Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H031908.270ON62262232460.0
KAFR0B054608.270ON6105887609e-92
Skud_4.3788.270ON6524256337e-73
Smik_4.3628.270ON6484286284e-72
YDR118W (APC4)8.270ON6525186205e-71
Suva_2.2778.270ON6494256064e-69
ZYRO0C01474g8.270ON5994775694e-64
TDEL0F039708.270ON6194455345e-59
NCAS0B037908.270ON6125605232e-57
Kpol_392.18.270ON4244254865e-54
TPHA0J007908.270ON6854384991e-53
CAGL0B01859g8.270ON6224124193e-43
NDAI0J012708.270ON7353754012e-40
TBLA0C045708.270ON6083393912e-39
KLTH0G13508g8.270ON6454863071e-28
Kwal_56.237668.270ON7404152742e-24
SAKL0H16852g8.270ON6444922671e-23
Ecym_43008.270ON7153641493e-09
AGR078C8.270ON7153501466e-09
KLLA0F19316g8.270ON6711581252e-06
TPHA0I028807.484ON456114724.3
CAGL0E01749gsingletonON48256715.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H03190
         (622 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...  1254   0.0  
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   297   9e-92
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   248   7e-73
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   246   4e-72
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   243   5e-71
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   238   4e-69
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   223   4e-64
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   210   5e-59
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   206   2e-57
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   191   5e-54
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   196   1e-53
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   166   3e-43
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   159   2e-40
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   155   2e-39
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   122   1e-28
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   110   2e-24
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   107   1e-23
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    62   3e-09
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    61   6e-09
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    53   2e-06
TPHA0I02880 Chr9 (633548..634918) [1371 bp, 456 aa] {ON} Anc_7.4...    32   4.3  
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...    32   5.7  

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score = 1254 bits (3246), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/622 (97%), Positives = 608/622 (97%)

Query: 1   MTEDALYARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTI 60
           MTEDALYARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTI
Sbjct: 1   MTEDALYARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTI 60

Query: 61  GGEIISVMFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDII 120
           GGEIISVMFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDII
Sbjct: 61  GGEIISVMFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDII 120

Query: 121 TQSLPRLVKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNG 180
           TQSLPRLVKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNG
Sbjct: 121 TQSLPRLVKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNG 180

Query: 181 EYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLER 240
           EYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLER
Sbjct: 181 EYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLER 240

Query: 241 FLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEEL 300
           FLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEEL
Sbjct: 241 FLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEEL 300

Query: 301 RDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE 360
           RDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE
Sbjct: 301 RDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE 360

Query: 361 GMVGDSLEISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYP 420
           GMVGDSLEISEFTDLLENC              AKDIKDIKVFLLWLENVLKTTINKDYP
Sbjct: 361 GMVGDSLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYP 420

Query: 421 PNFNVSECGKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLL 480
           PNFNVSECGKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLL
Sbjct: 421 PNFNVSECGKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLL 480

Query: 481 SKVIVGDPIPLLNSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEVLLGAIDCQSNK 540
           SKVIVGDPIPLLNSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEVLLGAIDCQSNK
Sbjct: 481 SKVIVGDPIPLLNSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEVLLGAIDCQSNK 540

Query: 541 VATDIKLPYNHAEMDIEGVRIMGDASQIAPESHQTTKITLPIIVQYKSGDITLRTHESHY 600
           VATDIKLPYNHAEMDIEGVRIMGDASQIAPESHQTTKITLPIIVQYKSGDITLRTHESHY
Sbjct: 541 VATDIKLPYNHAEMDIEGVRIMGDASQIAPESHQTTKITLPIIVQYKSGDITLRTHESHY 600

Query: 601 CKLDCQLILHRESVSVTIARLK 622
           CKLDCQLILHRESVSVTIARLK
Sbjct: 601 CKLDCQLILHRESVSVTIARLK 622

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  297 bits (760), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 179/588 (30%), Positives = 307/588 (52%), Gaps = 16/588 (2%)

Query: 12  YTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQD 71
           Y   N  LPLY  +G K L+V R +D++ IA T I+    V    WD I G+ +S+ F+D
Sbjct: 11  YCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRD 70

Query: 72  GSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131
           GSIRI DV  D KLVA LRTQ   +DC  WDRI   +  +  +++ +I+   +P L++F+
Sbjct: 71  GSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIV-DLMPSLIQFV 129

Query: 132 GSDASPSMSPYLPTNHSWR-FPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPH 190
            S    S+ PY P+N +WR          ++D+H LHQ   D+ + +LNG+Y L L  P 
Sbjct: 130 SSANKLSLIPYTPSNANWRELDAKWKKNRVIDMHCLHQSETDSFLMVLNGDYYLTLKTP- 188

Query: 191 QEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGY 250
           + D SE     +   S   +Y C YK G  R++D + F+  K  I LLE  L  +D   Y
Sbjct: 189 ETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKDMSKY 248

Query: 251 FLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGE 310
              HL+ ++   ++PY +F+E++C+ AFG+EKL   L   FL+G++ +EL+DWL YS+G+
Sbjct: 249 TRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHYSVGD 308

Query: 311 RNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEIS 370
           +N+ +W++L + AY++T+++  + L+   ER+I+L E+   L++  Q   G   D+  + 
Sbjct: 309 KNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESG-ADDNSRLH 367

