Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H027007.194ON32632616740.0
NCAS0E018307.194ON31832813470.0
YIL021W (RPB3)7.194ON31832613370.0
KAFR0A026507.194ON31232613320.0
Skud_9.1487.194ON31827613260.0
Smik_9.1697.194ON31827613240.0
NDAI0G020007.194ON31130313220.0
Suva_9.1787.194ON31932613220.0
CAGL0J02420g7.194ON31230813110.0
ZYRO0D15796g7.194ON30832913040.0
TBLA0J015207.194ON33529912891e-179
TDEL0H025307.194ON31132612831e-179
Kpol_1063.117.194ON31633112631e-176
TPHA0C045107.194ON31026912391e-172
KLTH0E04598g7.194ON32830012331e-171
SAKL0F07458g7.194ON31532812251e-170
Kwal_55.203807.194ON32329012121e-168
KLLA0D16170g7.194ON30727711911e-165
ADL120C7.194ON31132811701e-161
Ecym_43827.194ON31127311601e-160
Kpol_1018.1393.428ON3352912431e-22
Kpol_473.33.428ON3202912235e-20
CAGL0B04125g3.428ON3342912237e-20
KAFR0A055203.428ON3342032192e-19
NDAI0A047703.428ON3352962131e-18
KLTH0F12056g3.428ON3501902141e-18
NCAS0A115203.428ON3351962122e-18
Suva_16.4383.428ON3351962112e-18
Smik_16.3533.428ON3351922113e-18
YPR110C (RPC40)3.428ON3351922103e-18
KLLA0D14861g3.428ON3341952104e-18
TBLA0F017003.428ON3331952061e-17
TPHA0D039203.428ON3351952061e-17
ADR031C3.428ON3641962071e-17
Kwal_23.39983.428ON3341952052e-17
SAKL0F06028g3.428ON3341952052e-17
KNAG0A076003.428ON3341952052e-17
Skud_16.3973.428ON3351882042e-17
ZYRO0C12364g3.428ON3352922033e-17
Ecym_44503.428ON3341922033e-17
TDEL0F031003.428ON3351922016e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02700
         (326 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.19...   649   0.0  
NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.19...   523   0.0  
YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA pol...   519   0.0  
KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.19...   517   0.0  
Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W (...   515   0.0  
Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W (...   514   0.0  
NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.19...   513   0.0  
Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W (...   513   0.0  
CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {...   509   0.0  
ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa] ...   506   0.0  
TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7....   501   e-179
TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.19...   498   e-179
Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa] ...   491   e-176
TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON...   481   e-172
KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar...   479   e-171
SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {O...   476   e-170
Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W...   471   e-168
KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa] ...   463   e-165
ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON} Sy...   455   e-161
Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to...   451   e-160
Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON} (370...    98   1e-22
Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON} com...    91   5e-20
CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {...    91   7e-20
KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON} Anc_3...    89   2e-19
NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON} Anc_3...    87   1e-18
KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} high...    87   1e-18
NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa] ...    86   2e-18
Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {...    86   2e-18
Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {...    86   3e-18
YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON} ...    86   3e-18
KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]...    86   4e-18
TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.4...    84   1e-17
TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {O...    84   1e-17
ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON} S...    84   1e-17
Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C...    84   2e-17
SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {...    84   2e-17
KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa] ...    84   2e-17
Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {...    83   2e-17
ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {...    83   3e-17
Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar t...    83   3e-17
TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {O...    82   6e-17

>KNAG0H02700 Chr8 (498753..499733) [981 bp, 326 aa] {ON} Anc_7.194
           YIL021W
          Length = 326

 Score =  649 bits (1674), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/326 (96%), Positives = 313/326 (96%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD
Sbjct: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI
Sbjct: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV
Sbjct: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300
           DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ
Sbjct: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300

Query: 301 DMYVPNAXXXXXXXXXXXXXVYDDAW 326
           DMYVPNA             VYDDAW
Sbjct: 301 DMYVPNAGTGGNIGSGSGSGVYDDAW 326

>NCAS0E01830 Chr5 (355752..356708) [957 bp, 318 aa] {ON} Anc_7.194
           YIL021W
          Length = 318

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/328 (78%), Positives = 279/328 (85%), Gaps = 12/328 (3%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+E GPQVKIREA +DNVDFILSNV+LA+ANS RRVM+AEIPTLAIDSVQ+ETNTTVLAD
Sbjct: 1   MSEAGPQVKIREATKDNVDFILSNVDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS+DIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHPIIQD+E NGVLICKLRKGQELK+TCIAKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDREGNGVLICKLRKGQELKITCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE DA +EWPNS+NCEYEDPP EGE FDYK+KAETFYMNVET+GSI V
Sbjct: 181 DPWNKLKHTDYWYEQDATKEWPNSKNCEYEDPPNEGELFDYKAKAETFYMNVETVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQ--GNVPGIEGNMINSGGADTGFAGGN 298
           DQVVVRG+DTLQKKVASILL+LTQM+QEK NFA     V G EG M+N G  D    GG 
Sbjct: 241 DQVVVRGVDTLQKKVASILLALTQMDQEKVNFATNPNGVSGREG-MMNGGDNDVNMDGGM 299

Query: 299 DQDMYVPNAXXXXXXXXXXXXXVYDDAW 326
           +Q+ Y   A              YD+AW
Sbjct: 300 EQNSYANVA---------NPGGAYDNAW 318

>YIL021W Chr9 (312905..313861) [957 bp, 318 aa] {ON}  RPB3RNA
           polymerase II third largest subunit B44, part of central
           core; similar to prokaryotic alpha subunit
          Length = 318

 Score =  519 bits (1337), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/326 (77%), Positives = 281/326 (86%), Gaps = 8/326 (2%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA++DNVDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSMDIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYEDPP EG+PFDYK++A+TFYMNVE++GSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+      NM+  G  +     G +Q
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD-NNTASNML--GSNEDVMMTGAEQ 297

Query: 301 DMYVPNAXXXXXXXXXXXXXVYDDAW 326
           D Y  NA              YD+AW
Sbjct: 298 DPY-SNASQMGNTGSGG----YDNAW 318

>KAFR0A02650 Chr1 (548878..549816) [939 bp, 312 aa] {ON} Anc_7.194
           YIL021W
          Length = 312

 Score =  517 bits (1332), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 251/326 (76%), Positives = 277/326 (84%), Gaps = 14/326 (4%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIE+LEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELK+TCIAKKGI+KEHAKW P +AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWCPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT+YWYE D  +EWPNS+NCEYEDPP E +PFDYK+KA+TFYMNVET+GSISV
Sbjct: 181 DPWNKLKHTNYWYEQDPEKEWPNSKNCEYEDPPNENDPFDYKAKADTFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300
           DQVVVRG+DTLQKKVASILL+L QM+QEK N+A G    +    I  GGA        +Q
Sbjct: 241 DQVVVRGVDTLQKKVASILLALNQMDQEKVNYASGATADMNQGDIAMGGA--------EQ 292

