVEEGENSDFEIEIVPPHSEELP 227

Query: 183 YIPDGHIILHEADIAKLRDYA 203
           ++P+G+    E+D+ KL  + 
Sbjct: 228 HVPNGYSPFKESDVIKLNTFT 248

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score = 59.3 bits (142), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 82/294 (27%), Positives = 114/294 (38%), Gaps = 96/294 (32%)

Query: 1   MQDNEDKEN----------AVAVPQTPASNILDGSGVVLKPV-----------GSRGKQS 39
           M  NEDKEN           +  PQTPA  +      VLKP             + GK  
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 40  FSVRK----SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69
             ++     SPT+         GRLPLA+KDNN S   V                     
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 70  LGRQPADQVREA----------------NSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113
           L  +  DQ+R+                 N+SRKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYN--ALPKMKSLVLKDLA 178

Query: 114 APNESSKSVTKR-----------LLLDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRL 162
            P ++ +S               + L     +  S          I    +Q  GGL +L
Sbjct: 179 GPAKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQ--GGLQQL 236

Query: 163 VRQSQN--------------RELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
           ++ +                 E+EI PQ Q+ LPY+PDG+      DI KLR +
Sbjct: 237 IKNTTKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTF 290

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 92/238 (38%), Gaps = 63/238 (26%)

Query: 1   MQDNEDKENAVA-------VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLP 53
           M+ +EDKEN V        +P+TP   +             R   + + R S     R+P
Sbjct: 1   MKKHEDKENLVTSAGRGAMMPRTPIHQL------------KRSSSNLAGRNST----RMP 44

Query: 54  LASKDNNASGLVVSGKLGRQPADQVREANSSR-------------KLKRYGSLLGYDNRQ 100
           LASKD N S  V   K          +A S R             KLK+YGS+LG     
Sbjct: 45  LASKDRNQSQGVFGLKTSGAGGAGGAQAQSKRPASSSIAKNMPDSKLKKYGSVLGVGYGS 104

Query: 101 LTRSKSLILKDPE------------APNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXI 148
           L ++KSL+LKD                N  +  +  RL   EE                 
Sbjct: 105 LAKAKSLVLKDTSDCESANEESEEEEGNPLAAKLKSRLCSAEEGGNEDDGSSGLL----- 159

Query: 149 LKIRSQLGGGLDRLVRQSQNRE----LEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
                 LG  L +L    + +E    +E  P+   ELP++P+G+  L  AD+AKL  Y
Sbjct: 160 ------LGEALSQLAAAGETQEDVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKY 211

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 53.5 bits (127), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 96/219 (43%), Gaps = 40/219 (18%)

Query: 13  VPQTPASNILDGSGVVLKPVGSRGKQSFSV-RKSPTRGGRLPLASKDNNASG-------- 63
           +PQTP +N+L  +   LK   ++  Q  +V   SP +  RLPLASKDNN S         
Sbjct: 18  MPQTP-NNLLKRTHSKLKTGIAKDIQGGNVINTSPQK--RLPLASKDNNRSNSFLNNSNV 74

Query: 64  ------------LVVSGKLGRQPADQVREANSS------RKLKRYGSLLGYDNRQLTRSK 105
                          +          + + N S      RKLK+YGS+LGY+   L + K
Sbjct: 75  NLNFNINNNNNNNNNNINNNNIKKQHIFQQNKSGILADDRKLKKYGSVLGYN--ALPKVK 132

Query: 106 SLILKDPEAPNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQ 165
           SL+LKD     +    +    L  + + K S           +L      GG L +L+R 
Sbjct: 133 SLVLKDISDNEDDDDDLLSLKLR-DSMNKKSINTNKSNSGIGLLS-----GGNLQQLIRD 186

Query: 166 SQN--RELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
           +    RE+E +  A  +  YIPD H+   E DIAKL+ +
Sbjct: 187 ANEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTF 225

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score = 52.0 bits (123), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/258 (27%), Positives = 102/258 (39%), Gaps = 70/258 (27%)

Query: 1   MQDNEDKENAVA-------------VPQTPASNILDGS-GVVLKPVGSRGKQSFSVRKSP 46
           +  NEDKEN                +P+TPA  +L  S   VLKP             SP
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKPNSVNATDELG-NISP 61

