Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032108.268ON28528513010.0
KLLA0F19272g8.268ON2662436818e-89
YDR116C (MRPL1)8.268ON2852426783e-88
Smik_4.3608.268ON2852426742e-87
NCAS0B038108.268ON3142416753e-87
ZYRO0C01518g8.268ON2772426629e-86
SAKL0H16896g8.268ON2852436568e-85
KAFR0B054808.268ON2802436498e-84
Kpol_392.38.268ON2812436445e-83
TPHA0J007708.268ON2782436402e-82
Suva_2.2758.268ON2852426377e-82
Skud_4.3768.268ON2852426342e-81
NDAI0J013308.268ON3142426328e-81
TDEL0F039508.268ON2762436105e-78
KLTH0G13552g8.268ON2812846106e-78
Ecym_43028.268ON2752426001e-76
AGR080W8.268ON2752425984e-76
Kwal_56.237758.268ON2812435881e-74
CAGL0B01815g8.268ON2902475324e-66
TBLA0I031908.268ON2412104199e-50
KLLA0D05709g8.9ON25453800.10
KLLA0A11286g1.441ON57997810.11
Ecym_13531.441ON56897702.2
AEL048W1.441ON56897702.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03210
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   505   0.0  
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   266   8e-89
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   265   3e-88
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   264   2e-87
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   264   3e-87
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   259   9e-86
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   257   8e-85
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   254   8e-84
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   252   5e-83
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   251   2e-82
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   249   7e-82
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   248   2e-81
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   248   8e-81
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   239   5e-78
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   239   6e-78
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   235   1e-76
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   234   4e-76
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   231   1e-74
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   209   4e-66
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   166   9e-50
KLLA0D05709g Chr4 (492707..493471) [765 bp, 254 aa] {ON} highly ...    35   0.10 
KLLA0A11286g Chr1 complement(978095..979834) [1740 bp, 579 aa] {...    36   0.11 
Ecym_1353 Chr1 complement(725756..727462) [1707 bp, 568 aa] {ON}...    32   2.2  
AEL048W Chr5 (545687..547393) [1707 bp, 568 aa] {ON} Syntenic ho...    32   2.3  

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  505 bits (1301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/285 (90%), Positives = 257/285 (90%)

Query: 1   MLANHWRPVLLRMPLRALHTRFGPLXXXXXXXXXXXXXXXXXKLTKEQLRRRELRKMIRS 60
           MLANHWRPVLLRMPLRALHTRFGPL                 KLTKEQLRRRELRKMIRS
Sbjct: 1   MLANHWRPVLLRMPLRALHTRFGPLAQEAVTGAAVAAAPAQPKLTKEQLRRRELRKMIRS 60

Query: 61  KMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLP 120
           KMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLP
Sbjct: 61  KMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLP 120

Query: 121 TPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQ 180
           TPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQ
Sbjct: 121 TPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQ 180

Query: 181 LNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQ 240
           LNSK           PNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQ
Sbjct: 181 LNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQ 240

Query: 241 VLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA 285
           VLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA
Sbjct: 241 VLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  266 bits (681), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 179/243 (73%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KLTKEQLR+RELRKM++ ++ AK PAS   +Y+ V  A+R LRA+EVGQP SQQTITLTT
Sbjct: 24  KLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTT 83

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           +VV+E+GVPPL G+V    PLK V++A F+ D      ++++  + +VGG++L+ Q+K+G
Sbjct: 84  LVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAG 143

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           EV + FDKAFATPDI PQL S+           P  KKGTV  DL  +I+  + ++PFRQ
Sbjct: 144 EVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQ 203

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R  +++ G+AK HF+D++VL NL+A ++AF+ +I NQ++KK SIL ++TL+STHGPGIVI
Sbjct: 204 RGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVI 263

Query: 283 DLA 285
           D A
Sbjct: 264 DFA 266

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  265 bits (678), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 123/242 (50%), Positives = 178/242 (73%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           LTK+Q ++REL+++++ K  AKRPA+   +Y+ V +A+R LRA EVG+P SQQTI LTT+
Sbjct: 44  LTKDQAKKRELKRLVQRKAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTL 103

