Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H032008.269ON56155226780.0
Skud_4.3778.269ON56257211901e-157
YDR117C (TMA64)8.269ON56556811451e-150
Suva_2.2768.269ON56557111421e-150
TDEL0F039608.269ON55855911401e-150
NCAS0B038008.269ON56556711261e-147
CAGL0B01837g8.269ON56957011251e-147
TPHA0J007808.269ON58358111041e-144
Smik_4.3618.269ON56556810841e-141
KAFR0B054708.269ON56256510661e-138
ZYRO0C01496g8.269ON56756710621e-138
Kpol_392.28.269ON56657810581e-137
NDAI0J013108.269ON57959010081e-130
Kwal_56.237718.269ON5625649951e-128
KLTH0G13530g8.269ON5745739731e-124
SAKL0H16874g8.269ON5635629701e-124
TBLA0I032008.269ON5635769401e-120
AGR079W8.269ON5425638621e-108
Ecym_43018.269ON5645798361e-104
KLLA0F19294g8.269ON5705758032e-99
SAKL0F04576g7.152ON180156810.13
Suva_13.4658.839ON73269761.2
Suva_15.3675.71ON264150741.6
Suva_2.1164.100ON679123742.4
Kpol_1067.251.456ON39170697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03200
         (561 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...  1036   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   462   e-157
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   445   e-150
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   444   e-150
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   443   e-150
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   438   e-147
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   437   e-147
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   429   e-144
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   422   e-141
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   415   e-138
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   413   e-138
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   412   e-137
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   392   e-130
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   387   e-128
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   379   e-124
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   378   e-124
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   366   e-120
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   336   e-108
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   326   e-104
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   313   2e-99
SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 a...    36   0.13 
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...    34   1.2  
Suva_15.367 Chr15 (645397..646191) [795 bp, 264 aa] {ON} YHR167W...    33   1.6  
Suva_2.116 Chr2 (201124..203163) [2040 bp, 679 aa] {ON} YBL009W ...    33   2.4  
Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON} (57301....    31   7.9  

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/552 (92%), Positives = 508/552 (92%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTT               FADGLA
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETLSVEDVDYFM 240
           DAFRLKLDIPDKLESATTQ          KPTSPVTNPVAVDDLAEVLETLSVEDVDYFM
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAEEPPVEAKPTSPVTNPVAVDDLAEVLETLSVEDVDYFM 240

Query: 241 TRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKHFXX 300
           TRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKHF  
Sbjct: 241 TRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKHFEK 300

Query: 301 XXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAVTSF 360
                            STDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAVTSF
Sbjct: 301 EGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAVTSF 360

Query: 361 QPDSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTKGNE 420
           QPDSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTKGNE
Sbjct: 361 QPDSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTKGNE 420

Query: 421 EKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKIGRK 480
           EKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKIGRK
Sbjct: 421 EKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKIGRK 480

Query: 481 VVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDHLRE 540
           VVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDHLRE
Sbjct: 481 VVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDHLRE 540

Query: 541 LGVPSSWVVFEN 552
           LGVPSSWVVFEN
Sbjct: 541 LGVPSSWVVFEN 552

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  462 bits (1190), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/572 (45%), Positives = 354/572 (61%), Gaps = 24/572 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL Q  +KQ   DE+ F  +T+KQTNF S  SVG +Y ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
              P+   FKEKH    L+P+VY+CW +P LLPIILTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  NNTPI--LFKEKHNE-QLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD      G  CG+A+ ++P V++A+G ++MDL  ++                 F DGL+
Sbjct: 118 FD-PRSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHH--FNDGLS 174

Query: 181 DAFRLKLDIP------DKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETLSVE 234
            A ++KLD P      + + S   Q             +     V V++LAEVL+  SV 
Sbjct: 175 KALKVKLDPPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVS 234

Query: 235 DVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKY 294
           DVDYF+TRALYYTLTQ+  L LPI+ SNF+S H+M+ LP  ID  EVNVKK+SW+K+AK+
Sbjct: 235 DVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPP-IDHNEVNVKKTSWRKSAKF 293

Query: 295 LKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIA--ESG--PKSQTTN 350
           LKHF                    T  K    LK+FVPY VG+S +  ESG    S+   
Sbjct: 294 LKHFEKEGFLKLKGKGDDLTIVGKTIDKDE--LKNFVPYKVGSSTSAQESGEHANSKEKT 351

Query: 351 GPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLL 407
             +M+++T ++P S A+  L    LG + Y++  +IR  L++YI+ N LA   +   V++
Sbjct: 352 PGMMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVM 411

Query: 408 NDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPP 467
           +D LF MV K  ++     RIM R +IL+ ++  +F   YQ+FK+ D+ L K P KG PP
Sbjct: 412 DDLLFNMVNK-KKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPP 470

Query: 468 KVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQ 527
           ++ I TEMKIGRKV+TRV NF+   I     A DLRK+CS STTIG++  T   +E+QVQ
Sbjct: 471 RIKITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGES-QTFKSAEVQVQ 529

Query: 528 GAHGPLIIDHLRELGVPSSWVVFENKVKPKKK 559
           G HG LIIDHL  LGVP+ W+ FENK+K KK+
Sbjct: 530 GPHGQLIIDHLNNLGVPNKWIDFENKLKKKKR 561

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  445 bits (1145), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 247/568 (43%), Positives = 342/568 (60%), Gaps = 27/568 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL Q  QKQ   +E+ F  +T+KQTNF    SVGT+Y ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
              P+   FKEKH    L+P+VY+CW +P LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  NNTPI--LFKEKHKE-QLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD      G  CGIA+ ++P+ ++A+G +++DL  F+                 F DGL+
Sbjct: 118 FD-PRCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHH--FNDGLS 174

Query: 181 DAFRLKLDIP---------DKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETL 231
             F++KL+ P         + + S   +          +        V V+++AEVL+  
Sbjct: 175 KVFKMKLEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHF 234

Query: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291
           +V DVDYF+TRALYYTLTQ+  L LPI+ASNF+S H+M+ LP  ID  EVNVKK+SWKK+
Sbjct: 235 TVSDVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPP-IDHNEVNVKKTSWKKS 293

Query: 292 AKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTN- 350
           AK+LKHF                       K    LK+FVPY +G S + +  +  TT+ 
Sbjct: 294 AKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDE--LKNFVPYKLGCSKSATESRESTTSK 351

Query: 351 ---GPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404
                +M+++T ++P + A+  L    L    Y++  +IR  +++YI+   LA   +   
Sbjct: 352 EKTSGMMYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGK 411