Query: 301 DMYVPNAXXXXXXXXXXXXXVYDDAW 326
           D +  N              +YD+AW
Sbjct: 293 DAFYSN------MPNSNANGIYDNAW 312

>Skud_9.148 Chr9 (282540..283496) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  515 bits (1326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/276 (86%), Positives = 263/276 (95%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA++D VDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDGVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSMDIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYEDPP EG+PFDYK++A+TFYMNVE++GSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGN 276
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD 276

>Smik_9.169 Chr9 (287469..288425) [957 bp, 318 aa] {ON} YIL021W
           (REAL)
          Length = 318

 Score =  514 bits (1324), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/276 (86%), Positives = 263/276 (95%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA++DNVDFILSNV+LAMANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQSMDIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLIPLQSMDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYED P EG+PFDYK++A+TFYMNVE++GSI V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDAPNEGDPFDYKAEADTFYMNVESVGSIPV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGN 276
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD 276

>NDAI0G02000 Chr7 (449842..450777) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/303 (80%), Positives = 268/303 (88%), Gaps = 3/303 (0%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSN++LA+ANS RRVM+AEIPTLAIDSVQ+ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNIDLALANSFRRVMIAEIPTLAIDSVQIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHPIIQDKENNGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKENNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D  +EWPNS+NCEYEDPP EGEPFDYK+KAETFYMNVET+GSISV
Sbjct: 181 DPWNKLKHTDYWYEQDPQKEWPNSKNCEYEDPPNEGEPFDYKAKAETFYMNVETVGSISV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSG---GADTGFAGG 297
           DQVVVRGI+TLQ+KVASILL+LTQM+QEK  +A         NM+N       D    G 
Sbjct: 241 DQVVVRGINTLQQKVASILLALTQMDQEKMQYATVTEGQQGNNMMNQDVDMDGDAYANGA 300

Query: 298 NDQ 300
           N+Q
Sbjct: 301 NNQ 303

>Suva_9.178 Chr9 (300119..301078) [960 bp, 319 aa] {ON} YIL021W
           (REAL)
          Length = 319

 Score =  513 bits (1322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/326 (75%), Positives = 282/326 (86%), Gaps = 7/326 (2%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA++DNVDFIL++V+LAMANSLRR+M+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREASKDNVDFILTSVDLAMANSLRRIMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS+DIE+LEY RDCFCEDHCDKCSVVLTLQA GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSLDIEQLEYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHP+IQDKE NGVLICKLRKGQELK+TC+AKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLLGRNIGHPVIQDKEGNGVLICKLRKGQELKLTCVAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D+A+EWP S+NCEYEDPP EG+ FDYK++A+TFYMNVE++GSI+V
Sbjct: 181 DPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDAFDYKAEADTFYMNVESVGSITV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300
           DQVVVRGIDTLQKKVASILL+LTQM+Q+K NFA G+   +  NM+  G  +     G +Q
Sbjct: 241 DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGD-NNVASNML--GTNEDVMMTGAEQ 297

Query: 301 DMYVPNAXXXXXXXXXXXXXVYDDAW 326
           D Y  NA              YD+AW
Sbjct: 298 DPYA-NASQMGNTGSSGG---YDNAW 319

>CAGL0J02420g Chr10 complement(234977..235915) [939 bp, 312 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021w RPB3
          Length = 312

 Score =  509 bits (1311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/308 (79%), Positives = 271/308 (87%), Gaps = 5/308 (1%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA RDNVDFILSNV+LA+ANSLRRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATRDNVDFILSNVDLALANSLRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EF+AHRLGLIPLQS DIE+LEY RDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFLAHRLGLIPLQSTDIEQLEYSRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLLI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TCIAKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKL+HT YWYE D  +EWP S+NCEYEDPP + EPFDYK+KA+TFYMNVE +GSI+V
Sbjct: 181 DPWNKLQHTDYWYEEDIRKEWPQSKNCEYEDPPNDDEPFDYKAKADTFYMNVEAVGSIAV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVP--GIE--GNMINSGGADTGFA- 295
           DQVV+RGIDTLQKKVASI+L+L QM+QEK NFA G+    GIE  G+ +   G D  +  
Sbjct: 241 DQVVLRGIDTLQKKVASIMLALNQMDQEKVNFATGDAKGNGIEEDGDAMMMNGHDGPYGD 300

Query: 296 GGNDQDMY 303
            G   D Y
Sbjct: 301 NGRSSDTY 308

>ZYRO0D15796g Chr4 complement(1319952..1320878) [927 bp, 308 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 308

 Score =  506 bits (1304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 274/329 (83%), Gaps = 24/329 (7%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA R+NVDFILS+VELAMANSLRRVM+AEIPTLAIDSV+VETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATRENVDFILSHVELAMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIE+LEYCRDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRN+GHPIIQDKE NGVLICKLRKGQEL + C+AKKGIAKEHAKWGP++AIEFEY
Sbjct: 121 VSNLMGRNLGHPIIQDKEGNGVLICKLRKGQELTLKCVAKKGIAKEHAKWGPSAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YW+E D A+EWP S+N EYEDPP EGEPFDY++ A TFYMNVE++GS+S 
Sbjct: 181 DPWNKLKHTEYWHEQDPAKEWPLSKNSEYEDPPNEGEPFDYRATANTFYMNVESVGSLST 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGN---MINSGGADTGFAGG 297
           DQVV+RGIDTLQKKVASILL+LTQM+Q+K NFA G   G  G+   M+N      G  GG
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVNFASGAPMGAVGDGDTMMNGDDYPYGATGG 300

Query: 298 NDQDMYVPNAXXXXXXXXXXXXXVYDDAW 326
           +                      VYDD+W
Sbjct: 301 S---------------------GVYDDSW 308

>TBLA0J01520 Chr10 (344746..345753) [1008 bp, 335 aa] {ON} Anc_7.194
           YIL021W
          Length = 335

 Score =  501 bits (1289), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 233/299 (77%), Positives = 264/299 (88%), Gaps = 3/299 (1%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQ+KIREA +DNVDFILSN+++A+ANSLRRVM+AEIPTLAIDSV+VE NTTVLAD
Sbjct: 1   MSEEGPQIKIREATKDNVDFILSNIDMALANSLRRVMIAEIPTLAIDSVEVEMNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS DI++LEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSADIDQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHPIIQDKE NGVLICKLRKGQELKMTC+AKKGIAKEHAKWG T+AIE+EY
Sbjct: 121 VSNLLGRNIGHPIIQDKEGNGVLICKLRKGQELKMTCVAKKGIAKEHAKWGATAAIEYEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D  +EWP+S+NC+YEDPP EGE FDYK+KA TFYMNVE +GSI+ 
Sbjct: 181 DPWNKLKHTDYWYENDPLKEWPHSKNCQYEDPPTEGELFDYKAKANTFYMNVEAVGSITT 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGND 299
           DQV++RGIDTLQKK A ILL+L+QMEQEK NF  G     + N ++      G + GND
Sbjct: 241 DQVIIRGIDTLQKKTAGILLALSQMEQEKVNFGTGTQ---DNNDLHQQDDHMGMSNGND 296