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGE 163
           VV E+G  PL G V  P PL+ ++IAAF+ D   L+ L+E+    ++GGA+L+ ++KSGE
Sbjct: 104 VVGERGTAPLSGSVTFPKPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGE 163

Query: 164 VPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQR 223
           + V FDKAFATPDI P L S+           P++KKGTV  D+ ++++  +G+MPFRQR
Sbjct: 164 ISVDFDKAFATPDIVPALQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQR 223

Query: 224 AANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVID 283
             +++ G+ KC+F+DR++L N+I+AR AF+ A+ NQKSKK +IL ++TLSSTHGPGIVID
Sbjct: 224 GNSISIGVGKCYFTDREILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVID 283

Query: 284 LA 285
            A
Sbjct: 284 FA 285

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  264 bits (674), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 177/242 (73%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           LTK+Q ++REL+++ + K  AKRPA+ + +Y+ V  A+R LRA EVG+P SQQTI LTT+
Sbjct: 44  LTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTL 103

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGE 163
           VV E+G  PL G V  P PL+ +++AAF+ D   L+ L+++    ++GGA+L+ ++KSGE
Sbjct: 104 VVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGE 163

Query: 164 VPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQR 223
           +PV FDKAFATPDI P L S+           P++KKGTV  D+ +++   +G+MPFRQR
Sbjct: 164 IPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQR 223

Query: 224 AANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVID 283
             +++ G+ KC+FSDR++L N+I+AR AF+ A+ NQKSKK ++L ++TLSSTHGPGIVID
Sbjct: 224 GNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVID 283

Query: 284 LA 285
            A
Sbjct: 284 FA 285

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  264 bits (675), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 176/241 (73%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           L+KEQL++RELR++ + K  AKRPAS   +Y+ V EA+R +RA EVG+P+ QQTITLT++
Sbjct: 73  LSKEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSL 132

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGE 163
           VV+EKGV PL+G + LP PLK +++A FS + ELL R++E+    +VGG ELI+++K+GE
Sbjct: 133 VVNEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGE 192

Query: 164 VPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQR 223
           V   FDKAFA+ D+A  L+++           PN KKGTV  DL +++  K+G++PFRQ 
Sbjct: 193 VKTDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQT 252

Query: 224 AANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVID 283
              ++ GI KCHFSD ++L N+IAAR A   A+  QKSKK SILG++TLSSTHGPGIVID
Sbjct: 253 GNCISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVID 312

Query: 284 L 284
            
Sbjct: 313 F 313

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  259 bits (662), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 174/242 (71%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KLTKEQLR+RE+R+  R K+ AK+PA    +Y+  P A+R LRAVEVG P SQQ IT+TT
Sbjct: 35  KLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVTT 94

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
            VV+++G PP+ G+V LP+PLK V +A FS D + L   +++    +VGG+++I ++K G
Sbjct: 95  SVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQG 154

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           E+PV FDKAFATPDIA +L S+           P  K+GTV  DL  +I+   G++PFRQ
Sbjct: 155 EIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFRQ 214

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           +  +++  +AKC FSDRQVL NL+A + AF+ A+ NQK+K+ SILGR+TL++THGPGIVI
Sbjct: 215 KGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIVI 274

Query: 283 DL 284
           DL
Sbjct: 275 DL 276

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  257 bits (656), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 182/243 (74%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+K+QL+RRELR++++ K  A++PA+   +Y+ V +A+R LRA EVGQP SQQTI+LTT
Sbjct: 43  KLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTT 102

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           +V+SE+G P L+G++  P PLK V+IA F+ D + LK  +++    +VGG+ELI+++K G
Sbjct: 103 LVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKG 162

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           EVP+ FDKAFATPDIA  L S+           PN KKGTV  D+ ++I+  +G +PFRQ
Sbjct: 163 EVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQ 222

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R   ++  +AKC F+D QVL N++AA+++F+LA+ NQK+KK SILG++TL++THGPG+VI
Sbjct: 223 RGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVI 282