Query: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKG 464
           V+++D LF MV K  ++     RI+AR EIL  ++  +F   YQ+FK  DT L K P KG
Sbjct: 412 VIMDDLLFDMVNK-KKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKG 470

Query: 465 EPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEI 524
             P + IITEMKIGRKV+TRV NF+   +     AADLRK+CS STTI ++  T   +E+
Sbjct: 471 SLPHIKIITEMKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISES-QTFKCAEV 529

Query: 525 QVQGAHGPLIIDHLRELGVPSSWVVFEN 552
           QVQG HG  IIDHL +LG+PS W+ FEN
Sbjct: 530 QVQGPHGQSIIDHLNKLGIPSKWIDFEN 557

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  444 bits (1142), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 246/571 (43%), Positives = 351/571 (61%), Gaps = 33/571 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL Q  +KQ   +E+ F  +T+KQTNF    S+GT+Y ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
              P+   FKEKH    L+P+VY+CW +  LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  NNTPI--LFKEKHNE-QLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD      G  CG+A+ ++P +++AVG ++MDL  +  +               F DGL+
Sbjct: 118 FD-PRCKIGTLCGVASRQAPKIVLAVGIVEMDLPSY--SRVIGETGVAVKIVHHFNDGLS 174

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKPTSPVTNP---------VAVDDLAEVLETL 231
            AF++KL+ P   + A+            +  +  T           + ++++AEVL+ L
Sbjct: 175 KAFKVKLEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHL 234

Query: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291
           SV DVDYF+TRALYYTLTQ+  LALPI+ASNF+S H+M+ LP  ID  EVNVK++SWKK+
Sbjct: 235 SVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPP-IDHNEVNVKRTSWKKS 293

Query: 292 AKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVG--NSIAESGPKSQT- 348
           AK+LKHF                       K    LK+FVPY +G  NS  E G  + + 
Sbjct: 294 AKFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDE--LKNFVPYKLGVNNSAKEKGENTNSK 351

Query: 349 --TNGPVMFAVTSFQP-----DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNN 401
             T+G +M+++T ++P     D   +  LP   Q Y++  +IR  + +YI+   L    +
Sbjct: 352 EKTSG-MMYSLTLYKPFNLAKDLVKEANLPF--QTYYTSQDIRSAITQYISIKNLVDAKD 408

Query: 402 PKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHP 461
              V+++D L+ MV K  ++     R++ R +IL+ ++  +F   YQ++K+ DT L++ P
Sbjct: 409 KGKVVMDDLLYNMVNKKKKDPDVA-RVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTP 467

Query: 462 QKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVV 521
            KG PP++ IITEMKIGRKV+T+V NF+ L I     AADLRK+CS STTIG++  T   
Sbjct: 468 MKGSPPRIKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGES-QTFKS 526

Query: 522 SEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552
           +E+QVQG HG LIIDHL + GVP+ W+ FEN
Sbjct: 527 AEVQVQGPHGQLIIDHLNKSGVPNKWIDFEN 557

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  443 bits (1140), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 240/559 (42%), Positives = 351/559 (62%), Gaps = 18/559 (3%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL Q  ++Q G  ++ FS + VKQTN++   S GT+Y + 
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
               VP++FKEKHG   L+P+VY+CW+ P LLPI+LTH  VIE+ LFNGANLM++GT+PP
Sbjct: 61  NN--VPIWFKEKHGE-LLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD       + CGIA+   P VI+A+G ++++L  +++                F DGL 
Sbjct: 118 FD-ERCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHY--FTDGLC 174

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKPTSP----VTNPVAVDDLAEVLETLSVEDV 236
            AF++ ++ P  L S   +             SP        ++++D+A+VL+ LSVEDV
Sbjct: 175 QAFKIDIE-PAVLSSEPVEEEEEEEGKEKLTESPKRETFHTEISIEDVAQVLDELSVEDV 233

Query: 237 DYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLK 296
           D+F TRALYYT T +  L +PINASNF+S H++  LP  +D ++VN+KK+SWKKTAK+LK
Sbjct: 234 DHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPP-VDQSQVNMKKTSWKKTAKFLK 292

Query: 297 HFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFA 356
           HF                      +K    LK+FVPY      A     ++ ++  +M++
Sbjct: 293 HFEKVGFLQLKGKGDDLVIVGVNKNKDE--LKNFVPYKTSGQTASKKNSNKDSSPGMMYS 350

Query: 357 VTSFQPDSTAQTALPLGG---QRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFG 413
              ++P +  +  +       +  ++  E+++ +N+YITA KL    N KMVLL+D LF 
Sbjct: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFD 410

Query: 414 MVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIIT 473
           M  +  ++ Q T R ++R +I++  +  +F   YQLFKD+DTPL K+P +G  P+V I+T
Sbjct: 411 MFYR-KKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVT 469

Query: 474 EMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPL 533
           EMKIGRKVVTRV +F+   +   + AA+LRKLCS STTIG+TV++P V+E+QVQGAHGPL
Sbjct: 470 EMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPL 529

Query: 534 IIDHLRELGVPSSWVVFEN 552
           IID+L + G+P+ W+ FE+
Sbjct: 530 IIDYLNKQGIPTKWIDFES 548

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  438 bits (1126), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 248/567 (43%), Positives = 347/567 (61%), Gaps = 26/567 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MF+K PHIK LSNLKNS+++KL Q +  Q G D++    + VKQTNFQ+ T++GTIY ++
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYT-CPSIVKQTNFQTPTTIGTIYTDE 59

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           + IP+  +FKEKH    L+ +VY CW+   LLPI L+H  VI++ LFNGANLMISGT+PP
Sbjct: 60  KNIPI--WFKEKHDP-RLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPP 116

Query: 121 FDVAHLHKGRPCGIANYKSPD-VIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGL 179
           FD   L  G  CG+A+ + P  V+ A+G + MDL  F                  F D L
Sbjct: 117 FD-EKLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHH--FEDEL 173

Query: 180 ADAFRLKLDIP---------DKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLET 230
             +F++ L  P         +  E    +          + T  ++    V+DLAEVL+ 
Sbjct: 174 FKSFKIDLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDH 233

Query: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290
           LSV+DVDYF+TRALYYT+T + KL+LPI+ASNF+S H+ K LP  +D  EVN+KKSSWKK
Sbjct: 234 LSVQDVDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPD-VDHNEVNIKKSSWKK 292

Query: 291 TAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAES--GPKSQT 348
           TAK+LKHF                      +KT   LK+FVPY +G+S  E+    K   
Sbjct: 293 TAKFLKHFEKEGFLKLKGKGDDLTVVGM--NKTKDELKNFVPYKLGSSNGENKGAKKEGD 350