Query: 47  TR------GGRLPLASKDNNASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYDNRQ 100
            R        RLPLA KDNN S    S K G          N+ +KLK+YGS+LG D   
Sbjct: 62  RRRQLLQLQNRLPLAKKDNNNSSFS-SRKNG---------LNNIKKLKKYGSVLGMD--A 109

Query: 101 LTRSKSLILKDPEAPNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLG---- 156
           L R+KSLILKD +   +  +          ++ +N+             +  S LG    
Sbjct: 110 LPRTKSLILKDVDDKPDDDEEDEDDNAFGLKL-RNAMKQHENNSNEEENEGMSGLGIGLF 168

Query: 157 -----------GGLDRLVRQS---------------------QNRELEIRPQAQDELPYI 184
                      GGL +L+R++                      +RE+E  P  ++ LP++
Sbjct: 169 HDNEDNSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFV 228

Query: 185 PDGHIILHEADIAKLRDY 202
           P G+      DI KL+ +
Sbjct: 229 PFGYTPFTPEDINKLKTF 246

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 127/306 (41%), Gaps = 62/306 (20%)

Query: 1   MQDNEDKENAVA-VP----QTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTR----GGR 51
           M +  DKEN ++ +P    QTP +N +              K + S R SP +     G+
Sbjct: 1   MSNQSDKENNLSTIPVLALQTPNTNFV-------------KKNTTSTRISPLKRLQQQGK 47

Query: 52  LPLASKDNNASGLVVSGKLGRQPADQVREANSSRKLKRYGSLLGYDN---RQLTRSKSLI 108
           LPL SK+ N S  ++           +    ++ ++K+YGS+LG +N    +L ++KSLI
Sbjct: 48  LPLQSKNGNKSNSIL-----------ISHKGNNTRIKKYGSILGLENPGNFKLPKTKSLI 96

Query: 109 LKDPEAPNESSKSVTKRLLLDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQN 168
           LKD E+     +       L E ++++ +           L  +          +    +
Sbjct: 97  LKDNESSESEEEDGLLNRKLKEALSRSQNDEDREGDGSVGLFAKE----AFQNHISNDDD 152

Query: 169 RELE-IRPQAQD-ELPYIPDGHIILHEADIAKLRDYAPRXXXXXXXXXXXXXXXKRQADG 226
            E++ I  + +D EL YIPD + ++   +I KL+                        + 
Sbjct: 153 SEIDIINGKEKDVELSYIPDHYEVIAADEIEKLK------QVNLGTRFKSSASSGLNDND 206

Query: 227 SSLQLLELEDIPDGPEHTQPEVHLNTLDRFPQIA--------------GSEDWENGLTND 272
           S++Q LELE + D       +   N ++R  + +              G++   +GL +D
Sbjct: 207 STIQFLELEHVSDSDTEENIDPSYNGVNRIGKNSTKSKSIDFDITEEIGTKYAGSGLDDD 266

Query: 273 DIEDLI 278
           DIE ++
Sbjct: 267 DIEAML 272

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (46%), Gaps = 26/129 (20%)

Query: 1   MQDNEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLPLASKDNN 60
           M+ +EDKEN       P  +   GS V   P+    + + +V        RLPLASKD N
Sbjct: 1   MKKHEDKEN------IPTGSEPSGSIVPRTPMHQLKRSTSNVHLK--NNSRLPLASKDRN 52

Query: 61  --ASGLVVSGKL---------------GRQPADQVREANS-SRKLKRYGSLLGYDNRQLT 102
              SG  +  +L                ++PA      N    KLK+YGS+LG +   LT
Sbjct: 53  RSQSGFNLKQQLVQGHVGGGVMVGQNKSKRPASNSFVKNMPDSKLKKYGSVLGVNYPHLT 112

Query: 103 RSKSLILKD 111
           ++KSL+LKD
Sbjct: 113 KTKSLVLKD 121

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 42.4 bits (98), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 68/229 (29%), Positives = 98/229 (42%), Gaps = 39/229 (17%)

Query: 1   MQDNEDKENAVA----VPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRG-GRLPLA 55
           M  +EDKEN++     VP TP  ++L  S            QSF   KSP R   R PLA
Sbjct: 1   MGRHEDKENSIWSESNVPVTP-RHLLSRS------------QSFMKNKSPKRAEARRPLA 47