Query: 283 DLA 285
           D A
Sbjct: 283 DFA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  254 bits (649), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 121/243 (49%), Positives = 170/243 (69%), Gaps = 1/243 (0%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           K  K+Q +++ LR  +RS+  A+ PAS   +Y+ VP+A+R LRAVEVGQP SQQTITLTT
Sbjct: 37  KTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLTT 96

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVE-LEIVGGAELIDQLKS 161
           +V+SEKGVPP++G+V LPTPL+  ++   S DP+ L+ +Q+  + + +VGG EL+D+ K+
Sbjct: 97  LVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFKN 156

Query: 162 GEVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFR 221
            ++ + FDK  ATPDI    N             PN+KKGTV  +L+ ++   V +MPFR
Sbjct: 157 EDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPFR 216

Query: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281
           QRA  ++ GI K  FSD+Q+L N+IA REAF   + NQK+KK+S LG++TL+STHGPGIV
Sbjct: 217 QRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGIV 276

Query: 282 IDL 284
           ID 
Sbjct: 277 IDF 279

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  252 bits (644), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 118/243 (48%), Positives = 172/243 (70%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           K  K++L+RRELR+  + K  A++PAS   +Y+ + +A+R LRA EVGQP SQQ IT+TT
Sbjct: 39  KSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITT 98

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
            VVSE+G   L+G++   TP+K V+IA FS DPE L +++EE    ++GG +L++++KSG
Sbjct: 99  DVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSG 158

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           + PV FDKAFATPDI+P L S+           P IKKGTV  D+ ++I+  +G MPFRQ
Sbjct: 159 KQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQ 218

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
              +++  + +C+FSD+Q+L N+IA R A+   + +QKSKK S+LG++T++STHGPGI I
Sbjct: 219 TGNSISVSVGRCNFSDKQILENIIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITI 278

Query: 283 DLA 285
           D A
Sbjct: 279 DFA 281

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  251 bits (640), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 171/243 (70%), Gaps = 1/243 (0%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+K+QL++RELR+    K  AK PA+   +Y+ VP+A+R LRA EVGQP SQQTI LTT
Sbjct: 37  KLSKDQLKKRELRRFTIRKREAKMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTT 96

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           +VVSEKG P L GD+   TPLK V+IA F+ D   +K  +E+    +VGG+ELI ++K+G
Sbjct: 97  LVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNG 156

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           E+ V FDKAFATPDI  +L S            P+IKKGTV  ++  +I+  +G++PFRQ
Sbjct: 157 EIEVDFDKAFATPDIVQELGS-VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQ 215

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
               ++  I KC+FSDRQ+L NLI+ R+AF+ ++  QK+KK SILG++ LS+THGPGIVI
Sbjct: 216 LGNCISVAIGKCNFSDRQILENLISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVI 275

Query: 283 DLA 285
           D +
Sbjct: 276 DFS 278

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  249 bits (637), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 172/242 (71%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           LTK+Q ++REL+++ + +  AKRPA+   +++ V  A+R LRA EVG+P SQQTI LTT+
Sbjct: 44  LTKDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTL 103

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGE 163
           VV E+G  P+ G+V    PL+ V++A F+ D   LK L+E+    IVGG +L+ ++K+ E
Sbjct: 104 VVGERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNE 163

Query: 164 VPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQR 223
            PV FDKAFATPDI P L S+           P++KKGTV  D+ ++++  +G+MPFRQR
Sbjct: 164 SPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQR 223

Query: 224 AANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVID 283
              ++ GI KC+F+DR++L N+I+AR AF+ A+ NQK+KK S+L ++TLSSTHGPGIVID
Sbjct: 224 GNAISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVID 283

Query: 284 LA 285
            A
Sbjct: 284 FA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  248 bits (634), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 122/242 (50%), Positives = 176/242 (72%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           LTKEQ ++REL+++ + +  AKRPA+ + +Y+ V  A+R LRA EVG+P SQQTI LTT+
Sbjct: 44  LTKEQAKKRELKRLAQRRAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTL 103

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGE 163
           VV E+G  PL G V  P PL+ +++A F+ D   LK L+E+    ++GGA+L+ ++K+GE
Sbjct: 104 VVGERGTAPLSGSVAFPKPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGE 163

