Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
KNAG0H026907.196ON41941920730.0
Suva_9.1777.196ON43541316250.0
Skud_9.1477.196ON43141215950.0
Smik_9.1687.196ON43140415910.0
Kpol_1063.97.196ON41740815670.0
KLLA0D16214g7.196ON41840615630.0
CAGL0J02442g7.196ON41241115560.0
YIL022W (TIM44)7.196ON43140415540.0
TDEL0H025107.196ON41840515470.0
SAKL0F07502g7.196ON41238415150.0
NDAI0B017807.196ON43440414870.0
NCAS0A125207.196ON43240514860.0
Kwal_55.203687.196ON41241514830.0
KLTH0E04554g7.196ON47941614830.0
ZYRO0D15840g7.196ON40738414650.0
TPHA0C045307.196ON41640014610.0
Ecym_43807.196ON41842114410.0
ADL118C7.196ON41842114340.0
KAFR0A026407.196ON42140014040.0
TBLA0J015007.196ON42140512401e-169
Kpol_1024.188.384ON83459820.17
CAGL0L09669g2.653ON166268696.3
CAGL0K08404g8.384ON82259696.7
KNAG0A064702.475ON44166686.9
TBLA0C014801.398ON35347687.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= KNAG0H02690
         (419 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   803   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   630   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   619   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   617   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   608   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   606   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   603   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   603   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   600   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   588   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   577   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   577   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   575   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   575   0.0  
ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   568   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   567   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   559   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   556   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   545   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   482   e-169
Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON} (60564....    36   0.17 
CAGL0L09669g Chr12 (1036568..1041556) [4989 bp, 1662 aa] {ON} si...    31   6.3  
CAGL0K08404g Chr11 complement(846867..849335) [2469 bp, 822 aa] ...    31   6.7  
KNAG0A06470 Chr1 (985023..986348) [1326 bp, 441 aa] {ON} Anc_2.4...    31   6.9  
TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {O...    31   7.5  

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/419 (94%), Positives = 398/419 (94%)

Query: 1   MLAYKTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENI 60
           MLAYKTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENI
Sbjct: 1   MLAYKTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENI 60

Query: 61  RTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKAS 120
           RTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKAS
Sbjct: 61  RTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKAS 120

Query: 121 RKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGE 180
           RKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFT         KALASGE
Sbjct: 121 RKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTREERQRRREKALASGE 180

Query: 181 RVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIV 240
           RVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIV
Sbjct: 181 RVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIV 240

Query: 241 FMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKV 300
           FMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKV
Sbjct: 241 FMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKV 300

Query: 301 LKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQ 360
           LKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAK            GCRAQ
Sbjct: 301 LKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKLLQPQDLPVLVVGCRAQ 360

Query: 361 EINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           EINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT
Sbjct: 361 EINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/413 (74%), Positives = 352/413 (85%), Gaps = 2/413 (0%)

Query: 7   VRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDA 66
            RP  AG+ ++ARA   T+     GG +PRSPL IFRDTFKKEW+KSQELQENI+TLQDA
Sbjct: 25  CRPQDAGL-LIARALFSTSATRAQGG-NPRSPLQIFRDTFKKEWDKSQELQENIKTLQDA 82

Query: 67  SGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVK 126
           SGK+GE+EAY+KAREA+LRAQ+GSTIVGKTLKKTGETVE IA++AWDSE+ K +RKAA  
Sbjct: 83  SGKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASA 142

Query: 127 TAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVK 186
           TA+KLDE FEPVRQT++YK+VSEVIDDG+S+ YGGF T         K LASG+R RAVK
Sbjct: 143 TAKKLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVK 202

Query: 187 SNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVS 246
           SNDEAGTA+VAT +ESKES GKK+EDFKEKTAVGRS+  LK+RLWDESENPLIV MRKV+
Sbjct: 203 SNDEAGTAVVATNIESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVT 262