Query: 349 TNGPVMFAVTSFQPDSTAQTALPLGG---QRYFSGPEIREVLNEYITANKLAQPNNPKMV 405
           +   +M+++T ++P + A+  +   G   +  +   EIR+ +N YIT   L    N KMV
Sbjct: 351 SQSGMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMV 410

Query: 406 LLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGE 465
           LL+D LFGMV K   +  T  R ++R +ILE  +K +F   +Q++  + TPL K P +G 
Sbjct: 411 LLDDLLFGMVNKKRTD-PTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGS 469

Query: 466 PPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQ 525
           PP++ I+TEMKIGRKV+T+V NF+   I     AADLRK+CS STTIG+T+++P  +E+Q
Sbjct: 470 PPRIKILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQ 529

Query: 526 VQGAHGPLIIDHLRELGVPSSWVVFEN 552
           VQG HG +IIDHL +LGVP+ W+ +EN
Sbjct: 530 VQGPHGQIIIDHLNKLGVPTKWIDYEN 556

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  437 bits (1125), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 246/570 (43%), Positives = 355/570 (62%), Gaps = 30/570 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KLQ++ + Q   +E+ F  NT+KQTNF+  T++GTIY ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
                P++FKEKH    L+P+V ACW  P L+P++LTHS+V+EDH+FNGANLMISGT+PP
Sbjct: 61  GN--APIWFKEKHDE-KLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD   L  G  CGIA+ ++P++I+AVG ++M+L  F  T                 D L 
Sbjct: 118 FD-ERLTVGTVCGIADKRTPNLIVAVGIVQMNLPSF--TRVIGETGVAVQIVHHLEDELF 174

Query: 181 DAFRLKLDIPDKL---ESATTQXXXXXXXXXXKPTSPVTNP------VAVDDLAEVLETL 231
             F++K + P +L   +S++++            T   +N         +DD+AEVL+ L
Sbjct: 175 KVFKVKEEPPAELLQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDEL 234

Query: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291
            +ED+DYF+TRALYYT++Q+ KL  P +ASNF+S H+   LPKG +  EVN+KKSSWKKT
Sbjct: 235 RLEDIDYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKT 294

Query: 292 AKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPY-LVGNSIAESGPKSQTTN 350
           AK+LKHF                       K    +K F+PY ++GN  + +G +     
Sbjct: 295 AKFLKHFEKEGFLKLKGVGDDLTIVEVNKDKDE--IKQFLPYPVIGNQGSNTGSEGGNAK 352

Query: 351 GPVMFAVTSFQP-----DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMV 405
             +   VT ++P     D  +   +PL  ++ +  PEI+E++N+YIT   L    + K V
Sbjct: 353 TTIKI-VTLYKPINLAKDFISSNKVPL--KQLYMEPEIKELINKYITMKDLVDKKDKKCV 409

Query: 406 LLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFK---DKDTPLTKHPQ 462
           L++D L  M+ K  E++ T  R++ R  IL+ V++ +F   Y LF+   ++ TPLTK P 
Sbjct: 410 LVDDMLMTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPL 469

Query: 463 KGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTP-VV 521
           KGEPPK++I+TEMKIGRKV+T+V NF+   I   EFAAD+RK CS STTIG+T S+    
Sbjct: 470 KGEPPKINIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKT 529

Query: 522 SEIQVQGAHGPLIIDHLRELGVPSSWVVFE 551
           +E+QVQG HG LI+ +L +LG+P+ W+ FE
Sbjct: 530 AEVQVQGPHGQLIMSYLNDLGIPNKWIDFE 559

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  429 bits (1104), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 238/581 (40%), Positives = 350/581 (60%), Gaps = 34/581 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKKTP++K  SNLKNSE++KL Q  ++Q    ++ F  + +KQ N++  TS GT+Y ++
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           +   VP++FKEKH S  L+PSVY CW +P LLPII+T+S VIE+ + NGANLMISGT+ P
Sbjct: 61  QN--VPIWFKEKH-SDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD   L  G  CGIA+YK P+V++A+G +++DL+ +  T                 DGL+
Sbjct: 118 FD-ERLICGALCGIASYKKPNVVMAIGIVQLDLQSY--TKVVGETGVAVNVLHYLGDGLS 174

Query: 181 DAFRLKLDIPDK----------LESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLET 230
           D+F++ L+ P+           L +   Q          K  +P   P   DDLAEVLET
Sbjct: 175 DSFKMNLEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPN--DDLAEVLET 232

Query: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290
           L V+ +D F+T++LYY+LT +PKL  PI+ASNF+S ++M  LP  +D   VN+KKSSWKK
Sbjct: 233 LPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPP-VDNDMVNLKKSSWKK 291

Query: 291 TAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTT- 349
           TAK+L+HF                       KT   LK FVPY  GN  +    K +T  
Sbjct: 292 TAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTE--LKSFVPYRTGNGNSTKSKKDKTND 349

Query: 350 ---NGPVMFAVTSFQPDSTAQTALPLG---GQRYFSGPEIREVLNEYITANKLAQPNNPK 403
              NG +M +V+ ++P S  +  +       +  ++  E+R+ + EYI    L    N K
Sbjct: 350 TSDNGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKK 409

Query: 404 MVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDT----PLTK 459
           M+L++D ++ +V K  ++     R+++R +++E + K +F   +Q++K  D     PL K
Sbjct: 410 MILMDDLMYSLVYK--KKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFK 467

Query: 460 HPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTP 519
            P +G  PKV I+TEMKIGRKV+TRV NF+  +I     AADLRKLC+ +TTIG+T+++P
Sbjct: 468 KPIRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSP 527

Query: 520 VVSEIQVQGAHGPLIIDHLRELGVPSSWVVFENKVKPKKKR 560
             +E+QVQG H  +II HL  L +P+ W+ F+N VKPK+K+
Sbjct: 528 KTAEVQVQGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  422 bits (1084), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 248/568 (43%), Positives = 346/568 (60%), Gaps = 27/568 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL Q   KQ   +E+ F  + +KQTNF    SVGT+Y ++
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
             IP+   FKEKH    L+P+VY+CW +P LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  NNIPI--LFKEKHCE-QLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD +  + G  CG+A  +SP V++A+G +++DL  ++                 F DGL 
Sbjct: 118 FD-SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHH--FNDGLF 174

Query: 181 DAFRLKLDIP---------DKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETL 231
            AF++KL+ P         + + S  T+             S       ++++AEVL+ L
Sbjct: 175 KAFKVKLEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHL 234

Query: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291
           +V DVDYF+TRALYY+LTQ+  L LPI+AS F+S H+M+ LP  ID  EVNVKKSSWKK+
Sbjct: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPP-IDHNEVNVKKSSWKKS 293