Query: 164 VPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQR 223
           +PV FDKA+AT DI P L S+           P++KKGTV  D+ ++++  +G+MPFRQR
Sbjct: 164 IPVDFDKAYATADIVPALQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQR 223

Query: 224 AANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVID 283
             +++ GI KC+F+DR+VL N+IAAR AF+ A+ +QKSKK +IL ++TLSSTHGPGIVID
Sbjct: 224 GNSISLGIGKCYFTDREVLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVID 283

Query: 284 LA 285
            A
Sbjct: 284 FA 285

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  248 bits (632), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 173/242 (71%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+KEQL++RE+R++ + K  A++PA+   +Y+ V +A+R +RA EVG+P  QQTITLTT
Sbjct: 72  KLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLTT 131

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           ++VSEKG   L+G++ L  PLK ++IA FS D ELL+ ++ +   ++VGG E ++ +K G
Sbjct: 132 LIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKDG 191

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
            +   FD AFATP+I P +NS+           PN KKGTV  DL+ ++ +K+G +PF+Q
Sbjct: 192 TIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFKQ 251

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
              N++  I KC+FSD+ +L N+IAAR+AF+ A+ NQK+K+ SIL ++TLSSTHGPGIVI
Sbjct: 252 TGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIVI 311

Query: 283 DL 284
           D 
Sbjct: 312 DF 313

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  239 bits (610), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 128/243 (52%), Positives = 172/243 (70%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+K+QL++RE+R++ + K  AK+  S   +Y+S+P A+R LRA EVGQP +QQTITLTT
Sbjct: 34  KLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQPQTQQTITLTT 93

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
            VV+E+GVP L G V  P PLK V+IA FS D + LK  +E+    +VGG E+I+++KSG
Sbjct: 94  AVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKFNCHLVGGTEIIEKIKSG 153

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           E+PV FDKAFATPDIAP L S+           P +KKGTV  D+  +++  +G+MPFRQ
Sbjct: 154 EIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVATDVSRLVQDSMGSMPFRQ 213

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R   ++  + K  FSDRQ+L N IA  +A + A+ NQ SKK S+LG++TLSSTHGPGIVI
Sbjct: 214 RGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKTTLSSTHGPGIVI 273

Query: 283 DLA 285
           D A
Sbjct: 274 DFA 276

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  239 bits (610), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 118/284 (41%), Positives = 187/284 (65%), Gaps = 7/284 (2%)

Query: 2   LANHWRPVLLRMPLRALHTRFGPLXXXXXXXXXXXXXXXXXKLTKEQLRRRELRKMIRSK 61
           L++ + P++   P+R LH                       KL+K+QL++RE+R+  + K
Sbjct: 5   LSSRFLPLVRASPVRRLHV-------SASLRAEEPVGNATSKLSKDQLKKREVRRFAQKK 57

Query: 62  MLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPT 121
             A+RPAS+  +Y+ V +A+R LRA EVGQP SQQT+++TT+V+SE+G P L G+V  P 
Sbjct: 58  AAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPN 117

Query: 122 PLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQL 181
            LK ++IA F+ D +  +  +E+    +VGG+EL++++K G+VP+ FDK+FATP+IA  L
Sbjct: 118 ALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLL 177

Query: 182 NSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQV 241
            S+           P  KKGTV  +L ++I+  +G +PFRQR  N++  + +C F+D+Q+
Sbjct: 178 ASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQL 237

Query: 242 LGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVIDLA 285
           L N++AA+++ + A+ NQK+KK S+LG++TL+ST GPGIVID A
Sbjct: 238 LENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  235 bits (600), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 110/242 (45%), Positives = 169/242 (69%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+KEQ++++ELR +++ +  AK+   +  +Y+ V +A R LRA EVGQP SQQTI+LTT
Sbjct: 33  KLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTT 92

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           +VVS+KG P L G+++ P PL+ V++A F+ + E  +  +E+ +  +VGG ELI+ +K+G
Sbjct: 93  VVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNG 152