Query: 371 EFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECGK 430
           E  +L+ N               A   + +K+FL WL + +   ++ DY P  ++++   
Sbjct: 368 ELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQNSN 427

Query: 431 FGFLFTSGLALTLEPAKK---TVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVIVGD 487
             +         L+  KK    +  FD  +  + +    + +++  Y+  +L +K+ +  
Sbjct: 428 TCYKLGKSFEYLLQEGKKDSEDILNFDIIKHTLEKIEANISRMNTKYIEPILENKIAIDT 487

Query: 488 PIPLLNSYYI-EHFVTLLDIAQVAAHPAYLIYLCRNMSNR----SEVLLGAIDCQSNKVA 542
            IP   + Y  E  VT+ DI +++  P Y++Y+ +  S      +EV +G  +       
Sbjct: 488 KIPFFKANYSPELTVTVRDIVKISQIP-YVLYVVQLSSVTPTPINEVRVGTANIDGTSTN 546

Query: 543 TDIKLPYNHAEM--DIEGVRIMGDASQIAPESHQTTKITLPIIVQYKS 588
             I LP +  +M  DI  ++I+ + S+ + E          +I  YK+
Sbjct: 547 EKI-LPLSVVQMSNDIAVIKIIEEPSKKSKEYEIICSGAKEMITVYKT 593

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  248 bits (633), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 230/425 (54%), Gaps = 7/425 (1%)

Query: 11  FYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQ 70
           ++ + N   P++ TR TK L ++R +D + IA   +R+ + V +Y WD   G+ +S+ F+
Sbjct: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67

Query: 71  DGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKF 130
           DG++RI+D+  D +LV+ LR   T +   +WDRI L     S  +  ++I   LP+L++F
Sbjct: 68  DGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVI-DILPKLIRF 126

Query: 131 MGSDASPSMSPYLPTNHSWRFPNSG--AAGGILDVHFLHQKLGDTLVALLNGEYQLQLTG 188
           +      S+ PY P N  WR P+     +G ILDVH +  +  D +    NG+Y + L  
Sbjct: 127 VKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDYTILLPM 186

Query: 189 PHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYL 248
              E++  L  ++   D     Y+C+Y  G VR ++L   +  K ++ LL   ++ ++ +
Sbjct: 187 DDIENERILESVVKVQDG---FYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIKELI 243

Query: 249 GYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSL 308
           GY LAH+E I  E + PY +F++R+C++A+G  KL+  L   FL+G +  +L DWL  S+
Sbjct: 244 GYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLCNSV 303

Query: 309 GERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE 368
           GE+NL++WK L   AY++T+Q++ +  VP  ER+II  E+L+   L A   +    ++ +
Sbjct: 304 GEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRG-TLEAFSVQNKSNNTSD 362

Query: 369 ISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSEC 428
           ++    LL+N                ++    + F +W  + +   +++DY   F   + 
Sbjct: 363 LTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFEDD 422

Query: 429 GKFGF 433
             FG+
Sbjct: 423 PYFGY 427

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  246 bits (628), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 130/428 (30%), Positives = 227/428 (53%), Gaps = 7/428 (1%)

Query: 8   ARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISV 67
              ++ + N   P++ TR  K L +NR +D + +A+  IR+ + V +Y WDT+ G+ +S+
Sbjct: 5   GNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSI 64

Query: 68  MFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRL 127
            F+DG+IRI+D+  D +LV+ LR   T +    WDRI L S + +     +II   LP+L
Sbjct: 65  FFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNII-DYLPKL 123

Query: 128 VKFMGSDASPSMSPYLPTNHSWRFPNSGAAGG--ILDVHFLHQKLGDTLVALLNGEYQLQ 185
           ++++      ++ PY P N  WR P+         LD+H +  +  D +    NG+Y + 
Sbjct: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIF 183

Query: 186 LTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQ 245
           +     E++  ++ I+   D     Y+C+Y  G VR ++L   +  + ++ +L+  +  +
Sbjct: 184 VPVGADENERFVKSIVKIQDG---FYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240

Query: 246 DYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLV 305
           + +GY L H+E I  E V PY EF+ RLC++A+G +KL   L   FL+G +  +L DWL 
Sbjct: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300

Query: 306 YSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGD 365
            S+GE+N + WK L   AY++T+Q++ +  VP  ER+II  E+L+  +L A   +    D
Sbjct: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRG-ILEAFSIQNKFND 359

Query: 366 SLEISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNV 425
           S +++    LL+N                KD    + F +WL + +   +++DY      
Sbjct: 360 SSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQF 419

Query: 426 SECGKFGF 433
            +   FG+
Sbjct: 420 EDDPYFGY 427

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  243 bits (620), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 146/518 (28%), Positives = 263/518 (50%), Gaps = 15/518 (2%)

Query: 11  FYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQ 70
           ++ + N + P++ TR  K L + R +D + +A   IR+ + V +Y WDT  G+ +S+ F+
Sbjct: 8   YFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFK 67

Query: 71  DGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKF 130
           DG+IRI+D+  D +LV+ LR   T +   +WDRI L     + ++  +II   LP+L++F
Sbjct: 68  DGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNII-DDLPKLIRF 126

Query: 131 MGSDASPSMSPYLPTNHSWRFPNSGA--AGGILDVHFLHQKLGDTLVALLNGEYQLQLTG 188
           +      ++ PY   N  WR P+     +   LDVH +  +  D +    NG+Y + L+ 
Sbjct: 127 VKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSV 186