>TDEL0H02530 Chr8 (425329..426264) [936 bp, 311 aa] {ON} Anc_7.194
           YIL021W
          Length = 311

 Score =  498 bits (1283), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 239/326 (73%), Positives = 268/326 (82%), Gaps = 15/326 (4%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+E GPQVKIREA +DNVDFILS V+LAMANSLRR+M+AEIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSETGPQVKIREATKDNVDFILSQVDLAMANSLRRIMMAEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DIE+LEYCRDCFCEDHCDKCSVVLTLQA+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAIGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQEL M C+AKKGI+KEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELSMKCVAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D ++EWP S+N EYEDPP + + FDYK+KA TFYMNVET+GSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDISKEWPLSKNSEYEDPPNKDDAFDYKAKANTFYMNVETVGSIAT 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGNDQ 300
           DQVV+RGIDTLQKKVASILL+L QM+QE+ NF   N  G    + ++G  D    G  DQ
Sbjct: 241 DQVVLRGIDTLQKKVASILLALNQMDQERVNFGTANNTGA---IQDAGNVDVAMDGVQDQ 297

Query: 301 DMYVPNAXXXXXXXXXXXXXVYDDAW 326
           + Y                  YD+AW
Sbjct: 298 NPYSNGG------------GAYDEAW 311

>Kpol_1063.11 s1063 (29092..29787,29789..30043) [951 bp, 316 aa]
           {ON} (29092..29787,29789..30043) [951 nt, 317 aa]
          Length = 316

 Score =  491 bits (1263), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 244/331 (73%), Positives = 273/331 (82%), Gaps = 20/331 (6%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILS+V++A+ANSLRRVM+AEIPTLAIDSV+V TNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSHVDMALANSLRRVMIAEIPTLAIDSVEVITNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGL+PLQS DIE+LEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSTDIEQLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYSKDLDI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+TCIAKKGI+KEHAKWGP +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCIAKKGISKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT +W+E D A+EWP S+NCEYEDPP EGE FDYK++A+ F    ET+G+IS 
Sbjct: 181 DPWNKLKHTDFWFEQDPAKEWPQSKNCEYEDPPHEGEVFDYKAQADAFLYECETVGTISS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNV----PGIEGNM-INSGGADTGFA 295
           DQVV+RGIDTLQKKVASILL+LTQM+Q+K  +A GN      G+EGN  IN GG      
Sbjct: 241 DQVVLRGIDTLQKKVASILLALTQMDQDKVKYA-GNTNIGAGGMEGNGDINMGGT----- 294

Query: 296 GGNDQDMYVPNAXXXXXXXXXXXXXVYDDAW 326
            GND                     VYDDAW
Sbjct: 295 -GNDP--------YSNNGGEMGGNGVYDDAW 316

>TPHA0C04510 Chr3 complement(973590..974522) [933 bp, 310 aa] {ON}
           Anc_7.194 YIL021W
          Length = 310

 Score =  481 bits (1239), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 222/269 (82%), Positives = 251/269 (93%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M++EGPQVKIREA +DNVDFI+SNV+LAMAN+ RRVM+AEIPTLAIDSV+V +NTTVLAD
Sbjct: 1   MSDEGPQVKIREATKDNVDFIVSNVDLAMANAFRRVMIAEIPTLAIDSVEVISNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGL+PLQS DIE+LEY RDCFCEDHCDKCSVVLTLQA+GESESTTNVY+KDL I
Sbjct: 61  EFIAHRLGLVPLQSADIEQLEYSRDCFCEDHCDKCSVVLTLQALGESESTTNVYSKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VS+L+GRNIGHPIIQDKE NGVLICKLRKGQELK TCIAKKGIAKEHAKWGP +AIEFEY
Sbjct: 121 VSDLLGRNIGHPIIQDKEGNGVLICKLRKGQELKFTCIAKKGIAKEHAKWGPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE DAA+EWP S+NCEYEDPP EG  FDYK+KA+TFYMNVETIG+++ 
Sbjct: 181 DPWNKLKHTEYWYEQDAAKEWPQSKNCEYEDPPNEGSEFDYKAKADTFYMNVETIGTVTS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEK 269
           DQV+VRGID LQKKVASILL+L +++Q+K
Sbjct: 241 DQVIVRGIDILQKKVASILLALNRLDQDK 269

>KLTH0E04598g Chr5 (415348..416334) [987 bp, 328 aa] {ON} similar to
           uniprot|P16370 Saccharomyces cerevisiae YIL021W
          Length = 328

 Score =  479 bits (1233), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 228/300 (76%), Positives = 255/300 (85%), Gaps = 10/300 (3%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M EEGPQVKIREA +DNVDFILSNV++ MANSLRRVM+AEIPTLAIDSV+VETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDITMANSLRRVMIAEIPTLAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSSDINDLIYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDK+ NGVLICKLRKGQELK+ C+AKKGI+KEHAKW P +AIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKDGNGVLICKLRKGQELKLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YW+E DAA EWP S+NCEYEDPP E E FDY +K  TFYMNVET+GS++V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDEAFDYNAKPTTFYMNVETVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGA-----DTGFA 295
           DQVV+RG+ TLQ KVA IL SL +M+Q+K NF      G  G +   GGA     D+GFA
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG-----GTAGMVDQDGGAMPVEPDSGFA 295

>SAKL0F07458g Chr6 complement(570134..571081) [948 bp, 315 aa] {ON}
           highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 315

 Score =  476 bits (1225), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/328 (70%), Positives = 259/328 (78%), Gaps = 15/328 (4%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M EEGPQVKIREA +D+VDFILSNV++A+ANS RRVM+AEIPTLAIDSV+VETNTTVLAD
Sbjct: 1   MTEEGPQVKIREATKDSVDFILSNVDIALANSFRRVMIAEIPTLAIDSVEVETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DI  L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADINDLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNLMGRNIGHPIIQDKE NGVLICKLRKGQELK+ CIAKKGI+KEHAKW P SAIEFEY
Sbjct: 121 VSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLKCIAKKGISKEHAKWSPASAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE D A EWP S+NCEYEDPP E + FDY +K  TFYM+VET+GS++ 
Sbjct: 181 DPWNKLKHTDYWYEQDVAAEWPQSKNCEYEDPPNEDDVFDYNAKPNTFYMSVETVGSLTS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNF--AQGNVPGIEGNMINSGGADTGFAGGN 298
           DQVV+RGI TLQ KVA IL SL +M+QE+ NF  A GN   ++  M         +    
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQERVNFGGAGGNADNVDVAMDGENEMSDPYTSNQ 300