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           + P+ FDKA ATPD+  QL S+           P +KKGTV  ++  +IR  +  +PFRQ
Sbjct: 153 DTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQ 212

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R   L+  + KC FSD+Q+L N++A ++AF+ A+ +Q+ KK SILG++T++STHGPGIVI
Sbjct: 213 RGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVI 272

Query: 283 DL 284
           D 
Sbjct: 273 DF 274

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  234 bits (598), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 119/242 (49%), Positives = 170/242 (70%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+K+QL++RELR++ + K  A+RPAS   +Y+ V +A+R LRA EVGQP +QQTI++ T
Sbjct: 32  KLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTISVNT 91

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           MV+ +KG   L G V LP+P++  ++A F+ DPE  +  + +    +VGGAEL++QLKSG
Sbjct: 92  MVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQLKSG 151

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
           EV V FDKAFATPDIAP + +K           P++KKGTV  DL  ++   + + PF+Q
Sbjct: 152 EVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINSTPFKQ 211

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R   ++  I KCHFSDRQ++ NL+A + AF+ A+ +QK+KK S+ G +TL+STHGPGIVI
Sbjct: 212 RNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGPGIVI 271

Query: 283 DL 284
           D 
Sbjct: 272 DF 273

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  231 bits (588), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 171/243 (70%)

Query: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102
           KL+K+QLR+RE+RK+ + K  A+RPA+   +Y+ V +A+R LRA E GQP SQQT+++TT
Sbjct: 39  KLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSVTT 98

Query: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162
           +V+SE+G PPL G++  P PLK ++IA F+ D +  +  +E+    +VGG++L++++K G
Sbjct: 99  IVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIKEG 158

Query: 163 EVPVQFDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222
            V + FDK+FATP+I   L S+           P  KKGTV  +L  ++++ +G +PFRQ
Sbjct: 159 AVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPFRQ 218

Query: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282
           R   ++  + KC F+D+Q+L N++AA++  + A+  QK+KK S+LG++TL+STHGPGIVI
Sbjct: 219 RGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGIVI 278

Query: 283 DLA 285
           D A
Sbjct: 279 DFA 281

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  209 bits (532), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 107/247 (43%), Positives = 167/247 (67%), Gaps = 6/247 (2%)

Query: 44  LTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTTM 103
           LTKEQ ++RE++++   K  AK+PA+   +Y+ +P A+R LR+ EVG+PT  QTIT+TT+
Sbjct: 43  LTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTL 102

Query: 104 VVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEV--ELEIVGGAELIDQLKS 161
           VV++KG   L G+++ P PLK ++IA FS++ E L  L+ +   +++I GG ++I  +KS
Sbjct: 103 VVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKS 162

Query: 162 GEVPVQ-FDKAFATPDIAPQLNSKXXXXXXXXXXXPNIKK---GTVGPDLLAMIRSKVGA 217
           G++ V   +K FATP+I P + S+           PN+KK    TVG DL ++I   +G 
Sbjct: 163 GKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQ 222

Query: 218 MPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHG 277
           + FRQR  +L+  + +C+FSDR +L N+IA R AF+ ++ +Q +KK SILG++T+S+T G
Sbjct: 223 VSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAG 282

Query: 278 PGIVIDL 284
           PGIVID 
Sbjct: 283 PGIVIDF 289

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  166 bits (419), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 137/210 (65%), Gaps = 2/210 (0%)

Query: 75  LSVPEAMRILRAVEVGQPTSQQTITLTTMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSAD 134
           + VP A+R LRA+E G+ +S+QT+TL T+V + +G  PL G++     ++   IA F+ D
Sbjct: 33  MEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAVFTED 92

Query: 135 PELLKRLQEEVELEIVGGAELIDQLKSGEVPVQFDKAFATPDIAPQLNSKXXXXXXXXXX 194
           PE  K + +E+ ++I+GG+ELID++ SGE  + F  AFAT D+   L ++          
Sbjct: 93  PEQHK-IAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLGKQKV 150

Query: 195 XPNIKKGTVGPDLLAMIRSKVGAMPFRQRAANLAFGIAKCHFSDRQVLGNLIAAREAFQL 254
            P +KK TVG ++  +++ K+  +PF ++A+ ++F + KC F+D ++L NLI ARE  Q 
Sbjct: 151 LPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKAREGLQK 210