Query: 292 AKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTN- 350
           AK+LKHF                       K    LK+FVPY +G S    G     T+ 
Sbjct: 294 AKFLKHFEKEGILKLKGKGDDLTIVGKNTDKDE--LKNFVPYKLGCSSPSKGSGENATSK 351

Query: 351 ---GPVMFAVTSFQPDSTAQTAL---PLGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404
                +M ++T ++P S A+  L    LG   Y++  ++R  ++EYI+   LA   + + 
Sbjct: 352 DRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRK 411

Query: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKG 464
           V+++D LF MV K  +   TT RI+AR EIL+ ++  +F   YQ+F++ DT L + P KG
Sbjct: 412 VVMDDLLFNMVNKKKKTPDTT-RIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKG 470

Query: 465 EPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEI 524
            PP++ I+TEMKIGRKV+T+V NF+  +I     AADLRK+CS STTIG++  T   +E+
Sbjct: 471 CPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGES-QTFKSAEV 529

Query: 525 QVQGAHGPLIIDHLRELGVPSSWVVFEN 552
           QVQG HG  IID+L + G+PS W+ FEN
Sbjct: 530 QVQGPHGQFIIDYLNKSGIPSKWIDFEN 557

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  415 bits (1066), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 239/565 (42%), Positives = 335/565 (59%), Gaps = 25/565 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFV-FSGNTVKQTNFQSTTSVGTIYLN 59
           MFKK P IK LS LKNS+++KL Q ++ Q   DE +  +G+++ QTNF STT+ GTIY +
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  DEKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMP 119
              IP+   FK KH S  L+P+ +  WS+ GLL  + THSVV+E+++FNGA+LMI+GT+P
Sbjct: 61  SNSIPI--MFKTKH-SDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVP 117

Query: 120 PFDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGL 179
           PFD + L  G  C +A  ++PDV IAVG +K++L  +                  F D L
Sbjct: 118 PFD-STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHH--FEDAL 174

Query: 180 ADAFRLKLDIPDKLES-------ATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETLS 232
              F+ KL+IP  ++S       A               T P +     DD+AEVL+ L+
Sbjct: 175 FSTFKAKLEIPASVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDELT 234

Query: 233 VEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTA 292
           VEDVDYF+ RALY+T+ Q+  L LP+ AS FMS H+M+ LP  +D  +VN+K++SWKKTA
Sbjct: 235 VEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLP-DVDHKKVNIKRTSWKKTA 293

Query: 293 KYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTN-- 350
           K+LK+F                       K    LK+FVPY +GN+  ++  KS +T   
Sbjct: 294 KFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDE--LKNFVPYKIGNTAKKAASKSDSTQTQ 351

Query: 351 GPVMFAVTSFQPDSTAQTALP---LGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLL 407
           G  + +V  ++P +  Q  +    + G   ++  EIR  +N+YI    L    + KMV+L
Sbjct: 352 GVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVML 411

Query: 408 NDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPP 467
           +D LF MV +   +     RI+ R  ILE ++  +F   +QL+K  +TPL K+P KG+ P
Sbjct: 412 DDLLFAMVNR-KIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTP 470

Query: 468 KVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQ 527
           K+ I+TEMKIGRKVVTRV NF++  I   E AADLRKLCS STTI +T     VSE+QVQ
Sbjct: 471 KIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPKK--VSEVQVQ 528

Query: 528 GAHGPLIIDHLRELGVPSSWVVFEN 552
           G HG LIIDH  + G+PS ++ FEN
Sbjct: 529 GPHGQLIIDHFNKSGIPSKFIQFEN 553

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  413 bits (1062), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 235/567 (41%), Positives = 339/567 (59%), Gaps = 26/567 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PH+K LSNLKNSE +KL    + Q G  E+ F    +KQTNFQ+ + +GT+Y + 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           +  P+  +FKEKHG+  L+P+V+ACWSHPGLLP++LTH  V+E+ LFNGANLM++GT+ P
Sbjct: 61  DNKPI--WFKEKHGN-LLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD + L  G  CGIA+  +PDV++AVG +++DL  +++                  DGL+
Sbjct: 118 FD-SRLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHY--LPDGLS 174

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKPTSPVTN-------PVAVDDLAEVLETLSV 233
             F++  + P  LE +  +              P +         V +DD+AEVL+   +
Sbjct: 175 KVFKVNAEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRL 234

Query: 234 EDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAK 293
           EDVD F+TRALYYTLT + KL LPI+ASNF+S H+   LP  +D  +VNVKKSSWKKTAK
Sbjct: 235 EDVDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLP-SVDHEKVNVKKSSWKKTAK 293

Query: 294 YLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKS----QTT 349
           +LK+F                       K    L++F PY +       G  S    +  
Sbjct: 294 FLKNFEKEGFLKLKGKGDDLTIIGINKQKPE--LQNFQPYQISGGSGGGGNSSSNNNKKD 351

Query: 350 NGPVMFAVTSFQPDSTAQTAL---PLGGQR-YFSGPEIREVLNEYITANKLAQPNNPKMV 405
             P +   T ++P + A+  +    L  Q   ++  E++  LN+YI +N LA   N KMV
Sbjct: 352 GSPQLRCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMV 411

Query: 406 LLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGE 465
           +L+D L+ +V K  ++  T  R+++R  I+E ++   F   +Q++K  D PL K+P +G 
Sbjct: 412 ILDDLLYHLVNK-KQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGN 469

Query: 466 PPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQ 525
            P + I+TEMKIGRKV+TRV  F+  +I + E AA LR+LCS STTIG+T+++P   E+ 
Sbjct: 470 LPNIEIVTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVT 529

Query: 526 VQGAHGPLIIDHLRELGVPSSWVVFEN 552
           VQG HGPLIIDHL  LG+P+ W+ F+N
Sbjct: 530 VQGPHGPLIIDHLNSLGIPTKWIKFDN 556

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  412 bits (1058), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 245/578 (42%), Positives = 347/578 (60%), Gaps = 31/578 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKKTPHIK LSNLKNSE++KL Q  + Q G  ++ F  + +KQTNF + TSVG IY ++
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           E    PL+FKEKH S  L+P+VY CW  P LLPI+LTH +VI +H+FNGANLMISGT+PP
Sbjct: 61  EG--SPLWFKEKH-SELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD + L     CGIA   +P+ I+AVG +++D+  +++                + DG++
Sbjct: 118 FD-SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHY--WGDGMS 174

Query: 181 DAFRLKLDIP------DKLESATTQXXXXXXXXXXKPTS----PVTNPVAVDDLAEVLET 230
            AF++K DIP      DK   AT            + T     P  +   V +LA+    
Sbjct: 175 VAFKMKRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESA 234