Query: 189 PHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYL 248
            + E+++ L+ II   D     Y C+Y+ G V+ ++L   ++ K ++ LL   ++ ++ +
Sbjct: 187 DNIENENSLKSIIKVQDG---FYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELI 243

Query: 249 GYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSL 308
           GY L HLE I  E   PY +F++RLC++A+G  KL+  L   FL+G +  +L DWL  S+
Sbjct: 244 GYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSV 303

Query: 309 GERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE 368
           GE+N + WK L   AY++T Q++ +  VP  ER+II  E+L+A +L A   +  +  + +
Sbjct: 304 GEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRA-ILQAFSIQNKLSYTSD 362

Query: 369 ISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSEC 428
           ++    LL++                +D    + F +W  + L   +++DY   F   + 
Sbjct: 363 LTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDD 422

Query: 429 GKFGFLFTSGLALTL-----EPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKV 483
             FG+   S     L     EP+  ++      R ++    D+   +    V   +   +
Sbjct: 423 LYFGYDLLSYFDRILSKKGTEPS--SIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHI 480

Query: 484 IVGDPIPLLNSYYIEHFVTLLDIAQVAAHPAYLIYLCR 521
           +V     +    Y    + LLD  ++  H  Y++YL +
Sbjct: 481 LVDLKTDVFAQKYPSSQINLLDAIKLPKH-NYIVYLIQ 517

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  238 bits (606), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 122/425 (28%), Positives = 223/425 (52%), Gaps = 7/425 (1%)

Query: 11  FYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQ 70
           ++ + N   P++  R  K L ++R +D + +A   +R+ + V +Y WD   G+ +S+ F+
Sbjct: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63

Query: 71  DGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKF 130
           DG+IRI+D+  D +LV+ LR  RT +   +WDRI L   + +  +  ++I   LP+L++F
Sbjct: 64  DGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVI-DVLPKLIRF 122

Query: 131 MGSDASPSMSPYLPTNHSWRFPNSGAAGGI--LDVHFLHQKLGDTLVALLNGEYQLQLTG 188
           +      +++PY P N  WR P+         LD+H +  +  D +    NG+Y + L  
Sbjct: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLPV 182

Query: 189 PHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYL 248
              E++  L+ ++   +     Y+C+Y  G V   +L   ++ + ++ LL   ++ ++ +
Sbjct: 183 SDIENEKILKSVVKVQNG---FYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELI 239

Query: 249 GYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSL 308
           GY LAH+E I  E   PY +F++R+C++A+G  KL+  L   FL+G +  +L DWL  ++
Sbjct: 240 GYLLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAV 299

Query: 309 GERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLE 368
           GE+N + WK L   AY++T QV  +  VP  ER+II  ++L+  +L A   +       +
Sbjct: 300 GEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKG-ILEAFSIQXXXXXXXD 358

Query: 369 ISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSEC 428
           ++    LL+                 KD    + FL+W  + +   +++DY P F   + 
Sbjct: 359 LTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDD 418

Query: 429 GKFGF 433
             FG+
Sbjct: 419 PYFGY 423

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  223 bits (569), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/477 (29%), Positives = 238/477 (49%), Gaps = 20/477 (4%)

Query: 10  QFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMF 69
           Q Y + N V PLYV + T+   V+R  DD+ IA+  +RD SQV  YQWD I G+ +S+ +
Sbjct: 3   QDYVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFY 62

Query: 70  QDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSM-EWDPDI-ITQSLPRL 127
           +DG++RI D     +LV+LLR    G    +WDRI L    +++ +W  D  +T+ +P++
Sbjct: 63  KDGTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKM 122

Query: 128 VKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLT 187
           VKF        + PY   +  WR   +     +LD H +  +  D+L  + +GE+ + + 
Sbjct: 123 VKFARDSRQLCVVPYTLPSDVWRPQAADDTNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180

Query: 188 GPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDY 247
                  + +   + +  S +H Y  +Y+ G V + DL   V+D  +++LL+  +  +  
Sbjct: 181 ------LAAIPSPLVKFVSAQHQYLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQL 234

Query: 248 LGYFLAHLEPIQTECVEPYQEFIERLCEDAFGK-EKLQESLTDHFLVGSMDEELRDWLVY 306
             Y   H+E IQ + ++PY EF+ER C+ AFG  + L+E L D  LVG +  EL DWLV 
Sbjct: 235 HRYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVN 294

Query: 307 SLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDS 366
           S+GE+NL+ W+ L   AY +T QV+ +  +P  ERLI L ++    +L+ +     +   
Sbjct: 295 SMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLS-RQLTLQLPLL 353

Query: 367 LEISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVS 426
             I      L+N                        FL W ++ ++ +I++DY   FN+ 
Sbjct: 354 PPIDCLQFFLKNVLEAIASLSSQQRLLGS-------FLDWFDDRVRESIDEDYKLRFNLH 406

Query: 427 ECGKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKV 483
           +    G    S L L L  +    +   +    +    D +  +D++ + D L SK+
Sbjct: 407 DNSSLGPDTASYLQLRLRNSSPEFSSVSDLTHSLASTTDCVSSLDSILI-DALTSKI 462

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  210 bits (534), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 133/445 (29%), Positives = 232/445 (52%), Gaps = 18/445 (4%)