Query: 56  SKDNNASGLVVSGK--LGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113
           SKDNN S   +  K  L ++    V  A S     R G     +     + KSL+LKD  
Sbjct: 48  SKDNNRSVSYLGTKEPLRKRTRPGVNHAGSFVGNARLGPAPTLNASGAPKIKSLVLKD-G 106

Query: 114 APNESSKS-----------VTKRLLLDEEIAKNSSXXXXXXXXXXILK----IRSQLGGG 158
              E S+S            + RL         S           +L     ++S LG  
Sbjct: 107 IEEEGSQSEGAEVDEDDDDDSNRLAAKLRTKLLSRDRDAEGEQTGLLGATGGLQSLLGPK 166

Query: 159 LDRLVRQS-QNRELEIRPQAQDELPYIPDGHIILHEADIAKLR--DYAP 204
           L +   +S  ++E+E+ P   + LP++P+G+    E +IAKL+  D +P
Sbjct: 167 LSQRAEESDSDQEVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSP 215

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 95/221 (42%), Gaps = 34/221 (15%)

Query: 1   MQDNEDKENAV----AVPQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRG-GRLPLA 55
           M   E+KENA+    +VP TP +++L  S            QSF    SP R   R PLA
Sbjct: 1   MGARENKENAIWSERSVPVTP-THLLSRS------------QSFMKNISPKRAEQRKPLA 47

Query: 56  SKDNNASGLVVSGK--LGRQPADQVREANSSRKLKRYGSLLGYDNRQLTRSKSLILKDP- 112
           SKDNN S   +  K  L ++    V  A S     R G +   +     R KSL+LKD  
Sbjct: 48  SKDNNKSTGFLGAKEPLRKRTRPTVNHAGSFIGNTRPGVVPILNTNGAPRIKSLVLKDDI 107

Query: 113 ----------EAPNESSKSVTKRLL--LDEEIAKNSSXXXXXXXXXXILKIRSQLGGGLD 160
                     EA ++ S S+  +L   L+     +S+           L+  +      +
Sbjct: 108 EEEQSQSDGGEAEDDESNSLAAKLRGKLNARDRDDSTEQGGLLGATGGLQGLANTKLHSE 167

Query: 161 RLVRQSQNRELEIRPQAQDELPYIPDGHIILHEADIAKLRD 201
            L   S + E+E+ P   + LP+IP G+    + DI KL+D
Sbjct: 168 TLDSDS-DLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQD 207

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 63/146 (43%), Gaps = 48/146 (32%)

Query: 4   NEDKENA---------------VAVPQTPA------SNILDGSGVVLKP-------VGSR 35
           +EDKENA               +  PQTPA      S+IL      +KP           
Sbjct: 13  DEDKENASTFYDHHQHFRSGKPILFPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDA 72

Query: 36  GKQSFSVRKSPTRG-----GRLPLASKDNNASGLVVSGKLGRQPADQVREANSSRKLKRY 90
           G  +     SP R       R PL+ KDNN S ++   K  +Q  D        ++LK+Y
Sbjct: 73  GAGAVPPNISPRRQLLQLQNRFPLSKKDNNNSFIL---KQQQQQFDH-------KRLKKY 122

Query: 91  GSLLGY-----DNRQLTRSKSLILKD 111
           GS+LG      ++  LTR KSL+LKD
Sbjct: 123 GSVLGLGTDGNNHNNLTRIKSLVLKD 148

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 19/33 (57%)

Query: 170 ELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202
           ++E  P  +D LPYIP G+      DI KL+ Y
Sbjct: 275 DIEYAPIREDSLPYIPQGYTPFTNEDINKLKVY 307

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 70/264 (26%), Positives = 106/264 (40%), Gaps = 73/264 (27%)

Query: 4   NEDKENAVA-----------------VPQTPASNIL--DGSGVVLKPVGSRGKQSFSVRK 44
           N DKEN +A                 VPQTP   +L    S  +   V    +QS     
Sbjct: 10  NSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAVFKDAQQSKENNN 69

Query: 45  SPTRGGRLPLASKDNNAS-----------GLVVSGKLGRQPADQVREANSSRKLKRYGSL 93
           +  +  RLPLASKDNN S            LV++ +L     +Q     +S KL++YGS+
Sbjct: 70  NNIKLNRLPLASKDNNNSRRSNSFILQNNKLVLNKQLSLLNNNQ-----TSNKLRKYGSI 124