Query: 231 LSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKK 290
           L+VED+D+F+TR+LYYTLT + KLA PI +S+F+S H+M+ LP  +D   VN+KK+SWKK
Sbjct: 235 LTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPP-VDHNLVNIKKTSWKK 293

Query: 291 TAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPK---SQ 347
           ++K+LKHF                   S   K         PY + NS + SG K   ++
Sbjct: 294 SSKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKF--EPYRISNSSSNSGKKINSNR 351

Query: 348 TTNGPVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404
             +  +M+++  + P  +A+   T   L  + +++  E++  + EYI   +L    NPKM
Sbjct: 352 QESENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKM 411

Query: 405 VLLNDTLFGMVTKGNEEKQTTK--RIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQ 462
             L+D L+ M       K++T   R + R  ++E     +F  LYQLFK+ DTPLTK+P 
Sbjct: 412 ANLDDRLYDMCYT----KKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPV 467

Query: 463 KGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVS 522
           +G PP++ I+TEMKIGRK+VTRV NF+   I     A DLR+LCS STTIG+T ++P  +
Sbjct: 468 RGSPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTT 527

Query: 523 EIQVQGAHGPLIIDHLRELGVPSSWVVFENKVKPKKKR 560
           E+QVQG H  +IIDHL  L +P+ W+ FENK+KPKK R
Sbjct: 528 EVQVQGPHSKIIIDHLNSLSIPTKWIDFENKLKPKKIR 565

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  392 bits (1008), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 236/590 (40%), Positives = 337/590 (57%), Gaps = 62/590 (10%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSG-NTVKQTNFQSTT--SVGTIY 57
           MFKK PHIK LSNLKNS+++KL Q ++ Q  ++ + F+  N +KQTNFQ+T   S+GTI+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  LNDEKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGT 117
            ND  IP+  +FK KH    L+P+V+ CW++  +LP +L+H  VI++ LFNGANLMISGT
Sbjct: 61  TNDSNIPI--WFKSKHND-LLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGT 117

Query: 118 MPPFDVAHLHKGRPCGIANYKSPDVII-AVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFA 176
           +PPFD + L  G  CGIA+ + P  I+ A+G +KM++  F+                 F 
Sbjct: 118 IPPFD-SRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHH--FE 174

Query: 177 DGLADAFRLKLDIPDKL--ESATTQXXXXXXXXXXKPTSPVTNPVAVDDLA--------- 225
           D L   F+     PD+   E   T+              P  N VA +D           
Sbjct: 175 DELFKIFKCNDLKPDEFVKEQLNTE-------------HPQDNDVADEDTTRKKEENRES 221

Query: 226 -----EVLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATE 280
                EVL+    EDVDYF+TR+LYYT+TQ+ K+ LPI+ASNF+S H+ K LP  I   E
Sbjct: 222 NEPDFEVLDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLP-DISHNE 280

Query: 281 VNVKKSSWKKTAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNS-- 338
           VN+KK+SWKKTAK+LKHF                      +KT   LK+FVPY +G S  
Sbjct: 281 VNIKKTSWKKTAKFLKHFEKEGFLKLKGKGDDLTVVGM--NKTKDELKNFVPYKIGKSTT 338

Query: 339 ----IAESGPKSQTTNGPVMFAVTSFQPDSTAQTALP----LGGQRYFSGPEIREVLNEY 390
               ++      ++    +M++ T ++P + A+  L     +  +  ++  EIR+++  Y
Sbjct: 339 PSFSLSSPNTNDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSY 398

Query: 391 ITANKLAQPNNPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLF 450
           I +  L    N KM+LL+D LF MV K   E     R M R  ILE ++  +F   YQ++
Sbjct: 399 INSKNLIDMKNKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIY 458

Query: 451 KDKD---------TPLTKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAAD 501
           + ++          PL K PQ+G  P++ I+TEMKIGRKV+T+V NF+   I     AAD
Sbjct: 459 RKRNGKGELMEDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAAD 518

Query: 502 LRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDHL-RELGVPSSWVVF 550
           LRKLCS STTIG+T+++P   E+QVQG HG +IIDHL ++ GVP+ W+ +
Sbjct: 519 LRKLCSGSTTIGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  387 bits (995), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 224/564 (39%), Positives = 328/564 (58%), Gaps = 23/564 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK P IK LSNLKNSE++KLQ + ++Q    ++ F    +KQT F++  + GT+Y +D
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           + IP+  +FKEK  S  L+P+V++CWS+  L+PI+L H  V+E+ L  GANLM+ GT+PP
Sbjct: 61  KNIPI--WFKEKF-SDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD     K +  G+A+  SPDV+ A+G ++++L  +  +               F D L 
Sbjct: 118 FD-ERCVKTKMVGVASTHSPDVVKAIGIVQLNLPQY--SRVIGESGVAVEIVHTFDDELC 174

Query: 181 DAFRLKLDIPDKL--------ESATTQXXXXXXXXXXKPTSPVTNPVA-VDDLAEVLETL 231
            AF++KL  P+          E  +            KP++P+  P+  +DD AE L  L
Sbjct: 175 KAFKVKLQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQL 234

Query: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291
           SVEDVD+F TRALYYTLTQ+ KL +P +ASNF+S H+++ LP  +D T+VN+KK+SWKKT
Sbjct: 235 SVEDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPP-LDHTQVNMKKTSWKKT 293

Query: 292 AKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNG 351
           AK+LKHF                       KT   LK FVPY  G +   S       N 
Sbjct: 294 AKFLKHFEKEGFLKLKGKGDDLTIVGL--DKTKDELKHFVPYRTGGNSGGSTGSESEQNS 351

Query: 352 PVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLN 408
            +M A+  ++P S+A+    A  L     FS  E++  ++ YI +  L   +N   V L+
Sbjct: 352 -MMKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLD 410

Query: 409 DTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPK 468
           D LF +V +  + K+   R + R +I+  ++K +F   + + K   TPL KHP KG+ P+
Sbjct: 411 DLLFSLVNRSTK-KENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQ 469

Query: 469 VHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQG 528
           + I+TEMKIGRKVVT+V NF+   +   E A  LRK CS STTIG+T ++P  +E+ VQG
Sbjct: 470 IQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQG 529