Query: 12  YTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQD 71
           Y   N +  LY  +  K L + R  D++ IA+  +RD + +  +QWD I G+ ++V ++D
Sbjct: 8   YRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKD 67

Query: 72  GSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131
           G+ RI D     KL+ALLR  +T +D  +WDRI L  +  + ++D   +  S+P++++F 
Sbjct: 68  GNARIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFD-HFVLNSMPKMIRFA 126

Query: 132 GSDASPSMSPYLPTNHSWRFPNSGAAG-----GILDVHFLHQKLGDTLVALLNGEYQLQL 186
                  + PY P N +WR       G      ILDVH +HQ+  + LV +L+G++ L+L
Sbjct: 127 RDTRQIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQE-DNGLVLMLDGDFILRL 185

Query: 187 T-GPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQ 245
             GP       L+ I+    + R +Y+C+Y+   V  + L   ++   TI+L++ F+  +
Sbjct: 186 AAGP---SGPALKDIVV---ADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIK 239

Query: 246 DYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLV 305
               Y   HL+ I+ + V PY EF+ ++C+ AFG E L E L    L G +  EL +W  
Sbjct: 240 QLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFC 299

Query: 306 YSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE-GMVG 364
           Y++GE+N ++WK +    Y++T Q++ +  +P  ER+I+L E+ +A +   QL E     
Sbjct: 300 YTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTT 359

Query: 365 DSLEISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFN 424
           DS E +  T L +                A+++   + FL W ++ L   +++DY    +
Sbjct: 360 DSSEFANLTSLSQT--YLRSTVETIQGVSAQEVL-FQTFLQWFDDRLHEALDEDYKQKLS 416

Query: 425 VSECGKFGFLFTSGLALTLEPAKKT 449
           +    K G+   + L L + P K++
Sbjct: 417 IDSNCKIGYQIATYLDLRINPDKQS 441

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  206 bits (523), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 144/560 (25%), Positives = 263/560 (46%), Gaps = 27/560 (4%)

Query: 20  PLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDV 79
           P  + + +    V R  DD+ I    IR+   V++  W++ G   ++VMF DGS RI+D+
Sbjct: 16  PAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSARIHDI 75

Query: 80  MYDAKLVALLRTQ---RTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFMGSDAS 136
             + KL+ LLR Q   +  +D  +W ++ +  +    E+D DI +  +P  +KF+ +   
Sbjct: 76  FREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDI-SGLMPSPIKFVNNAGQ 134

Query: 137 PSMSPYLPTNHSWRFPNSG-AAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQS 195
             + PY+ T   WR  +       I+D+H  H    D  + ++NG Y+L +  P+  D++
Sbjct: 135 LEVVPYVVTQTQWRNVDKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTI-QPNSTDEN 193

Query: 196 ---ELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFL 252
              +L KII     K  +++C+YK      +DLT  +E    + LL      +    Y +
Sbjct: 194 ASNQLHKIIHL--EKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQLHRYIV 251

Query: 253 AHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERN 312
            HL+ I  +  +P  +F+E    +    + L +SL    L G M + L  WL   +GE+N
Sbjct: 252 DHLDIIDNDLKKPLDDFLE--VTNILNIKDLSKSLKSFILYGLMAKSLNHWLCNVVGEKN 309

Query: 313 LEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEF 372
           L++WK L  T Y++  Q++ + ++P  E+L +L  + +ALV+   L     G   E+  F
Sbjct: 310 LKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPAS--GHMQELEYF 367

Query: 373 TDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECGKFG 432
             L                  +++ K   VF+LW+++++   +++DY P  N+ E G   
Sbjct: 368 DSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNICEDGSVV 427

Query: 433 FLFTSGLALTLE--PAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKVIVGDPIP 490
                 +    +    +K+    D S+ +++   D L  +D+ YVR++LL  + +     
Sbjct: 428 PTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTMKIRGTAR 487

Query: 491 LLNSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEV--------LLGAIDCQSNKVA 542
                + E  VT+LDI   A +P +L+YL    SN  +V           +I+ ++   A
Sbjct: 488 SFTENFDED-VTILDIFYCAKYP-FLVYLVEKRSNTQDVKASVKYIGTANSINLRTISAA 545

Query: 543 TDIKLPYNHAEMDIEGVRIM 562
             +  P +     I+ V+ +
Sbjct: 546 KKVNYPLSIDSASIQKVKFL 565

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  191 bits (486), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 119/425 (28%), Positives = 209/425 (49%), Gaps = 27/425 (6%)

Query: 9   RQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVM 68
           R +Y++ N    LYVTR  + L V R  D S +A  FI+D   V  Y+WD   G  ISV 
Sbjct: 8   RLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVF 67

Query: 69  FQDGSIRINDVMYDAKLVALLR-TQRTGLDCVLWDR--IRLPSRAQSMEWDPDIITQSLP 125
             DG+IRI D+  + +LV+ +R + +  +D  LWDR    +PS+ Q   +D +II + LP
Sbjct: 68  LTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQL--FDSNII-ECLP 124

Query: 126 RLVKFMGSDASPSMSPYLPTNHSWRFPNSGAAG--------GILDVHFLHQKLGDTLVAL 177
            L+KF+    + ++  Y P NHSWR  +  +           +LDVH  H    D    +
Sbjct: 125 TLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTII 184