Query: 94  LGYDNRQLTRS------KSLILKD---------PEAPNESSKSVTKRL----------LL 128
           LG +N     +      KSLILKD          +  ++    +T  L          LL
Sbjct: 125 LGVNNNGNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLL 184

Query: 129 DEEIAKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQNRELE----------IRPQAQ 178
           ++   KN+            + +  + G GL +L+ QS N + +           +  A 
Sbjct: 185 NQ--LKNAKKNSYSDSEEEEIGLFGK-GNGLQKLISQSMNHKTKIEAEIIPEIETKSAAY 241

Query: 179 DELPYIPDGHIILHEADIAKLRDY 202
            +L Y P+G+I  +  DI KL  +
Sbjct: 242 PDLSYSPEGYIPFNNEDIKKLNTF 265

>TBLA0E04460 Chr5 complement(1141836..1142669) [834 bp, 277 aa] {ON}
           Anc_8.265 YDR113C
          Length = 277

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 58/139 (41%), Gaps = 21/139 (15%)

Query: 4   NEDKENAVAVPQTPASNILDGSGVVLKPVGSRGKQSFS--VRKSPTRG----GRLPLASK 57
           N +KEN    P+TP+  +   S  +LK   +         +   P+       R PLASK
Sbjct: 2   NSNKENIFTAPRTPSPQLKRDSSNILKFNSTTHTNVLKSKITDVPSNASGITARRPLASK 61

Query: 58  DNN----ASGLVVSGKLGRQPADQVREANSS--------RKLKRYGSLLGYDNRQLTR-- 103
           D N    A G V S              N           +LK+YGS+LGY N  +    
Sbjct: 62  DKNVRRTALGQVKSSISSNNSNTNSTNNNDKNKNNMLPMNRLKKYGSVLGYSNNTINSNA 121

Query: 104 SKSLILKDPEAPNESSKSV 122
           SK+LILKD  AP E  K +
Sbjct: 122 SKTLILKDI-APLEKDKHI 139

>CAGL0C05599g Chr3 complement(538455..541559) [3105 bp, 1034 aa]
           {ON} similar to uniprot|P35688 Saccharomyces cerevisiae
           YDL240w LRG1 GTPase-activating protein of the rho/rac
           family
          Length = 1034

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 11/140 (7%)

Query: 52  LPLASKDNNASGLVVSGKLGRQPADQ---VREANSSRKLKRYGSLLGYDNRQLTRSKSLI 108
           + L +KDN  + +  +G +  + + +   +R  N  ++LK     +   N +    KS++
Sbjct: 517 MDLQNKDNKVANIYENGNVPSKFSMEQTYIRTLNDVKRLKSRRESIRVSNEKKEARKSVV 576

Query: 109 LKDPEAPNESSKSVTKRLLLDEEI-AKNSSXXXXXXXXXXILKIRSQLGGGLDRLVRQSQ 167
           L+ PE    S K   K L++  +   +NS            L +       + R+V   Q
Sbjct: 577 LEIPETELGSGKREDKNLIIKTDTPTENSGRDEQLFGNNKTLTLDD-----ISRIVAAEQ 631

Query: 168 NRELEIRPQAQDELPYIPDG 187
            REL  RP A      + DG
Sbjct: 632 AREL--RPNAFTHFKTLEDG 649

>Kwal_47.18450 s47 (830833..831945) [1113 bp, 370 aa] {ON} YML027W
           (YOX1) - Homeobox-domain containing protein [contig 195]
           FULL
          Length = 370

 Score = 30.0 bits (66), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 4/40 (10%)

Query: 14  PQTPASNILDGSGVVLKPVGSRGKQSFSVRKSPTRGGRLP 53
           P TP ++ILD S + L+PV + G        SPT   +LP
Sbjct: 254 PDTPPASILDTSNIALEPVTTPGTN----HSSPTNARQLP 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.132    0.365 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,206,553
Number of extensions: 1099908
Number of successful extensions: 2259
Number of sequences better than 10.0: 26
Number of HSP's gapped: 2283
Number of HSP's successfully gapped: 29
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 65 (29.6 bits)