Query: 529 AHGPLIIDHLRELGVPSSWVVFEN 552
            HGP +I+ L +L +P+ W+ F N
Sbjct: 530 PHGPAVIELLNQLAIPTKWINFVN 553

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  379 bits (973), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/573 (38%), Positives = 331/573 (57%), Gaps = 33/573 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK P IK LSNLKNSE++ +Q + ++Q G  E+ F    +KQT F++  + GT++ + 
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           +   VP++FKEK  S  L+P+V+ CWS+  LLPI+L H  V+E+ L  GANLM+ GT+PP
Sbjct: 61  KN--VPIWFKEKF-SDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           FD     K R   +A+  +PDV+ A+G ++++L  +  +               F D L 
Sbjct: 118 FD-ERCVKTRMVSVASTAAPDVVKAIGIVQINLPQY--SRVIGESGVAVEIVHTFGDELC 174

Query: 181 DAFRLKLDIPD---KLESATTQXXXXXXXXXXKPTSP-----------VTNP-VAVDDLA 225
             F++KL  P+    +  + ++           P++P           V  P V V+D++
Sbjct: 175 KVFKVKLQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDIS 234

Query: 226 EVLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKK 285
           E L  L VEDVD+F TR+LYY+L  + KL  PI+ASNF+S H+++ LP  ID T+VN+KK
Sbjct: 235 EQLTELRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPP-IDHTQVNMKK 293

Query: 286 SSWKKTAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGN--SIAESG 343
           +SWKKTAK+LK+F                       +T + LK+F PY +G   S +E G
Sbjct: 294 TSWKKTAKFLKYFEKEGFLKLKGKGDDLTIIGV--DRTKSELKNFAPYRIGGGASSSEKG 351

Query: 344 PKS---QTTNGPVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLA 397
             S   +     VM AV+ ++P S+ +   +A  L   + F+  +I+  +++YI+A  L 
Sbjct: 352 ASSVANEKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLV 411

Query: 398 QPNNPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPL 457
            P+N   V L+D L+ +V + ++ K+   R +AR +I+  V+K +F   + + K   TPL
Sbjct: 412 SPDNKSAVRLDDLLYDLVNRSSK-KENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPL 470

Query: 458 TKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVS 517
            KHP KG  P+V I+TEMKIGRKVVT+V NF+   +   E A  LRK CS STTIG+  +
Sbjct: 471 FKHPVKGSIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANT 530

Query: 518 TPVVSEIQVQGAHGPLIIDHLRELGVPSSWVVF 550
           +P   E+ VQG HGP +I+ L E G+P+ W+ F
Sbjct: 531 SPKTLEVTVQGPHGPAVIELLNESGIPTKWINF 563

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  378 bits (970), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/562 (39%), Positives = 334/562 (59%), Gaps = 22/562 (3%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK PHIK LSNLKNSE++KL   V++Q  V ++ F    VKQT F+  TS GT+Y ++
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           +   VP++FKEKHGS  ++P+V+ CWS+P +LP++ TH  V+E+ L  GA+LM+ G +PP
Sbjct: 61  QN--VPIWFKEKHGS-LMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           F  +   KG   G+A+ +SP VI A+G +++DL  +  T               F DGL 
Sbjct: 118 FS-SKCSKGSLVGVASTRSPRVIKAIGIVQLDLPSY--TRVIGETGVAVNIIHTFDDGLC 174

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKP-------TSPVTNPVAVDDLAEVLETLSV 233
            AF++KL+ P+ +E  +++                   T+     V  +D +E L  LS 
Sbjct: 175 KAFKMKLEPPEAIEDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSA 234

Query: 234 EDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAK 293
           ED+D+F+TR+LYYTLTQ+ +L LP+NASNF+S H++  LP  +D  ++N+KKSSWKK+AK
Sbjct: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPP-VDHNQINMKKSSWKKSAK 293

Query: 294 YLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTT-NGP 352
           +LKHF                       K    LK FVPY +G+    +  K++   N  
Sbjct: 294 FLKHFEKANFLKLKGKGDDLVVVGINKDKDE--LKKFVPYRIGSHGEPTQTKAKAQENSN 351

Query: 353 VMFAVTSFQPDSTAQT---ALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLND 409
           +M AV+ ++P S+A+    A+ L   + F+  E++  L+ YI    L   ++ KMVLL+D
Sbjct: 352 MMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDD 411

Query: 410 TLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKV 469
           TLF M+ +  + K+   R ++R +I+   +  +F   +Q+ K  D PL K   KG  P++
Sbjct: 412 TLFPMINRSTK-KENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEI 469

Query: 470 HIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGA 529
            I+TEMKIGRKVVT+V NF+   +     AA+LRK CS STTIG+T+S+P   E+ VQG 
Sbjct: 470 QIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGP 529

Query: 530 HGPLIIDHLRELGVPSSWVVFE 551
           HG ++I  L E G+P+ W+ F+
Sbjct: 530 HGAIVIGMLNEYGIPTKWINFQ 551

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  366 bits (940), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/576 (38%), Positives = 312/576 (54%), Gaps = 30/576 (5%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK   I  LSNLKNSE R ++Q  +     +E+ F G+ VKQT F+ST + G IY + 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
               VP++FK+K+ S  + P+VY  W +P  +PII TH  +IE  +FNGANLMI GT+ P
Sbjct: 61  NN--VPIWFKQKY-SNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
            D   L  G+ CGIA+ K P  I+A+G    D+   +T                ++D L 
Sbjct: 118 HD-ERLKPGKICGIASTKVPGTILAIGLCTFDMSTVDT--PLGKTGVAVEVLHWYSDELT 174

Query: 181 DAFRLKLDIP--------DKLESATTQXXX---XXXXXXXKPTSPVTNPVA--VDDLAEV 227
           + F++KL+ P          LES T +             KP +P  +      DDLAE 
Sbjct: 175 NIFKIKLNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAET 234

Query: 228 LETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSS 287
           LE L VED+D F+T++LYYT+TQE  L LPI +S F+S +LMK LP  +D  +VN+KKSS
Sbjct: 235 LEQLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLP-NVDHNQVNIKKSS 293

Query: 288 WKKTAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQ 347
           WKKTAK+LKHF                       K    LK FVPY +G        K +
Sbjct: 294 WKKTAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQ--LKTFVPYRIGKPAGALPSKDK 351

Query: 348 TTNGPVMFAVTSFQP---DSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404
             N   +  VT + P   + +  TAL L  + YF+  EI   +  YI    LA P +   
Sbjct: 352 QDNKNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAK 411

Query: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKG 464
           + ++D LF +V   N  K    R + R +++E V+  +F   +QLF   +  L+KHP+KG
Sbjct: 412 ISMDDVLFDLVITNN--KANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKG 469

Query: 465 EPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEI 524
            PP V ++TE     KV+TRV NF+  NI   + + +L+ LCS ST+I +    P  SE+
Sbjct: 470 SPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEE---LPNGSEV 526