Query: 255 AIQNQKSKKRSILGRSTLSSTHGPGIVIDL 284
           A++ Q +KK S + ++TL+STHGPGI IDL
Sbjct: 211 ALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>KLLA0D05709g Chr4 (492707..493471) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P07283 Saccharomyces cerevisiae
           YFL045C SEC53 involved in synthesis of GDP- mannose and
           dolichol-phosphate-mannose required for protein assembly
           in endoplasmic reticulum phosphomannomutase
          Length = 254

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 32/53 (60%), Gaps = 2/53 (3%)

Query: 123 LKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLK--SGEVPVQFDKAFA 173
           L P R+       ++LKRL+E+V +  VGG++L  QL+    +V  QFD AF+
Sbjct: 24  LTPARLTVSDEVRDILKRLREKVVIGFVGGSDLSKQLEQLGSDVLDQFDYAFS 76

>KLLA0A11286g Chr1 complement(978095..979834) [1740 bp, 579 aa] {ON}
           highly similar to uniprot|P39968 Saccharomyces
           cerevisiae YEL013W VAC8 Phosphorylated vacuolar membrane
           protein that interacts with Atg13p required for the
           cytoplasm-to-vacuole targeting (Cvt) pathway interacts
           with Nvj1p to form nucleus-vacuole junctions
          Length = 579

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 95  QQTITLTTMVVSEKGVPPLHGDVVLP------TPLKPVRIAAFSADPELLKRLQEEVELE 148
           Q++  L    ++EK V P+  DV+ P       P   +RIA+ +A   L    + ++ + 
Sbjct: 66  QRSAALAFAEITEKYVSPVSRDVLEPILMLLTNPDPQIRIASCAALGNLAVNNENKLLIV 125

Query: 149 IVGGAE-LIDQLKSGEVPVQFDKAFATPDIAPQLNSK 184
            +GG E LI+Q+KS  V VQ +      ++A Q ++K
Sbjct: 126 EMGGLEPLIEQMKSDNVEVQCNAVGCITNLATQDDNK 162

>Ecym_1353 Chr1 complement(725756..727462) [1707 bp, 568 aa] {ON}
           similar to Ashbya gossypii AEL048W
          Length = 568

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 51/97 (52%), Gaps = 7/97 (7%)

Query: 95  QQTITLTTMVVSEKGVPPLHGDVVLPTPL-----KP-VRIAAFSADPELLKRLQEEVELE 148
           Q++  L    ++EK V P+  +V+ P  +      P ++IAA +A   L    + ++ + 
Sbjct: 64  QRSAALAFAEITEKYVRPVDREVLEPILILLQSNDPQIQIAACAALGNLAVNNENKILIV 123

Query: 149 IVGGAE-LIDQLKSGEVPVQFDKAFATPDIAPQLNSK 184
            +GG E LI+Q+KS  V VQ +      ++A Q ++K
Sbjct: 124 EMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNK 160

>AEL048W Chr5 (545687..547393) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL013W (VAC8)
          Length = 568

 Score = 31.6 bits (70), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 50/97 (51%), Gaps = 7/97 (7%)

Query: 95  QQTITLTTMVVSEKGVPPLHGDVVLPTPLK------PVRIAAFSADPELLKRLQEEVELE 148
           Q++  L    ++EK V P+  +V+ P  +        ++IAA +A   L    + ++ + 
Sbjct: 64  QRSAALAFAEITEKYVRPVDREVLEPILILLQSHDPQIQIAACAALGNLAVNNENKILIV 123

Query: 149 IVGGAE-LIDQLKSGEVPVQFDKAFATPDIAPQLNSK 184
            +GG E LI+Q+KS  V VQ +      ++A Q ++K
Sbjct: 124 EMGGLEPLIEQMKSNNVEVQCNAVGCITNLATQDDNK 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.381 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,765,526
Number of extensions: 768845
Number of successful extensions: 2087
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2131
Number of HSP's successfully gapped: 27
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 65 (29.6 bits)