Query: 247 GKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFS 306
            KVG FFAETES RVY+QFK+MDP F++  FT+HLREY+VPEILEAYV+GD KVLKKWFS
Sbjct: 263 NKVGGFFAETESSRVYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFS 322

Query: 307 EAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYK 366
           EAP+NVYAAQQK+FKE+ +FADGRILDIRGVEIVSAK            GCRAQEINLY+
Sbjct: 323 EAPFNVYAAQQKIFKEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYR 382

Query: 367 KVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           K KTGEIAAG E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 383 KRKTGEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/412 (73%), Positives = 351/412 (85%), Gaps = 2/412 (0%)

Query: 8   RPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDAS 67
           R   AG+ +VAR    T+     GG +PRSPL IFRDTFKKEWEKSQELQENI+TLQDAS
Sbjct: 22  RSQDAGL-LVARVLFSTSATRAQGG-NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDAS 79

Query: 68  GKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKT 127
           GK+GE+EAY+KAREA+LRAQ+GSTIVGKTLKKTGET+E IA+KAW+SE+ K +RKAA  T
Sbjct: 80  GKLGESEAYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASAT 139

Query: 128 AQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKS 187
           A++LDE FEPVRQT++YK+VSEVIDDG+S+ YGGF T         K LASG+R RAVKS
Sbjct: 140 AKRLDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKS 199

Query: 188 NDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSG 247
           NDEAGTA+VAT +ESKES GKK+EDF+EKTA+GRS+  LK+RLWDESENPLIV MRKV+ 
Sbjct: 200 NDEAGTAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTN 259

Query: 248 KVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSE 307
           KVG FFAETES RV++QFKLMDP F++ +FT+HLR+Y+VPEILEAYV+ D KVLKKWFSE
Sbjct: 260 KVGGFFAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSE 319

Query: 308 APYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKK 367
           APYNVYAAQQK+F+E+ ++ADGRILDIRGVEIVSAK            GCRAQEINLY+K
Sbjct: 320 APYNVYAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRK 379

Query: 368 VKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
            KTGEIAAG+E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 380 RKTGEIAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/404 (73%), Positives = 346/404 (85%), Gaps = 1/404 (0%)

Query: 16  VVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75
           ++AR    T+     GG +PRSPL IFRDTFKKEWEKSQELQENI+TLQDASGK+GE+EA
Sbjct: 29  MIARVLFSTSATRTQGG-NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87

Query: 76  YRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGF 135
           Y+KAREA+L+AQ+GSTIVGKTLKKTGET+E IA+KAW+SE+ K +RKAA  TA+KLDE F
Sbjct: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESF 147

Query: 136 EPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTAL 195
           EPVRQT++YK+VSEVIDDG+S+ YGGF T         K LASG+R RAVKSNDEAGTA+
Sbjct: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAV 207

Query: 196 VATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAE 255
           VAT +ESKES GKK+EDFKEKT VGRS+  LK++LWDESENPLIV MRK++ KVG FFAE
Sbjct: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267

Query: 256 TESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAA 315
           TES RVY+QFK+MDP F++ +FT+HLREY+VPEILEAYV+GD KVLKKWFSEAP+NVYAA
Sbjct: 268 TESSRVYSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327

Query: 316 QQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAA 375
           QQK+FKE+ ++ADGRILDIRGVE+VSAK            GCRAQEINLY+K KTGEIAA
Sbjct: 328 QQKIFKEQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387

Query: 376 GSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           G E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/408 (71%), Positives = 345/408 (84%), Gaps = 6/408 (1%)

Query: 15  RVVARAPLH---TARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIG 71
           +++    +H   T+  +L G   PR+P+ IFRDTFKKEWEKS++LQ+NI+ LQDASG++G
Sbjct: 13  KLLCSGSIHLFSTSSRVLQG---PRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLG 69

Query: 72  ETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKL 131
           E+EAY+KAREA+L+AQKGSTIVGKTL+KTGETVE IASKAWDSEI K++RKAA  TA+K+
Sbjct: 70  ESEAYKKAREAYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKI 129