Query: 299 DQDMYVPNAXXXXXXXXXXXXXVYDDAW 326
           DQ    P+A              +DDAW
Sbjct: 301 DQYNGGPSAG-------------FDDAW 315

>Kwal_55.20380 s55 (379749..380720) [972 bp, 323 aa] {ON} YIL021W
           (RPB3) - 45 kDa subunit of RNA polymerase II [contig
           149] FULL
          Length = 323

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 220/290 (75%), Positives = 251/290 (86%), Gaps = 5/290 (1%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M EEGPQVKIREA +DNVDFILSNV++AMANSLRRVM+AEIPT+AIDSV+VETNT+VLAD
Sbjct: 1   MAEEGPQVKIREATKDNVDFILSNVDMAMANSLRRVMIAEIPTIAIDSVEVETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGL+PLQS DI  L YCRDC+CED+CD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSSDINDLIYCRDCYCEDNCDRCSVVLTLQAVGESESTTNVYAKDLVI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VSNL+GRNIGHPIIQDK+ NGVLICKLRKGQELK+ C+AKKGIAKEHAKW P +AIEFEY
Sbjct: 121 VSNLLGRNIGHPIIQDKDANGVLICKLRKGQELKLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YW+E DAA EWP S+NCEYEDPP E + FDY++K  TFYMNVE++GS++V
Sbjct: 181 DPWNKLKHTDYWHETDAAAEWPQSKNCEYEDPPNEDDAFDYRAKPTTFYMNVESVGSLTV 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGA 290
           DQVV+RG+ TLQ KVA IL SL +M+Q+K NF      G  G     GGA
Sbjct: 241 DQVVIRGMKTLQDKVADILFSLKKMDQDKVNFG-----GAAGLAEQDGGA 285

>KLLA0D16170g Chr4 complement(1362809..1363732) [924 bp, 307 aa]
           {ON} highly similar to uniprot|P16370 Saccharomyces
           cerevisiae YIL021W
          Length = 307

 Score =  463 bits (1191), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 213/277 (76%), Positives = 246/277 (88%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+LA+ANSLRRVM++EIPTLAIDSV++ETNTTVLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLALANSLRRVMISEIPTLAIDSVEIETNTTVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFIAHRLGLIPLQS DI+++ YCRDC+CEDHCD+CSV L L A+GESESTTNVYAKDL I
Sbjct: 61  EFIAHRLGLIPLQSADIDQVVYCRDCYCEDHCDRCSVELILHAIGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
            S+L GRNIGHPIIQD+E NGVLICKLRKGQE+++ CIAKKGI+KEHAKW P++AIEFEY
Sbjct: 121 TSDLKGRNIGHPIIQDREANGVLICKLRKGQEIRVKCIAKKGISKEHAKWSPSAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YWYE DA  EWP S+NCE+EDPP E E FDY++K  TFY+NVE++GSI+ 
Sbjct: 181 DPWNKLKHTDYWYEQDARDEWPQSKNCEFEDPPNEDEDFDYRAKPNTFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNV 277
           +QVVVRGI TLQ KVA IL SL +M+QEK NFA G V
Sbjct: 241 EQVVVRGIKTLQDKVADILFSLKKMDQEKVNFAAGAV 277

>ADL120C Chr4 complement(477033..477968) [936 bp, 311 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL021W
           (RPB3)
          Length = 311

 Score =  455 bits (1170), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 219/328 (66%), Positives = 256/328 (78%), Gaps = 19/328 (5%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+L++ANSLRR+M+AEIPTLAIDSV++E+NT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIESNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGL+PLQS DI++L YCRDCFCEDHCD+CSV+LTL AVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLVPLQSKDIDQLVYCRDCFCEDHCDRCSVLLTLHAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VS+L G+NIGHPIIQDKE NGVLICKLRKGQEL++ C+AKKGIAKEHAKW P +AIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGVLICKLRKGQELRLKCVAKKGIAKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKL+HT YW+E D   EWP+S+NCE+EDPP E + FDY +K  TFYMNVE++GSI  
Sbjct: 181 DPWNKLRHTDYWHEQDPEAEWPHSKNCEFEDPPNEDDQFDYSAKPNTFYMNVESVGSIPS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFAQGNVPGIEGNMINSGGADTGFAGGN-- 298
           DQVV+RGI TLQ KVA IL SL +M+Q+K  F                G  TG A     
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAF----------------GGPTGDAAPMEV 284

Query: 299 DQDMYVPNAXXXXXXXXXXXXXVYDDAW 326
           DQD Y   +              YDDAW
Sbjct: 285 DQDPYSATS-GRFNEYNDNAHAAYDDAW 311

>Ecym_4382 Chr4 (803602..804537) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii ADL120C
          Length = 311

 Score =  451 bits (1160), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 204/273 (74%), Positives = 243/273 (89%)

Query: 1   MNEEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLAD 60
           M+EEGPQVKIREA +DNVDFILSNV+L++ANSLRR+M+AEIPTLAIDSV++ETNT+VLAD
Sbjct: 1   MSEEGPQVKIREATKDNVDFILSNVDLSLANSLRRIMIAEIPTLAIDSVEIETNTSVLAD 60

Query: 61  EFIAHRLGLIPLQSMDIERLEYCRDCFCEDHCDKCSVVLTLQAVGESESTTNVYAKDLTI 120
           EFI+HRLGLIPLQS DI++L YCRDC+CEDHCD+CSVVLTLQAVGESESTTNVYAKDL I
Sbjct: 61  EFISHRLGLIPLQSKDIDQLVYCRDCYCEDHCDRCSVVLTLQAVGESESTTNVYAKDLQI 120

Query: 121 VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTSAIEFEY 180
           VS+L G+NIGHPIIQDKE NG+L+CKLRKGQEL++ C+AKKGI+KEHAKW P +AIEFEY
Sbjct: 121 VSDLGGKNIGHPIIQDKEANGILVCKLRKGQELRLKCVAKKGISKEHAKWSPAAAIEFEY 180

Query: 181 DPWNKLKHTSYWYEVDAAQEWPNSENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISV 240
           DPWNKLKHT YW+E DA  EWP+S+NCE+EDP  + + FDY +K   FY+NVE++GSI+ 
Sbjct: 181 DPWNKLKHTDYWFEQDATSEWPHSKNCEFEDPLNDDDVFDYSAKPNIFYINVESVGSITS 240

Query: 241 DQVVVRGIDTLQKKVASILLSLTQMEQEKTNFA 273
           DQVV+RGI TLQ KVA IL SL +M+Q+K  F 
Sbjct: 241 DQVVIRGIKTLQDKVADILFSLKKMDQDKVAFG 273

>Kpol_1018.139 s1018 (370051..371058) [1008 bp, 335 aa] {ON}
           (370051..371058) [1008 nt, 336 aa]
          Length = 335