Query: 525 QVQGAHGPLIIDHLRELGVPSSWVVFENKVKPKKKR 560
           QVQG HG +++++  + G+P  W  + NKVKPKK+R
Sbjct: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  336 bits (862), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/563 (35%), Positives = 305/563 (54%), Gaps = 24/563 (4%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK P++ P SN KNSE+++LQ  +++Q+  + + FS   +K   F++ ++VGT+Y + 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
             I  PL+F+ KH    + P+VY+CW HP LLP++ TH  V+E  L  GA+LM+ GT+PP
Sbjct: 61  NNI--PLWFRGKHDQTYI-PTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           F  +   +GR  GIA+ ++P V+ AVG  +MDLE    T               + DGL 
Sbjct: 118 FS-SGTRRGRVVGIASTRAPGVVKAVGICEMDLE--GVTTVADTTGVAVRVLHTYGDGLC 174

Query: 181 DAFRLKLDIPDKLESATTQXXXXXXXXXXKPTSPVTNPVAVDDLAEVLETLSVEDVDYFM 240
             F+++ + P+  E+                T+P       + LAE LE L++EDVD+ +
Sbjct: 175 RVFKVQREAPEASEAKGASPEAREPEAEPPKTAP------GEGLAEELERLTMEDVDHLL 228

Query: 241 TRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKTAKYLKHFXX 300
           TRA+YYT+  + +L LP+ AS F++ H++K LP  +D ++V VK+SSW K AK LKHF  
Sbjct: 229 TRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPP-MDLSQVTVKRSSWGKAAKLLKHFEA 287

Query: 301 XXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTNGPVMFAVTSF 360
                               +  H  LK F PY   +  A +G K+ +T   +   V  +
Sbjct: 288 QGLLTLKGKPESFTVVSVNSA--HEALKSFEPYRTVSDKASTGSKNSSTTQSLEI-VYHY 344

Query: 361 QPDST---AQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTK 417
            P+ T       L + G    S  +IR+ L +Y+ A K   P +  M+ L+DTL  ++ K
Sbjct: 345 VPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQLLHK 404

Query: 418 GNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKI 477
                  T R + RPE L  ++   F   + + +  D PL+K PQKG  P + +  E KI
Sbjct: 405 NV--NADTPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNERKI 460

Query: 478 GRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEIQVQGAHGPLIIDH 537
            +KVVT+V NF+   +   E AA+LR  CS STTI    +T  V E+QVQG H   I+  
Sbjct: 461 YKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAV-EVQVQGPHEATIVSI 519

Query: 538 LRELGVPSSWVVFENKVKPKKKR 560
           L + G+PS ++  + KV+PKKK+
Sbjct: 520 LNKHGIPSKYITLDCKVQPKKKK 542

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 199/579 (34%), Positives = 316/579 (54%), Gaps = 35/579 (6%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MFKK P IK  SNLKNSE++KL   V+ Q    EF FS   VKQ  F++ T+ GTI+ ++
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120
           +  P+  FFKEKH S  L P++  CW +PGLL ++LTH  V+++ L NGA+LM+ GT+PP
Sbjct: 61  DNKPI--FFKEKH-SEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPP 117

Query: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGLA 180
           F   +  +G+  G+A+ ++P V+ A+G  +++L                       DGL 
Sbjct: 118 FS-DNCTRGKLVGVASSETPFVVEAIGVCQLNLA--GIVKVVGETGVAVKVLHTINDGLW 174

Query: 181 DAFRLKLDIPDKL----------------ESATTQXXXXXXXXXXKPTSPVTNPVAVDDL 224
           + F++ ++ P +L                + A               + P+  P ++ ++
Sbjct: 175 EVFKMSVEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEV 234

Query: 225 AEVLETLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVK 284
           AE LE LS+E VD+F+T+A+YYTL  +  L LPI ASNF++ H+MK LP+ I  T+V++K
Sbjct: 235 AEQLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPR-IHKTQVSLK 293

Query: 285 KSSWKKTAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPY-LVGNSIAESG 343
           +SSW + +K+LK+F                       KT   +K F PY  +  S++ S 
Sbjct: 294 RSSWARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTE--IKSFQPYRTIQKSVSTSS 351

Query: 344 PKSQTTNGPVMFAVTSFQPDSTAQTALPLGGQR---YFSGPEIREVLNEYITANKLAQPN 400
             +   +  V   V  +QP +TA+  L   G          +I+ +LN+Y+T  KL    
Sbjct: 352 KNNDKHDVEV---VVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNAT 408

Query: 401 NPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKH 460
           + +++LL+DTLF +  K +    T  R + R ++ + ++   F  ++ +FKD   PL+  
Sbjct: 409 DERIILLDDTLFSLAYKKSASDST--RKVLRAKMFDLILSTSFTEVFFIFKD-GKPLSSK 465

Query: 461 PQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPV 520
           P K +   V ++TEMKI RK+VTR+ NF+   +   E + +LRK CS S+T+ +  +   
Sbjct: 466 PLKSKNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQS 525

Query: 521 VSEIQVQGAHGPLIIDHLRELGVPSSWVVFENKVKPKKK 559
            +E+QVQG HG   I+ L E G+PS ++ F+NK+  KKK
Sbjct: 526 TTEVQVQGPHGNTAINILNEHGIPSKYIDFDNKLNKKKK 564

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  313 bits (803), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 201/575 (34%), Positives = 312/575 (54%), Gaps = 38/575 (6%)

Query: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60
           MF K PHIKPLSNLKNS+++KLQ  +++Q   +E+      +KQT+FQ     G+IY ++
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQIN-EEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  EKIPVPLFFKEKHGSGPLWPSVYACWS-HPGLLPIILTHSVVIEDHLFNGANLMISGTMP 119
              P+  +FK K     L+P++++ W+    LLPIILTH  VIE H+  GA LM+ GT+P
Sbjct: 60  SNKPI--WFKTKF-EDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVP 116

Query: 120 PFDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTXXXXXXXXXXXXXXXFADGL 179
           PF  +++ +G   GIA+ K P ++ A+G  +MDL     +                 DGL
Sbjct: 117 PFP-SNVKRGSIVGIASTKDPLLVKAIGIAEMDL--CGISHVIGTKGIAVRVVHYLDDGL 173

Query: 180 ADAFRLKLDIP------DKLESATTQXXXXXXXXXXKPTS----PVTNPVAVDDLAEVLE 229
             AF+L+L+ P      + +E+   +             S      ++   V+++A+ LE
Sbjct: 174 FKAFKLELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELE 233

Query: 230 TLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWK 289
            +S+EDVD+ + RA+ Y++  + K+ LPI AS F+S H+MK LP  +D   VN+KKSSWK
Sbjct: 234 EMSIEDVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLP-DVDTNMVNIKKSSWK 292