Query: 178 LNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKL 237
           LNG Y++         +SE+ +++   + +   Y  +YK G  R+++    +    +  L
Sbjct: 185 LNGVYEINGIVMPDISKSEVYQLLKLHNGE---YMSFYKNGHYRKINFNNLLSCNVSNGL 241

Query: 238 LERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAF--GKEKLQESLTDHFLVGS 295
           L   L  ++   Y   HL+ I+ E + PY +F++++C DA+  G  KL + L    L G 
Sbjct: 242 LSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGE 301

Query: 296 MDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLT 355
           ++ E +DWLV  +G+RN ++W+ L    + +  +++ + ++P  ER +I  E+    +  
Sbjct: 302 INNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNG 361

Query: 356 AQLSEGMVGDSLEISE-FTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTT 414
              ++    D + + E F+ L+ N                  +K  ++F  W+ + +   
Sbjct: 362 YMKTDTDFYDIISLREYFSKLIRNS-------ITIINSLNNQLKYFEIFSEWINDKINEI 414

Query: 415 INKDY 419
            ++DY
Sbjct: 415 TDEDY 419

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  196 bits (499), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 126/438 (28%), Positives = 218/438 (49%), Gaps = 28/438 (6%)

Query: 1   MTEDALYARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTI 60
           MTE +  ++ +Y ++N +  LY  +  K L +   +D S +A+ FI+D S VV + WD+I
Sbjct: 1   MTEHS-DSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSI 59

Query: 61  GGEIISVMFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRI----RLPSRAQSMEWD 116
            G+ +   F DGSIR+ D+    +LV+  R+    + CV WDRI     L  + +  ++D
Sbjct: 60  TGKFLLFAFNDGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIIITETLDQQLKIFDYD 119

Query: 117 PDIITQSLPRLVKFMGSDASPSMSPYLPTNHSWR---------FPNSG---AAGGILDVH 164
              +T S+P LVKF+       + P L    +WR           NS    +   +LD+H
Sbjct: 120 ---LTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIH 176

Query: 165 FLHQKLG-DTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQV 223
            L+ + G D    L+NG Y   L+  H  ++S   K+I    + +  Y  +Y+    R +
Sbjct: 177 LLYTESGMDNFAVLVNGVY--DLSDIHVPNRSP-NKVIKLVKASQGKYLGFYENASYRLI 233

Query: 224 DLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAF-GKEK 282
           D+T F  +   + LL   +  ++ +      +E I+ E + P++ FI  +C DA+ G + 
Sbjct: 234 DVTPFSSNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDN 293

Query: 283 LQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERL 342
           L  S+T+  L G + EE  DWL+ ++GERNL +WK+L      +  Q++ +  +P++E+ 
Sbjct: 294 LYRSMTNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKF 353

Query: 343 IILCEQLQALVLTAQLSEGMVGDSLEI-SEFTDLLENCXXXXXXXXXXXXXXAKDIKDIK 401
           II  E++Q  +   +LS+      LE  SE  DL+ N                 D    +
Sbjct: 354 IITAERIQNYITAMRLSDN--SKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFE 411

Query: 402 VFLLWLENVLKTTINKDY 419
           +F+ W+ N +   I+++Y
Sbjct: 412 IFIDWIRNTIYLIIDENY 429

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  166 bits (419), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 112/412 (27%), Positives = 192/412 (46%), Gaps = 27/412 (6%)

Query: 30  LVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDVMYDAKLVALL 89
           LV+ R +D+  I    +R+   ++ Y WD I G+ +++  +DGS+RI D+    KL++ L
Sbjct: 29  LVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLKDGSVRIYDIFNGGKLISFL 88

Query: 90  R-------TQRTGLDCVLWDRIRLPSRAQSMEWDPDI-ITQSLPRLVKFMGSDASPSMSP 141
           R       + +  LDC LWDRI +P    S    P+  +T+S+P LVKF+       + P
Sbjct: 89  RVLPVVLGSNKPSLDCCLWDRIIIPKSGSSELRIPNNDLTESMPTLVKFVQDAKQIDIIP 148

Query: 142 YLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKII 201
                  WR   +     ++DVH  +      +  L+NGEY   L      D ++++K I
Sbjct: 149 NRSITKLWRSIGNNEKK-VVDVHLGYSCSSAQVTILINGEY---LIEKSVSDINQIQKKI 204

Query: 202 ARTDSKRH----VYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEP 257
             + +K+     +Y  ++      Q+DLTG + + D + L+E  +   ++      H   
Sbjct: 205 PISLNKKEFCEAIYEIHFDDYSRLQIDLTGILLNDDKLDLIETQIKMTNHFDLIKDHFNL 264

Query: 258 IQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWK 317
           I+   + PY EF+E     + G     + L   FL+G +D +L +W   ++ E+NL++W 
Sbjct: 265 IEKSVLAPYYEFLE-----SIGGINDLDVLERLFLIGELDTKLGNWFKETINEKNLKKWS 319

Query: 318 SLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEFTDLLE 377
            L N  Y    QV+++  VP+ ERL++L  ++  ++    L E      L+ISE    L 
Sbjct: 320 RLGNEFYSNFKQVLIIVFVPICERLMVLTNRINGMIKGIDLQESQETSLLDISELQSFLN 379

Query: 378 NCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDYPPNFNVSECG 429
                            +D      FL WL + +  +IN +Y   F  +E G
Sbjct: 380 LVLKLLAELNEDETYFKQD------FLPWLTDKVYESINNEYKSVFFKAEYG 425

