Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032208.267ON86864213e-55
Kpol_543.428.267ON112562264e-25
KAFR0B054908.267ON85492113e-23
CAGL0B01793g8.267ON98542116e-23
NCAS0B038208.267ON115512101e-22
TBLA0E044708.267ON94882045e-22
TPHA0A017708.267ON104512021e-21
YDR115W8.267ON105702022e-21
Suva_2.2748.267ON105702012e-21
Kwal_56.237768.267ON130492032e-21
Skud_4.3758.267ON105492003e-21
Smik_4.3598.267ON105492003e-21
NDAI0J013408.267ON141491999e-21
SAKL0H16918g8.267ON111491979e-21
KLTH0G13574g8.267ON112491942e-20
Ecym_43038.267ON109491934e-20
AGR081C8.267ON130741944e-20
ZYRO0C01540g8.267ON97721891e-19
TDEL0F039408.267ON110511873e-19
KLLA0F19250g8.267ON116491831e-18
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03220
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...   166   3e-55
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    92   4e-25
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    86   3e-23
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    86   6e-23
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    86   1e-22
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    83   5e-22
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    82   1e-21
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...    82   2e-21
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...    82   2e-21
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    83   2e-21
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...    82   3e-21
Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...    82   3e-21
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    81   9e-21
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    80   9e-21
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    79   2e-20
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    79   4e-20
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    79   4e-20
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    77   1e-19
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    77   3e-19
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    75   1e-18

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
          Anc_8.267 YDR115W
          Length = 86

 Score =  166 bits (421), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MSLLLSTVAGIARTRAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGF 60
          MSLLLSTVAGIARTRAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGF
Sbjct: 1  MSLLLSTVAGIARTRAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGF 60

Query: 61 LARVRASFRSKVLKRRKEKGRWYLSH 86
          LARVRASFRSKVLKRRKEKGRWYLSH
Sbjct: 61 LARVRASFRSKVLKRRKEKGRWYLSH 86

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 91.7 bits (226), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 49/56 (87%)

Query: 31  TGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           TG++ L RRWKSRGNTYQPSTLKRKRKFGFLAR R+   SK+L+RRK KGRWYLSH
Sbjct: 57  TGLLGLQRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa]
          {ON} Anc_8.267 YDR115W
          Length = 85

 Score = 85.9 bits (211), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 45/49 (91%)

Query: 38 RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
          +RWKSRGNTYQPSTLKRKRKFGFL+R ++  +SK+LK RKEKGRWYLSH
Sbjct: 37 KRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKSKILKDRKEKGRWYLSH 85

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
          similarities with uniprot|Q04598 Saccharomyces
          cerevisiae YDR115w
          Length = 98

 Score = 85.9 bits (211), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%)

Query: 33 VVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
          +  L RRWKSRGNTYQPSTLKRKRKFGFLAR+     +K++KRRKEKGRWYL+H
Sbjct: 45 LFPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 85.5 bits (210), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%)

Query: 36  LTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           L RRWKSRGNTYQPSTLKRKRKFGFLA+ R S + K+LKRR+ KGRWYL+H
Sbjct: 65  LQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKCKILKRRRLKGRWYLTH 115

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON}
          Anc_8.267 YDR115W
          Length = 94

 Score = 83.2 bits (204), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 42/88 (47%), Positives = 60/88 (68%), Gaps = 6/88 (6%)

Query: 5  LSTVAGIARTRAVGASALLTGGI------RPTTGVVTLTRRWKSRGNTYQPSTLKRKRKF 58
          L+ +A  +++ A+ + +LL   +           ++  +RRWKSRGNTYQPSTLKRKRK 
Sbjct: 7  LTRIACFSKSTALNSMSLLNKSLLINNNIIGNNKLMIDSRRWKSRGNTYQPSTLKRKRKH 66

Query: 59 GFLARVRASFRSKVLKRRKEKGRWYLSH 86
          GFL+R ++   +K+LKRRK KGRW+LSH
Sbjct: 67 GFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 82.4 bits (202), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/51 (74%), Positives = 44/51 (86%)