 Score = 98.2 bits (243), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/291 (25%), Positives = 136/291 (46%), Gaps = 51/291 (17%)

Query: 7   QVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHR 66
           ++ I   N    +F L N++ ++AN+ RR+M++E+P++A++ V    NT+VL DE +AHR
Sbjct: 41  EINISSINSREANFDLINIDTSIANAFRRIMISEVPSVAVEYVYFLNNTSVLQDEVLAHR 100

Query: 67  LGLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------ST 110
           +GL+PL+ +D + L +      E+    D+ ++VL+L                       
Sbjct: 101 IGLVPLK-VDPDMLSWIDSELPEEEKFTDENTIVLSLNVKCTMNPDAPKDCTDPKILYKN 159

Query: 111 TNVYAKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKE 166
           +NVYA+DL       G+ +     +P++    N  +L+CKLR GQE+ +      GI  +
Sbjct: 160 SNVYARDLKFEP--QGKQVESFANYPVVP--ANPDILLCKLRPGQEISLKAHCILGIGSD 215

Query: 167 HAKWGPTSAIEFEYDPWNKL----------KHTSYW-------------YEVDAAQEWPN 203
           HAK+ P +   +   P   +          K   Y+             Y  DA ++  +
Sbjct: 216 HAKFSPVATASYRLMPHINITQPITGEDAKKFQKYFMPGVIGINDNGEAYVKDARKDTVS 275

Query: 204 SENCEYEDPPVEGEPFDYKSKAETFYMNVETIGSISVDQVVVRGIDTLQKK 254
            E   +  P  EG+          F +NVE+ G+++ +++  + +  L+ K
Sbjct: 276 RE--VFRHPEFEGK-VKLGRVRNHFIVNVESTGAMTPEEIFFKSVRILRNK 323

>Kpol_473.3 s473 complement(6708..7670) [963 bp, 320 aa] {ON}
           complement(6708..7670) [963 nt, 321 aa]
          Length = 320

 Score = 90.5 bits (223), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 133/291 (45%), Gaps = 64/291 (21%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           RE N D     L NV+ ++AN+LRR+M++E+P++A + + +  NT+V+ DE IA R+GLI
Sbjct: 36  RETNLD-----LINVDTSIANALRRIMISEVPSVAAEYIYILNNTSVIQDEVIAQRIGLI 90

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STTNVY 114
           PL+ +D +RL +  +   ED    D+ ++VL+L                        ++Y
Sbjct: 91  PLK-VDPDRLTWLNNDLPEDEKFTDENTIVLSLNVKCTRNLDAPKDCTDPSILYHNAHIY 149

Query: 115 AKDLTIVSNLMGRN----IGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           A+DL       G+        P++    +  +LI KLR GQE+ +      GI  +HAK+
Sbjct: 150 ARDLKFEP--QGKQEETFADSPVVS--ADPDILIAKLRPGQEISLRAHCILGIGADHAKF 205

Query: 171 GPTSAIEFEYDP----WNKLKHTSY-------------------WYEVDAAQEWPNSENC 207
            P     +   P      K+K  S                     Y  DA ++    E  
Sbjct: 206 SPVCTASYRLMPKIIITEKIKGESAKRFQKCFPPGVIDINENDEAYVKDARKDTMTREVL 265

Query: 208 EYEDPPVEGEPFDYKSKAET----FYMNVETIGSISVDQVVVRGIDTLQKK 254
            +E+       F  K K +     F  N+ET+G++S +++ ++ +  L+ K
Sbjct: 266 RHEE-------FQDKVKLDRVRNHFIFNIETVGAMSAEEIFLKSVKILKNK 309

>CAGL0B04125g Chr2 complement(401513..402517) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110c RPC40 DNA-directed RNA polymerase I
           III
          Length = 334

 Score = 90.5 bits (223), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 85/291 (29%), Positives = 141/291 (48%), Gaps = 53/291 (18%)

Query: 7   QVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHR 66
           QV   E    N D I   ++ ++AN+ RR+M+AE+P +A + V ++ NT+V+ DE +AHR
Sbjct: 43  QVSSHEERELNFDMI--GIDTSLANAFRRIMIAEVPAVAPEYVYIQNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQ--SMDIERLEYCRDCFCEDHCDKCSVVLTLQ--------AVGESESTT----- 111
           +GL+PL+     +ERL+       E H DK ++V+TL         A  +    T     
Sbjct: 101 IGLVPLKVDPEKLERLDTSDPDNLEFH-DKNTIVMTLNVKCTRNPDAPKDCTDPTILYNN 159

Query: 112 -NVYAKDLTI--VSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHA 168
            +VYA+DL     S+ +      P++    +  +L+ KLR GQE+ ++     G  K+HA
Sbjct: 160 AHVYARDLKFEPHSSQVETFADCPVVPCDPD--ILLAKLRPGQEISLSTHCILGEGKDHA 217

Query: 169 KWGPTSAIEFEYDPWNKLKHTSYWYEV--DAAQE----WPN-----SENCEYE--DPP-- 213
           K+ P +   +       L H      +  D+A+     +P      +EN E    DP   
Sbjct: 218 KFSPVATASYRL-----LPHIEILEPITGDSAKRFQACFPKGVIGINENGEAYVLDPRKD 272

Query: 214 ------VEGEPFDYKSK----AETFYMNVETIGSISVDQVVVRGIDTLQKK 254
                 +  E F+ K K     + F  NVE+ G++  + +V++ ID L+KK
Sbjct: 273 TVSREVLRHEEFEGKVKLGRVRDHFVFNVESTGAMQPEDIVLKSIDILKKK 323

>KAFR0A05520 Chr1 (1101190..1102194) [1005 bp, 334 aa] {ON}
           Anc_3.428 YPR110C
          Length = 334

 Score = 89.0 bits (219), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 98/203 (48%), Gaps = 31/203 (15%)

Query: 3   EEGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEF 62
            E   VKI   N    +F L +++ ++AN+ RR+M++E+P +A++ V    NT+V+ DE 
Sbjct: 37  RESFDVKISSMNEREANFDLVHIDTSVANAFRRIMISEVPAVAVEYVYFLNNTSVIQDEV 96

Query: 63  IAHRLGLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE------------ 108
           +AHR+GL+PL+ +D + L +      +D    D+ ++VLTL                   
Sbjct: 97  LAHRIGLVPLK-VDPDMLTWIDSSLPDDEKFTDENTIVLTLNVKCTRNPDAPRDCTDPNI 155

Query: 109 --STTNVYAKDLTIVSNLMGRNIGHPIIQDKENNGVLIC-------KLRKGQELKMTCIA 159
               +NVYA DL       G+      ++   NN V+ C       KLR GQE+ +    
Sbjct: 156 LYRNSNVYASDLKF--EPQGKQ-----VETFANNAVVPCDPKILLAKLRPGQEISLRAHC 208