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  159 bits (401), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 181/375 (48%), Gaps = 38/375 (10%)

Query: 15  VNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSI 74
           +N   PLY+T+ +  ++  R  D   I++  IR+   V++  WD+  G+ +++ F DG+ 
Sbjct: 27  INPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTF 86

Query: 75  RINDVMYDAKLVALLRTQR--------TGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPR 126
           RI D+  D KL+ L+R QR        T +D  +WDR+ + +  Q +E++ DI T+ +P 
Sbjct: 87  RIYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDI-TKLMPT 145

Query: 127 LVKFMGSDASPSMSPYLPTNHS--WR--------FPNSGAAGGI--------------LD 162
           L+KF+    +  + PY        WR         P S     I              LD
Sbjct: 146 LIKFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLD 205

Query: 163 VHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRH-VYNCYYKTGPVR 221
           +H +H    D     +NG YQ+ L      + +   KI+    S  H VY+C+++ G +R
Sbjct: 206 LHIIHVIDPDCFTIAINGTYQINLVRK-TINTTNRNKIVRILKSTVHGVYHCFHENGSIR 264

Query: 222 QVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLC---EDAF 278
            +  + F      ++LLE F+   + + YF  HL+ I    ++ + +F+       +   
Sbjct: 265 SLYFSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNG 324

Query: 279 GKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPV 338
           G   + + L    L G M EEL +WL  S+GE+NL++WK L    Y ++ Q+  + L+P 
Sbjct: 325 GGNSMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPA 384

Query: 339 SERLIILCEQLQALV 353
            E  ++L ++  A++
Sbjct: 385 CELTLLLSQKCLAIL 399

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  155 bits (391), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 165/339 (48%), Gaps = 8/339 (2%)

Query: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75
           N  LPL + +    L V R  D S I +  IR+ + ++ YQW+   G  +++ FQ G++ 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 76  INDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFMGSDA 135
           I D +  ++L+A+L   +  +D  +WDR   P+  +   +D D IT  +P L++ +    
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSD-ITLYMPTLIQIIRDKE 131

Query: 136 SPSMSPYLPTNHSWRFPNSGA-AGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQ 194
                 Y P + +WR     +     LD+H LH  + D+   +LNGE +L    P   + 
Sbjct: 132 KICPGTYFPPHSTWRAKKEESLKNEFLDIHLLHHSVDDSFTFILNGELKL----PFPSNS 187

Query: 195 SELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAH 254
           +  R  I     + + + C+Y+   VR +D    ++ K    L++ F+     L Y   H
Sbjct: 188 TSGRA-IGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEH 246

Query: 255 LEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLGERNLE 314
           +  I+     P+ EF+  +  +A  +E + E+L    + G +  EL +W+  ++G +NL 
Sbjct: 247 IMFIKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLT 305

Query: 315 EWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALV 353
            W +L    Y +   ++ + ++P  ER +IL  +LQ L+
Sbjct: 306 RWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI 344

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  122 bits (307), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 113/486 (23%), Positives = 211/486 (43%), Gaps = 24/486 (4%)

Query: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75
           N  L LY+  G K + VNR  D   IA+  +R   Q++  QW+   G++ ++ F +G++R
Sbjct: 22  NPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAVR 81

Query: 76  INDVMYDAKLVALL------RTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRLVK 129
           I D      L  ++      ++    +D  +W   +     Q  +     IT+ LP +V+
Sbjct: 82  IYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMVR 141

Query: 130 FMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGP 189
            +      S+ P       W   + G    I   H   +K GD L+ + +G   +++   
Sbjct: 142 LVRDAKQLSVVPLETGKLRW-LADPGKDAAIFLGH--DEKSGDYLMTV-DGLLSVRVPSG 197

Query: 190 HQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLG 249
            ++    LR+       +   +      G V+ V L  F+      +L+      +    
Sbjct: 198 IKKMHKILRQ------GEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQIRFLCS 250

Query: 250 YFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVYSLG 309
           Y   ++   +T+ +EPY++F+ R+  DA+   +L     D  L G + E+L DWL  S+G
Sbjct: 251 YLTENINMCKTDLIEPYRQFLTRIA-DAYEGGELASRFRDIILSGYIPEDLEDWLCNSIG 309

Query: 310 ERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSE-GMVG-DSL 367
           ++N + WK L    Y   + V+ + ++P  ERLI+  EQLQ +    +L E G+      
Sbjct: 310 DKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEFGLASPQEF 369

Query: 368 EISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDY--PPNFNV 425
           E +E T+L+  C               +D +   +F  W  +V+  T+++DY  P N + 
Sbjct: 370 ESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYKRPQNRDS 429

Query: 426 -SEC-GKFGFLFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRDLLLSKV 483
             +C G         ++   E ++    F     ++  +      ++D++Y R  +L +V
Sbjct: 430 HQDCYGDRALALDQYISHCWENSEVWTRFERLLPQLAADADISATKLDHIYTRAWVLEQV 489

Query: 484 IVGDPI 489
            V  P+
Sbjct: 490 HVTSPV 495

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  110 bits (274), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 98/415 (23%), Positives = 180/415 (43%), Gaps = 26/415 (6%)

Query: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75
           N  L LY+    K++ VNR  D   IA+  +RD  ++V  QW+    ++ +V   +G +R
Sbjct: 22  NPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVVR 81