Query: 132 DEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEA 191
           DE FEPVR+TQ+YKDVS+VIDDGDS+ YGGF             L SG+RVRAVKSNDEA
Sbjct: 130 DESFEPVRKTQVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEA 189

Query: 192 GTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGK 251
           GT++VAT +E+KESLGKKMEDFKE T  GR++HG+K +LWDE+ENPLIVF+RKVSGK+G 
Sbjct: 190 GTSIVATNIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGG 249

Query: 252 FFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYN 311
           FFAETES RV +QFKLMDP F++ +FTKHLREY++PE+LEAYV+GDE VLKKWFSEAPYN
Sbjct: 250 FFAETESSRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYN 309

Query: 312 VYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTG 371
           VYAAQQK F+++ LF DGRILDIRGVEIVSAK            GCRAQEI+LY+KVKTG
Sbjct: 310 VYAAQQKEFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTG 369

Query: 372 EIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           EIAAG ESNILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 370 EIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  606 bits (1563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/406 (72%), Positives = 339/406 (83%), Gaps = 1/406 (0%)

Query: 15  RVVARAP-LHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGET 73
           + VARA  + T  V      +PRSPL IFR+TFK+EWEKS+ELQ+NI+ LQDASGK+GE+
Sbjct: 13  KAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLGES 72

Query: 74  EAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDE 133
           EAY+KAREA+++AQKGSTIVGKTLKKTGETVE IASKAWDSEIAK++RK   KTA KLDE
Sbjct: 73  EAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKLDE 132

Query: 134 GFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGT 193
            FEPVR+T++YKDVSEVIDDGDS+ YGGF T         +A+ASG+R RAVKSND AGT
Sbjct: 133 SFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAAGT 192

Query: 194 ALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFF 253
           ALVAT +ESKES GKK+EDFKEKT VGR LH  K +LWDESENPL+V +R VSGK+G  F
Sbjct: 193 ALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGGLF 252

Query: 254 AETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVY 313
           AETES RVY QFK+MDP FN+  FTKHLREY++PEILEAYV+GDE VLK+WFSEAPYNVY
Sbjct: 253 AETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVY 312

Query: 314 AAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEI 373
           AAQQK F+E+ LFADG+ILDIRGVEIVSAK            GCRAQEI+LY+K KTGEI
Sbjct: 313 AAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTGEI 372

Query: 374 AAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           AAG+ES+ILMSSYAMVFTRDPE V D+ETEGWKILEFVRGGSRQFT
Sbjct: 373 AAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/411 (71%), Positives = 349/411 (84%), Gaps = 5/411 (1%)

Query: 10  ASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGK 69
           +++GV +VAR    T  VLL+   +PRSPL IFR+TFKKEWEKSQELQ+NI+TLQDASG+
Sbjct: 6   STSGV-LVARRCFGTRSVLLS---NPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGR 61

Query: 70  IGETEAYRKAREAFLRAQKGS-TIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTA 128
           +GE+EAY+KAREA+L+A KGS TIVGKTL+KTGETVE +A+KAWDS+IAK +R  A KTA
Sbjct: 62  LGESEAYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTA 121

Query: 129 QKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSN 188
           +KLDE FEPVRQT++YKDVSEVIDDGDS+SYGGF T         K LASG+RVRAVKSN
Sbjct: 122 KKLDESFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSN 181

Query: 189 DEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGK 248
           DEAG+ALVAT +E+KESLGKK+EDFKEKT VGR+L  +K  LWDESENPLIVF+RK++GK
Sbjct: 182 DEAGSALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGK 241

Query: 249 VGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEA 308
           +G FFAETES RVY QFK++DP F ++ FTKHLR+Y+VPE+LEAYV+GDEKVLKKWFSEA
Sbjct: 242 IGGFFAETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEA 301