Query: 160 KKGIAKEHAKWGPTSAIEFEYDP 182
             GI  +HAK+ P +   +   P
Sbjct: 209 ILGIGSDHAKFSPVATASYRLLP 231

>NDAI0A04770 Chr1 (1091856..1092863) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 86.7 bits (213), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 78/296 (26%), Positives = 138/296 (46%), Gaps = 65/296 (21%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN D     L N++ +MAN+ RR+M++E+P++A + V   TNT+V+ DE +AHR+G+I
Sbjct: 50  REANFD-----LINIDTSMANAFRRIMISEVPSVAAEYVYFLTNTSVIQDEVLAHRIGMI 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTL-----QAVGESESTTN---------VY 114
           PL+ +D + L +      E+    D  +VV++L     + +   +  T+         VY
Sbjct: 105 PLK-VDPDMLSWIDTSLSEEEKFTDDNTVVMSLNIKCTRNLNAPKDCTDPKILYHNSSVY 163

Query: 115 AKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           AKDL       G+ +      P++    +  +L+ KLR  QE+ +      G+  +HAK+
Sbjct: 164 AKDLKF--EPQGKQVETFAKCPVVPSDPD--ILLAKLRPDQEISLRVHCILGVGGDHAKF 219

Query: 171 GPTSAIEFEYDPW-NKLK-----------------------HTSYWYEVDAAQEWPNSEN 206
            P S   +   P  N LK                        T   Y  DA ++  + E 
Sbjct: 220 SPVSTASYRLLPHINILKPITGEQAIKFQKCFLPGVIGINEETGEAYVKDARKDTVSREV 279

Query: 207 CEYEDPPVEGEPFDYKSK----AETFYMNVETIGSISVDQVVVRGIDTLQKKVASI 258
             +E+       F+ K K     + F  NVE+ G+++ +++  + +  L+ K + +
Sbjct: 280 LRHEE-------FNDKVKLGRIRDHFIFNVESTGAMTPEEIFFKSVRILKNKASYL 328

>KLTH0F12056g Chr6 (1016695..1017747) [1053 bp, 350 aa] {ON} highly
           similar to uniprot|P07703 Saccharomyces cerevisiae
           YPR110C RPC40 RNA polymerase subunit common to RNA
           polymerase I and III
          Length = 350

 Score = 87.0 bits (214), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 94/190 (49%), Gaps = 26/190 (13%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L NV+ ++AN+ RR+M+AE+P++A + V    NT+V+ DE +AHR+GL 
Sbjct: 66  REAN-----FDLVNVDASIANAFRRIMIAEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLT 120

Query: 71  PLQSMDIERLEYCRDCF--CEDHCDKCSVVLTLQAVGESE--------------STTNVY 114
           PL+ +D + L +        E   D+ ++VLTL                        ++Y
Sbjct: 121 PLK-VDPDMLSWVDTSVPEAERFTDENTIVLTLNVRCTRNPDAPKDCTDPKILYRNAHIY 179

Query: 115 AKDLTIVSNLMGRNI--GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGP 172
           A+DL        R     +P++    +  +L+ KLR GQE+ +      GI  +HAK+ P
Sbjct: 180 ARDLKFEPQGKQRETFAKNPVV--PADPDILLAKLRPGQEISLRAHCVLGIGSDHAKFSP 237

Query: 173 TSAIEFEYDP 182
            S   +   P
Sbjct: 238 VSTASYRLMP 247

>NCAS0A11520 Chr1 complement(2279808..2280815) [1008 bp, 335 aa]
           {ON} Anc_3.428 YPR110C
          Length = 335

 Score = 86.3 bits (212), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/196 (30%), Positives = 101/196 (51%), Gaps = 25/196 (12%)

Query: 7   QVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHR 66
           +V+I   N    +F L N++ ++AN+ RR+M++E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  KVEISSLNEREANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFLNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIERLEYCRDCFC--EDHCDKCSVVLTLQAV------GESEST-------- 110
           +GLIPL+ +D + L +  +     E   D  ++VLTL            ++T        
Sbjct: 101 IGLIPLK-VDPDLLTWVDNELPDEEKFNDTNTIVLTLNVKCTRNPDAPKDATDPKILYRN 159

Query: 111 TNVYAKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKE 166
           ++VYA DL       G+ I    G P++   ++  +L+ KLR GQE+ +      G   +
Sbjct: 160 SSVYASDLKFEP--QGKQIETFAGTPVVPCDQD--ILLAKLRPGQEISLRAHCILGTGGD 215

Query: 167 HAKWGPTSAIEFEYDP 182
           HAK+ P S   +   P
Sbjct: 216 HAKFSPVSTASYRLLP 231

>Suva_16.438 Chr16 complement(753618..754625) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 85.9 bits (211), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/196 (29%), Positives = 100/196 (51%), Gaps = 25/196 (12%)

Query: 7   QVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHR 66
           +V I   +  + +F L N++ ++AN+ RR+M++E+P +A + V    NT+V+ DE +AHR
Sbjct: 41  EVNISSLDARDANFDLINIDTSIANAFRRIMISEVPAVAAEYVYFFNNTSVIQDEVLAHR 100

Query: 67  LGLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAV------GESEST-------- 110
           +GL+PL+ +D + L +      +D    D+ +VVL+L            +ST        
Sbjct: 101 IGLVPLK-VDPDMLTWVDSSLPDDEKFTDENTVVLSLNVKCTRNLDAPKDSTDPKQLYNN 159

Query: 111 TNVYAKDLTIVSNLMGRN----IGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKE 166
            +VYA+DL       GR        P++    +  +L+ KLR GQE+ +      G+  +
Sbjct: 160 AHVYARDLKF--EPQGRQSTTFANCPVLP--ADPDILLAKLRPGQEISLKAHCILGVGGD 215

Query: 167 HAKWGPTSAIEFEYDP 182
           HAK+ P S   +   P
Sbjct: 216 HAKFSPVSTASYRLLP 231

>Smik_16.353 Chr16 complement(623974..624981) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 85.9 bits (211), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 98/192 (51%), Gaps = 30/192 (15%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L N++ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQA--------------VGESESTTNVY 114
           PL+ +D + L +      +D    D+ ++VL+L                  E  +  +VY
Sbjct: 105 PLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVY 163

Query: 115 AKDLTIVSNLMGRN----IGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           A+DL       G+        P++    +  +L+ KLR GQE+ +      GI  +HAK+
Sbjct: 164 ARDLKF--EPQGKQSTTFADFPVV--PADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPTSAIEFEYDP 182
            P S   +   P
Sbjct: 220 SPVSTASYRLLP 231

>YPR110C Chr16 complement(745828..746835) [1008 bp, 335 aa] {ON}
           RPC40RNA polymerase subunit AC40, common to RNA
           polymerase I and III
          Length = 335

 Score = 85.5 bits (210), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 98/192 (51%), Gaps = 30/192 (15%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L N++ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQA--------------VGESESTTNVY 114
           PL+ +D + L +      +D    D+ ++VL+L                  E  +  +VY
Sbjct: 105 PLK-VDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNAHVY 163