Query: 76  INDVMYDAKLVALLRTQRTG------LDCVLWDRI---RLPSRAQSMEWDPDIITQSLPR 126
           I D      L  ++     G      +D V+W  +   + P   + +++D   IT  +P 
Sbjct: 82  IYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFD---ITTLMPG 138

Query: 127 LVKFMGSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQL 186
           +V+ +      S++P      SW     G A     +   H       +  ++G+  L+ 
Sbjct: 139 MVRLVRDSKQLSLAPLDLGKLSWLDGKYGDAA----IFLAHDCESTEYMVAIDGQLSLRF 194

Query: 187 TGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQD 246
                     + KI+ +  S    +    K G ++ V L  F+E     +L++     + 
Sbjct: 195 ----PSGIRNVHKILPQGGSGS--FLAVGKDGTLQWVTLK-FLECALMRELVKSSGQIRF 247

Query: 247 YLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLVY 306
              Y   ++    TE +EPY+ F+ RL   A+  + L   L D  L G + ++L +WL  
Sbjct: 248 LCRYLAENVSLCHTELIEPYRVFLTRLM-GAYEGDDLATRLRDILLTGYIPDDLEEWLCN 306

Query: 307 SLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDS 366
           S+G++N + WK L    Y   + V+ + +VP  ERLI+  E++Q +  + +L       +
Sbjct: 307 SVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRFCKDYA 366

Query: 367 LEIS--EFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKDY 419
            E++  E   L+  C               +D    +VF  W  +V+  T+++DY
Sbjct: 367 GELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  107 bits (267), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 118/492 (23%), Positives = 206/492 (41%), Gaps = 33/492 (6%)

Query: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVMFQDGSIR 75
           N VL L++    K + VNR  D   IA+  ++D   +V YQW+   G I +V   +G IR
Sbjct: 21  NPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGIIR 80

Query: 76  INDVMYDAKLVALLRTQRTGLD----CVLWDRIRLPSRAQSMEWDPDIITQSLPRLVKFM 131
           + D     K V  +    +  D    C   D     S+  ++ +D +I T  +PRLVKF+
Sbjct: 81  LYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNV-FDHEI-TSLMPRLVKFV 138

Query: 132 GSDASPSMSPYLPTNHSWRFPNSGAAGGILDVHFL-HQKLGDTLVALLNGEYQLQLT--- 187
                 +M   LPT+     P      G     FL +      ++  ++G ++L  +   
Sbjct: 139 KDSRQLTM---LPTDVGDGVPRWSKLDGNKSFIFLGYDSKRQKILMAIDGAFKLSFSVAA 195

Query: 188 ---GPHQEDQSE-----LRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLE 239
                 + D+ +     +R I+   + +  V    +    ++  D       ++ I    
Sbjct: 196 LVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIK-FDFLNCNLTREMISCCN 254

Query: 240 RFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEE 299
           R       L      +  ++TE VEPY +FIER+     G   L   LT+    GS+  E
Sbjct: 255 RIRSLHKQLH---ESVSLVKTELVEPYTQFIERVLGAYEGD--LIGDLTELLFTGSVPPE 309

Query: 300 LRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQL- 358
           L DWL  ++G++NL  WK L +  Y    +++++ +VPV ERLI+  E+L  ++   +L 
Sbjct: 310 LEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIKGLKLI 369

Query: 359 SEGMVGDSLEISEFTDLLENCXXXXXXXXXXXXXXAKDIKDIKVFLLWLENVLKTTINKD 418
               + D+LE+ E   L+                   D    + F+ W  +++   +++D
Sbjct: 370 GLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVMEAVDED 429

Query: 419 YPPNFNVSECGKFGF-LFTSGLALTLEPAKKTVTFFDESRRIVRECGDLLLQVDNLYVRD 477
           Y    + + C       F SG    +   +     F     +    G     V+ LYV +
Sbjct: 430 YKRKTSYN-CDPLKIQQFMSGSLTGVHTYEWCQYSFPA---VTNRLGKQFETVEQLYVAN 485

Query: 478 LLLSKVIVGDPI 489
            ++ +V  G+PI
Sbjct: 486 WVVQRVKFGEPI 497

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/364 (20%), Positives = 163/364 (44%), Gaps = 32/364 (8%)

Query: 16  NNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPS--QVVSYQWDTIGGEIISVMFQDGS 73
           N+ L L+       + + R  D   + S  +R  S  ++++ Q +   G++ +V+ + GS
Sbjct: 21  NDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLRLKSNEEILTCQLEPNDGDLFAVVLRSGS 80

Query: 74  IRI---------NDVMYDAKLVA---LLRTQRTGLDCVLWDRIRLPSRAQSMEWDPD-II 120
           +++         +D    A +V    L R +   ++  +W+RI+  SR  + + D D ++
Sbjct: 81  VKVYKGRQDVDSSDPTDGADMVGTIVLGRGEWFNMEQFVWNRIKWKSRG-AFKGDFDTVL 139

Query: 121 TQSLPRLVKFMGSDASP----SMSPYLPTNHSWRFPNSGAAGGILDVHFLHQKLGDTLVA 176
           TQ LP+L +    + SP    + +P       W   N+  +    ++   +      ++ 
Sbjct: 140 TQWLPKLTEM---NVSPQGKLTCTPLEFEGPEW---NASLSENESNMFLTYDNATRKVMV 193