Query: 290 KTAKYLKHFXXXXXXXXXXXXXXXXXXXSTDSKTHAGLKDFVPYLVGNSIAE--SGPKSQ 347
           K  K LK+                     + +K H  L +   Y    +IA+  SG  + 
Sbjct: 293 KATKLLKYLEDEGFLKLKGKNDSCTVI--SLNKNHKDLTNMEAYKTLATIAKKSSGDTTN 350

Query: 348 TTNGPVMFAVTS---FQPDSTAQ---TALPLGG-QRYFSGPEIREVLNEYITANKLAQPN 400
            +N   + A +    ++P S  Q   T +     Q Y++  E++++L+ Y+  N L  P 
Sbjct: 351 QSNKNKITAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPE 410

Query: 401 NPKMVLLNDTLFGMVTKGNEE---KQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPL 457
           N  +V  +DTL+ M  +  +    ++  + ++  P  L +    +F T +Q++K    PL
Sbjct: 411 NKSLVKYDDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSK----NFNTYHQIYKPNGEPL 466

Query: 458 TKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVS 517
            K P+KG  P + I+TE KIGRKV+TRV NF+   I   E AA LRK CS STTIG++ S
Sbjct: 467 LKVPEKGPIPTLEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKS 526

Query: 518 TPVVSEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552
           T   +E+QVQG HG ++I  L + G+P+ W+ FEN
Sbjct: 527 TK-TAEVQVQGPHGSIVISILNDYGIPTKWISFEN 560

>SAKL0F04576g Chr6 (369113..369120,369587..370121) [543 bp, 180 aa]
           {ON} similar to uniprot|P89886 Saccharomyces cerevisiae
           YER007C-A TMA20 Protein of unknown function that
           associates with ribosomes
          Length = 180

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 20/156 (12%)

Query: 12  SNLKNSEQRKLQQEVQKQF-----GVDEFVFSGNTVKQTNFQSTTSVGTIYLNDEKIPVP 66
           SN+K+S QR L+ ++ KQF      +DE V   + V+    +       +Y  D +I   
Sbjct: 13  SNVKSSVQRTLKSKLVKQFPKLEEVIDELVPKKSQVELIKCEDKIQ---LYAVDGEI--- 66

Query: 67  LFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPPF----D 122
           LFF++ +    L P++      PG  P +      I+  + +GAN+M  G   P     D
Sbjct: 67  LFFQKFND---LIPTLKFVHRFPGAFPTVQVDRGAIK-FVLSGANIMCPGLTSPGAKLPD 122

Query: 123 VAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNT 158
              L K     I N ++ +  +A+GTL M  E   +
Sbjct: 123 APGLEKDAIV-IVNAENKEHALAIGTLLMSTEDIRS 157

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 46  NFQSTTSVGTIYLNDEKIPVPLFFKEKHGSGPLWPSVYACWSH----PGLLPIILTHSVV 101
           NF++   V +  L DE++ +PL +  + GS P  P V  CW +    PGL       + +
Sbjct: 204 NFETLRDVKSFTL-DEELVLPLMYMAEDGSVPKPPPVRKCWYYVKVRPGLKEFFAKVAPL 262

Query: 102 IEDHLFNGA 110
            E H++  A
Sbjct: 263 FEMHIYTMA 271

>Suva_15.367 Chr15 (645397..646191) [795 bp, 264 aa] {ON} YHR167W
           (REAL)
          Length = 264

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/150 (21%), Positives = 62/150 (41%), Gaps = 7/150 (4%)

Query: 378 FSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTKGNEEKQTTKRIMARPEILER 437
            +G E R          +  Q +   ++ + +TL  +    + +   T+ +   P + E 
Sbjct: 4   MTGEEGRTYFESLCEEEQSLQESQTNLLNILETLEALTNTESSDDSLTESLKNLPALHEE 63

Query: 438 VMKYHFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKIGRKVVTRVYN-FDHLNIRDT 496
           ++K   +  Y  ++ ++  L +  + G       I+     RK ++  Y  F+ LN RDT
Sbjct: 64  LLKSSIRLRYDKYQTREAQLLEDAESGRD-----ISAGAHNRKTISEYYTTFEQLN-RDT 117

Query: 497 EFAADLRKLCSASTTIGKTVSTPVVSEIQV 526
               +L K  S        VS P+V+E +V
Sbjct: 118 LRYINLLKRLSVDLAKQVEVSDPLVTEYEV 147

>Suva_2.116 Chr2 (201124..203163) [2040 bp, 679 aa] {ON} YBL009W
           (REAL)
          Length = 679

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 35/123 (28%), Positives = 46/123 (37%), Gaps = 14/123 (11%)

Query: 442 HFKTLYQLFKDKDTPLTKHPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAAD 501
           H   LY  FKD  TPL+  P+      + I  +      V    + F+H N+       D
Sbjct: 483 HDLVLYLFFKDHGTPLSGCPKIDYRQALSIFWQCVSILYVAESKFQFEHRNLTLDHILVD 542

Query: 502 LR--------KLCS-ASTTIGKTVSTPVVSEIQVQGAHGPL---IIDHLRE-LGVPSSWV 548
            R        K C   ST   K   T +      QG  G L   I + +R  L  P+SW 
Sbjct: 543 SRGNVTLIDLKCCRFVSTNTNKAFYTRLDHHFFFQG-QGNLQFEIYESMRSLLSQPTSWA 601

Query: 549 VFE 551
            FE
Sbjct: 602 TFE 604

>Kpol_1067.25 s1067 (57301..58476) [1176 bp, 391 aa] {ON}
           (57301..58476) [1176 nt, 392 aa]
          Length = 391

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 34/70 (48%), Gaps = 4/70 (5%)

Query: 362 PDSTAQTALPLGGQRYFSGPEIREVLNEYITANKLAQPNNPKMVLLNDTLFGMVTKGNEE 421
           PD     A    G  YF+   + E LN+Y    K  Q  NP   ++ND +  + ++   +
Sbjct: 323 PDLDQAKAYYRRGNAYFAKKRLEEALNDY----KNCQLKNPSDKVINDKIDLVESQIEAQ 378

Query: 422 KQTTKRIMAR 431
           K+ TK+ +A+
Sbjct: 379 KEKTKKNIAK 388

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,088,476
Number of extensions: 2398442
Number of successful extensions: 6457
Number of sequences better than 10.0: 33
Number of HSP's gapped: 6468
Number of HSP's successfully gapped: 33
Length of query: 561
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 446
Effective length of database: 40,294,809
Effective search space: 17971484814
Effective search space used: 17971484814
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)