Query: 115 AKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           A+DL       GR        P++    +  +L+ KLR GQE+ +      GI  +HAK+
Sbjct: 164 ARDLKF--EPQGRQSTTFADCPVV--PADPDILLAKLRPGQEISLKAHCILGIGGDHAKF 219

Query: 171 GPTSAIEFEYDP 182
            P S   +   P
Sbjct: 220 SPVSTASYRLLP 231

>KLLA0D14861g Chr4 complement(1253023..1254027) [1005 bp, 334 aa]
           {ON} highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 85.5 bits (210), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 101/195 (51%), Gaps = 25/195 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           V+I   +   V+F L +V+ ++AN+ RR+M++E+P++A + V    NT+VL DE +AHR+
Sbjct: 42  VQIESLDEREVNFDLVHVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVLQDEVLAHRI 101

Query: 68  GLIPLQSMDIERLEYCRDCF--CEDHCDKCSVVLTLQ--------AVGESE------STT 111
           GL+PL+ +D + L +        E   D+ ++V++L         A  + E         
Sbjct: 102 GLVPLK-VDPDMLSWVDTSLPESERFTDENTIVMSLNVKCTRNPDAPKDCEDPKVLYRNA 160

Query: 112 NVYAKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           ++YA+DL       G+ +      P++    +  +L+ KLR GQE+ +      GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQVEQFAKCPVVA--ADPDILLAKLRPGQEISLRAHCILGIGADH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P S   +   P
Sbjct: 217 AKFSPVSTASYRLLP 231

>TBLA0F01700 Chr6 (423582..424583) [1002 bp, 333 aa] {ON} Anc_3.428
           YPR110C
          Length = 333

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           +KI   +  +  F L N++ ++AN+ RR+M+AE+P +A + V    NT+V+ DE +AHR+
Sbjct: 42  IKISNLDERDATFDLINIDTSIANAFRRIMMAEVPAVAAEHVYFLNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+ +D + L +      E+    D+ ++VL+L                     +  
Sbjct: 102 GLVPLK-VDPDMLTWVDQTLPEEERFTDENTIVLSLNVKCTKNDKAPKDCTDPKILYNNA 160

Query: 112 NVYAKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           +VYA+DL       G+ +      P++    +  +L+ KLR GQE+ +      GI  +H
Sbjct: 161 HVYARDLKF--EPQGKQVETFANCPVVPTDPD--ILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P +   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>TPHA0D03920 Chr4 complement(821790..822797) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 84.0 bits (206), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 97/195 (49%), Gaps = 17/195 (8%)

Query: 4   EGPQVKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFI 63
           E   + I        +F L +++ ++AN+ RR+M+AE+P++A + V    NT+V+ DE +
Sbjct: 38  ESFDIHISSLTEKEANFDLVHIDTSIANAFRRIMIAEVPSVAAEYVYFMNNTSVIQDEVL 97

Query: 64  AHRLGLIPLQSMDIERLEYCRDCFC--EDHCDKCSVVLTLQAV------GESEST----- 110
           AHR+GLIPL+ +D ++L +        E   D+ ++V+TL A          ++T     
Sbjct: 98  AHRIGLIPLR-VDPDKLSWIDSELPDEEKFTDENTIVITLDAKCTRNPDAPKDATDPKVL 156

Query: 111 ---TNVYAKDLTIVSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
               +VYA+DL          +      +  +  +LI KLR GQE+ +      GI  +H
Sbjct: 157 YRNAHVYARDLKFEPQGKQAELFADQPVEAIDPDILIAKLRPGQEISLRAHCILGIGGDH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P +   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>ADR031C Chr4 complement(761933..763027) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR110C
           (RPC40)
          Length = 364

 Score = 84.3 bits (207), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 99/196 (50%), Gaps = 25/196 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           V+I+  +    +F L  V+ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 72  VQIKSLDEREANFDLLRVDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 131

Query: 68  GLIPLQSMDIERLEYCRDCF--CEDHCDKCSVVLTLQA--------------VGESESTT 111
           GL+PL+ +D + L +        E   D+ +VVL+L                  E     
Sbjct: 132 GLVPLK-VDPDMLTWVDKSLPEAERFTDENTVVLSLNVKCTHNPDAPKGSTDPKELYRNA 190

Query: 112 NVYAKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           ++YA+DL       G+ +      P++    +  +L+ KLR GQE+ +      GI  +H
Sbjct: 191 HIYARDLKF--EPQGKQLETFAKCPVV--PADPDILLAKLRPGQEISLRVHCILGIGSDH 246

Query: 168 AKWGPTSAIEFEYDPW 183
           AK+ P +   +   P+
Sbjct: 247 AKFSPVATASYRLMPY 262

>Kwal_23.3998 s23 (519065..520069) [1005 bp, 334 aa] {ON} YPR110C
           (RPC40) - RNA polymerase III (C) subunit [contig 255]
           FULL
          Length = 334

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/195 (28%), Positives = 96/195 (49%), Gaps = 25/195 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           V+I   +    +F L NV+ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VRISSLDEREANFDLVNVDASIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIERLEYCRDCF--CEDHCDKCSVVLTLQAVGESE--------------STT 111
           GL PL+ +D + L +        E   D+ ++VLTL                        
Sbjct: 102 GLTPLK-VDPDMLSWVDSSVPEAERFTDENTIVLTLNVKCTRNPDAPKDCTDPKILYRNA 160

Query: 112 NVYAKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           ++YA+DL       G+ +     +P++    +  VL+ KLR GQE+ +      GI  +H
Sbjct: 161 HIYARDLKF--EPQGKQLETFAKNPVV--PADPDVLLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>SAKL0F06028g Chr6 complement(453180..454184) [1005 bp, 334 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 334

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/195 (27%), Positives = 98/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           VKI   +    +F L +++ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+
Sbjct: 42  VKISSLDEREANFDLIHIDTSIANAFRRIMISEVPSVAPEYVYFFNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           GL+PL+ +D + L +  +   E+    D+ ++VLTL                       +
Sbjct: 102 GLVPLK-VDPDMLSWIDNSLTEEEKFTDENTIVLTLNVKCTRNPDAPKDCTDPKVLYRNS 160

Query: 112 NVYAKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           N+YA+ L       G+ +      P++    +  +L+ KLR GQE+ +      GI  +H
Sbjct: 161 NIYARHLKF--EPQGKQLETFAKSPVV--PADPDILLAKLRPGQEISLRAHCILGIGSDH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P     +   P
Sbjct: 217 AKFSPVCTASYRLMP 231

>KNAG0A07600 Chr1 complement(1192867..1193871) [1005 bp, 334 aa]
           {ON} Anc_3.428 YPR110C
          Length = 334

 Score = 83.6 bits (205), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 99/195 (50%), Gaps = 25/195 (12%)