Query: 177 LLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIK 236
            ++G +  +  G   +  +++  I++  ++  +V+          Q+    F E     +
Sbjct: 194 SIDGTFNFRY-GEKNKFPTKVTNILS-GNANNYVF--LNDEDWQLQIIKLEFTESHQMHE 249

Query: 237 LLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVG-S 295
           L++     Q  + Y   + + I  + +EP+  FI  L  D     +L + L D F +G S
Sbjct: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDE-QASRLLKGLKDVFYLGYS 308

Query: 296 MDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLT 355
            ++ + +W    LG   +  WK   +  +  +  +++ C++P  ERLI+  ++LQ L+ +
Sbjct: 309 AEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLIKS 368

Query: 356 AQLS 359
            +L+
Sbjct: 369 LKLN 372

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 81/350 (23%), Positives = 146/350 (41%), Gaps = 28/350 (8%)

Query: 46  IRDPSQVVSYQWDTIGGEIISVMFQDGSIRINDVMYD---------AKLVA---LLRTQR 93
           +R   +++  QW+   GE+ +V  + GS++I     D         A+LV    L R   
Sbjct: 53  LRQNEELLRCQWEPDDGELFAVALRSGSVKIYRGRLDPEGTEGSEGAELVGTVVLGRGDA 112

Query: 94  TGLDCVLWDRIRLPSRAQ-SMEWDPDIITQSLPRLVKF-MGSDASPSMSPYLPTNHSWRF 151
             ++  +W+RI+   R     E+D  ++ Q LPRL +  + +      +P       W  
Sbjct: 113 FQMEQFVWNRIKWRVREPFCGEFDSPLV-QWLPRLTEMSISAQGKLLCTPLGYEGPEW-- 169

Query: 152 PNSGAAGGILDVHFLHQKLGDTLVALLNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVY 211
            N+G A    ++          +V  ++G +  +    + E      K+ +      + Y
Sbjct: 170 -NAGLAADESNMFLTFDNNTRKVVLSIDGTFNFR----YGEKSKFPTKVTSILPGNENHY 224

Query: 212 NCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIE 271
                     QV    F E     +L++     Q  L Y   +   I T+ +EP+  F  
Sbjct: 225 VFINDEDWQLQVIRLEFTEYHQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTG 284

Query: 272 RLC-EDAFGKEKLQESLTDHFLVG-SMDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQ 329
            L  E+ F   K  + L D F +G S D+ + +W    LG      WK   +  +  +  
Sbjct: 285 SLFPEEQF--TKFMKGLKDVFYLGYSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQG 342

Query: 330 VVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEIS--EFTDLLE 377
           V++ C++P  ERLI+  ++L  LV + +L+   + D  E++  E  DLL+
Sbjct: 343 VLVTCMIPACERLIVSAKRLLGLVKSLKLNVFGLDDDNELTAVEVQDLLQ 392

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 79/158 (50%), Gaps = 10/158 (6%)

Query: 196 ELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQDYLGYFLAHL 255
           ++++II  +  K   Y C  K    + +DLT F++D +  KL++    +   L Y     
Sbjct: 191 DIKRIIKVSSGK---YMCLGKDWSYQVLDLT-FLQDPNIYKLIKTTQEYSALLRYLKQLH 246

Query: 256 EPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWL-VYSLGERNLE 314
             ++ +  EPY EF+E L      KE+ + +L + F +G    E+ + L    L    L+
Sbjct: 247 RHLRMKLTEPYFEFVETLL-----KEEHKNALQELFYIGVTKLEVMEELHEVQLQTFRLD 301

Query: 315 EWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQAL 352
           +W +L N     +  +++ C +P+ ER+I+L   ++AL
Sbjct: 302 KWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEAL 339

>TPHA0I02880 Chr9 (633548..634918) [1371 bp, 456 aa] {ON} Anc_7.484
           YBL045C
          Length = 456

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 51/114 (44%), Gaps = 6/114 (5%)

Query: 265 PYQEFIERLCEDAFGKEKLQ---ESLTDHFLVGSM-DEELRDWLVYSLGERNLEEWKSLM 320
           PY   +  +C   F +   +   +++   F + S+ D E + +LV S G  NL +    +
Sbjct: 59  PYNNGVSHVCSSLFSRHNKKVNADAVKQGFKLDSLVDREYQSFLVTSAGSANLAKALDCL 118

Query: 321 NTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGDSLEISEFTD 374
           NT++  T+Q V       S+ LI   E+L  L    +  +  V + L  + F +
Sbjct: 119 NTSFAETTQNVNQSDFDQSKTLI--TEELYKLENKNKFQQERVMEHLHSTAFQN 170

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 1/56 (1%)

Query: 493 NSYYIEHFVTLLDIAQVAAHPAYLIYLCRNMSNRSEVLLGAIDCQSNKVATDIKLP 548
           NSY   +F  LL    +    AY +YL    S    +L GA+D QS  + T   LP
Sbjct: 209 NSYEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKYGSILFGAVD-QSKYIGTLYTLP 263

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,379,168
Number of extensions: 2619028
Number of successful extensions: 6492
Number of sequences better than 10.0: 29
Number of HSP's gapped: 6575
Number of HSP's successfully gapped: 32
Length of query: 622
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 506
Effective length of database: 40,180,143
Effective search space: 20331152358
Effective search space used: 20331152358
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 69 (31.2 bits)