Query: 36  LTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           L RRWKSRGNTYQPSTLKRKR+ GFLAR R+   +K+L+RRK KGRWYL+H
Sbjct: 54  LQRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score = 82.4 bits (202), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%)

Query: 17  VGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRR 76
           + +S L T    P    +   RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRR
Sbjct: 36  LNSSPLKTPSFTPLGFGLIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRR 95

Query: 77  KEKGRWYLSH 86
           K KGRW+LSH
Sbjct: 96  KLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 82.0 bits (201), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/70 (61%), Positives = 50/70 (71%)

Query: 17  VGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRR 76
           + +S L T  + P        RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRR
Sbjct: 36  LNSSPLKTMSLTPFGFGFIGQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRR 95

Query: 77  KEKGRWYLSH 86
           K KGRW+LSH
Sbjct: 96  KLKGRWFLSH 105

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 82.8 bits (203), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 45/49 (91%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           +RWKSRGNTYQPSTLKRKR+ GFLARV++   SK+LKRR+EKGRWYL+H
Sbjct: 82  KRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 81.6 bits (200), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 43/49 (87%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRRK KGRW+LSH
Sbjct: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score = 81.6 bits (200), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 43/49 (87%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRRK KGRW+LSH
Sbjct: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 81.3 bits (199), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 44/49 (89%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           +RWKSRGNTYQPSTLKRKRK+GFL+R+R    SK+LKRRK KGRW+LSH
Sbjct: 93  KRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 80.5 bits (197), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 42/49 (85%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNTYQPSTLKRKR+ GFLAR +    SK+LK RKEKGRWYL+H
Sbjct: 63  RRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 79.3 bits (194), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 38/49 (77%), Positives = 43/49 (87%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNTYQPSTLKRKR+ GFLAR ++    KVLKRR+EKGRWYL+H
Sbjct: 64  RRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 79.0 bits (193), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 37/49 (75%), Positives = 43/49 (87%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNT+QPSTLKRKR+ GFLAR R+    K+LKRRKEKGRWYL++
Sbjct: 61  RRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLTY 109

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 79.3 bits (194), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 50/74 (67%), Gaps = 5/74 (6%)

Query: 18  GASALLTGGIRPTTGVVTL-----TRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKV 72
           GA    T    P   ++++      +RWKSRGNTYQPSTLKRKR+ GFLAR R+     +
Sbjct: 57  GAIGAFTPAAAPKPSMLSMLLGLTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNI 116

Query: 73  LKRRKEKGRWYLSH 86
           LKRR+EKGRWYL+H
Sbjct: 117 LKRRREKGRWYLTH 130

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
          similar to uniprot|Q04598 Saccharomyces cerevisiae
          YDR115W
          Length = 97

 Score = 77.4 bits (189), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/72 (56%), Positives = 51/72 (70%), Gaps = 7/72 (9%)

Query: 15 RAVGASALLTGGIRPTTGVVTLTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLK 74
          R +G S L       ++G     RRWKSRGNT+QPSTLKRKR+ GFLAR R+   SK+L+
Sbjct: 33 RLLGPSPL-------SSGFGMGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQ 85

Query: 75 RRKEKGRWYLSH 86
          RRK KGRW+L+H
Sbjct: 86 RRKHKGRWFLTH 97

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 76.6 bits (187), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 36/51 (70%), Positives = 44/51 (86%)

Query: 36  LTRRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           + RRWKSRGNT+QPSTLKRKR+ GFLAR R+   S+VL+RRK KGRWYL++
Sbjct: 60  MQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAKGRWYLTY 110

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 75.1 bits (183), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (85%)

Query: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86
           RRWKSRGNT+QPSTLKRKR+ GFLAR R+    ++LKRRK KGRWYL++
Sbjct: 68  RRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,498,544
Number of extensions: 239635
Number of successful extensions: 765
Number of sequences better than 10.0: 22
Number of HSP's gapped: 765
Number of HSP's successfully gapped: 22
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 59 (27.3 bits)