Query: 8   VKIREANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRL 67
           +KI   +    +F L +++ ++AN+ RR+M++E+P++A + V V  NT+V+ DE +AHR+
Sbjct: 42  IKISSMSEREANFDLVHIDTSVANAFRRIMISEVPSVAAEYVYVMNNTSVIQDEVLAHRI 101

Query: 68  GLIPLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STT 111
           G+IPL+ +D + L +      E+    D+ +VVLTL                       +
Sbjct: 102 GMIPLK-VDPDMLTWIDQSLSEEEKFTDENTVVLTLNVKCTRNLNAPKDCTDPKILYKNS 160

Query: 112 NVYAKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEH 167
           +VYA+DL       G+ +      P++    +  +L+ KLR  QE+ +      GI  +H
Sbjct: 161 SVYARDLRF--EPQGKQLETFADCPVVPSDPD--ILLAKLRPNQEISLRVHCILGIGSDH 216

Query: 168 AKWGPTSAIEFEYDP 182
           AK+ P +   +   P
Sbjct: 217 AKFSPVATASYRLLP 231

>Skud_16.397 Chr16 complement(710663..711670) [1008 bp, 335 aa] {ON}
           YPR110C (REAL)
          Length = 335

 Score = 83.2 bits (204), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 92/188 (48%), Gaps = 22/188 (11%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L N++ ++AN+ RR+M++E+P +A + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLINIDASIANAFRRIMISEVPCVAAEYVYFFNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQA--------------VGESESTTNVY 114
           PL+ +D + L +      +D    D+ ++VL+L                  E  +  +VY
Sbjct: 105 PLK-VDPDMLTWVDSSLPDDEKFTDENTIVLSLNVKCTRNPDAPKDCTDPKELYNNAHVY 163

Query: 115 AKDLTIVSNLMGRNIGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKWGPTS 174
           A+DL                    +  +L+ KLR GQE+ +      GI  +HAK+ P S
Sbjct: 164 ARDLKFEPQGRQSTTFAACSVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVS 223

Query: 175 AIEFEYDP 182
              +   P
Sbjct: 224 TASYRLLP 231

>ZYRO0C12364g Chr3 complement(976920..977927) [1008 bp, 335 aa] {ON}
           highly similar to uniprot|P07703 Saccharomyces
           cerevisiae YPR110C RPC40 RNA polymerase subunit common
           to RNA polymerase I and III
          Length = 335

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 131/292 (44%), Gaps = 65/292 (22%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L +V+ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLVHVDTSIANAFRRIMISEVPSVATEYVYFLNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STTNVY 114
           PL+ +D + L +      E+    D+ ++V+TL                       +++Y
Sbjct: 105 PLK-VDPDMLTWVDHSLPEEEKFTDENTIVMTLNVKCTRNPDAPKDCTDPKILYRNSHIY 163

Query: 115 AKDLTIVSNLMGRNIGH----PIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           A+DL       G  +      P+I    +  +L+ KLR GQE+ +      G+  +HAK+
Sbjct: 164 ARDLKF--EPQGSQVETFAKCPVIPTDPD--ILLAKLRPGQEISLRAHCILGVGSDHAKF 219

Query: 171 GPTSAIEFEYDPWNKLKH------------------------TSYWYEVDAAQEWPNSEN 206
            P +   +   P   ++                         T   Y  DA ++  + E 
Sbjct: 220 SPVATASYRLLPHIDIREPIKGELAQKFQKCFPPGVIGINESTDEAYVQDARKDTVSREV 279

Query: 207 CEYEDPPVEGEPFDYKSK----AETFYMNVETIGSISVDQVVVRGIDTLQKK 254
             +E+       F  K K     + F  NVE+ G+++ +++  + +  L+ K
Sbjct: 280 LRHEE-------FSNKVKLGRVRDHFVFNVESTGAMTPEEIFFKSVRVLKNK 324

>Ecym_4450 Chr4 (921163..922167) [1005 bp, 334 aa] {ON} similar to
           Ashbya gossypii ADR031C
          Length = 334

 Score = 82.8 bits (203), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 98/192 (51%), Gaps = 30/192 (15%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L +++ ++AN+ RR+M++E+P++A + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLIHIDASIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCF--CEDHCDKCSVVLTLQA--------------VGESESTTNVY 114
           PL+ +D + L +        E   D+ +VV++L                  E  +  ++Y
Sbjct: 105 PLK-VDPDMLTWVDKSLPEAERFTDENTVVMSLNVKCTANPDAPKGSTDPKELYNNAHIY 163

Query: 115 AKDLTIVSNLMGRNI----GHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           ++DL       G+ +     HP++    +  +L+ KLR GQE+ +      G+  +HAK+
Sbjct: 164 SRDLKF--EPQGKQLDSFAKHPVLPTDPD--ILLAKLRPGQEISLRVHCILGVGGDHAKF 219

Query: 171 GPTSAIEFEYDP 182
            P     +   P
Sbjct: 220 SPVCTASYRLMP 231

>TDEL0F03100 Chr6 complement(567682..568689) [1008 bp, 335 aa] {ON}
           Anc_3.428 YPR110C
          Length = 335

 Score = 82.0 bits (201), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 96/192 (50%), Gaps = 30/192 (15%)

Query: 11  REANRDNVDFILSNVELAMANSLRRVMVAEIPTLAIDSVQVETNTTVLADEFIAHRLGLI 70
           REAN     F L +++ ++AN+ RR+M++E+P+LA + V    NT+V+ DE +AHR+GL+
Sbjct: 50  REAN-----FDLIHIDTSIANAFRRIMISEVPSLAPEHVYFLNNTSVIQDEVLAHRIGLV 104

Query: 71  PLQSMDIERLEYCRDCFCEDH--CDKCSVVLTLQAVGESE--------------STTNVY 114
           PL+ +D + L +      E+    D+ ++VLTL                       ++VY
Sbjct: 105 PLK-VDPDMLTWVDSTLPEEERFTDENTIVLTLNVTCTRNPDAPKDCTDPKILYRNSSVY 163

Query: 115 AKDLTIVSNLMGRN----IGHPIIQDKENNGVLICKLRKGQELKMTCIAKKGIAKEHAKW 170
           A DL       GR        P++    +  +L+ KLR GQE+ +      G+  +HAK+
Sbjct: 164 AHDLKF--EPQGRQAELFAKCPVV--PADPDILLAKLRPGQEISLRAHCILGVGGDHAKF 219

Query: 171 GPTSAIEFEYDP 182
            P +   +   P
Sbjct: 220 SPVATASYRLLP 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,967,304
Number of extensions: 1359230
Number of successful extensions: 3366
Number of sequences better than 10.0: 47
Number of HSP's gapped: 3434
Number of HSP's successfully gapped: 47
Length of query: 326
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 216
Effective length of database: 40,868,139
Effective search space: 8827518024
Effective search space used: 8827518024
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)