Query: 309 PYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKV 368
           P+NVY AQQK+FK++ LF+DG+ILDIRGVE+VSAK            GCRAQEI+LY+K 
Sbjct: 302 PFNVYNAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKA 361

Query: 369 KTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           KTGEIAAG ESNILMSSYAMVFTRDPEQ+ D+ETEGWKILEF+RG SR F 
Sbjct: 362 KTGEIAAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/404 (73%), Positives = 346/404 (85%), Gaps = 1/404 (0%)

Query: 16  VVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75
           +VAR    T+     GG +PRSPL IFRDTFKKEWEKSQELQENI+TLQDASGK+GE+EA
Sbjct: 29  LVARVLFSTSTTRAQGG-NPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEA 87

Query: 76  YRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGF 135
           Y+KAREA+L+AQ+GSTIVGKTLKKTGET+E IA+KAW+SE+ K +RKAA  TA+KLDE F
Sbjct: 88  YKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKKLDESF 147

Query: 136 EPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTAL 195
           EPVRQT++YK+VSEVIDDG+S+ YGGF T         + LASG+R RAVKSN++AGTA+
Sbjct: 148 EPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNEDAGTAV 207

Query: 196 VATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAE 255
           VAT +ESKES GKK+EDFKEKT VGRS+  LK++LWDESENPLIV MRK++ KVG FFAE
Sbjct: 208 VATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAE 267

Query: 256 TESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAA 315
           TES RVY+QFKLMDP F++ +FT+HLREY+VPEILEAYV+GD KVLKKWFSEAP+NVYAA
Sbjct: 268 TESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAA 327

Query: 316 QQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAA 375
           QQK+FKE+ ++ADGRILDIRGVEIVSAK            GCRAQEINLY+K KTGEIAA
Sbjct: 328 QQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAA 387

Query: 376 GSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           G E+NILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 388 GDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/405 (70%), Positives = 344/405 (84%), Gaps = 3/405 (0%)

Query: 15  RVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETE 74
           R+  RA   T+   L   ++PRSP+ IFRDTFKKEW+KSQELQ+NI+TLQDASG++GE+E
Sbjct: 17  RLAGRALFSTSSGSL---QNPRSPVQIFRDTFKKEWKKSQELQDNIKTLQDASGRLGESE 73

Query: 75  AYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEG 134
           AY++AREA++RAQKGSTIVGKTLKKTGETVE IASKAWDSEIA+ +R+AA KTA+K+DEG
Sbjct: 74  AYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTREAASKTAKKIDEG 133

Query: 135 FEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTA 194
           FEPVRQT++YKDVSEV+DDG+S+ YGGF T         + + SG+R +AVK N++AGTA
Sbjct: 134 FEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKRAKAVKGNEDAGTA 193

Query: 195 LVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFA 254
           LVAT +E+K+S GKK+EDFKEKT +GR+LH LK+ LWDES NPLIVF+RK++ K+G FFA
Sbjct: 194 LVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVFLRKITRKIGGFFA 253

Query: 255 ETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYA 314
           ETE+ RV  QFK+MDP F + +FT+HLREYV+PEILEAYV+GDEKVLKKWFSEAPYNVYA
Sbjct: 254 ETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVLKKWFSEAPYNVYA 313

Query: 315 AQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIA 374
           AQQK F+E+ LFADG+ILDIRGVEIVSAK            GCRAQEI+LY+K KTGE+A
Sbjct: 314 AQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQEIHLYRKAKTGEVA 373

Query: 375 AGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           AG ESNI+MSSYAMVFTRDPEQ+ DEETEGW+ILEFVRGGSRQFT
Sbjct: 374 AGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/384 (73%), Positives = 326/384 (84%)

Query: 36  RSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGK 95
           RSPL IFR+TFK+EWEKS+ELQ+NI+TLQDASGK+GE++AY+KAREA+LRAQKGSTIVGK
Sbjct: 29  RSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYLRAQKGSTIVGK 88

Query: 96  TLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGD 155
           TLKKTGETVE IA KAW+SE+ K +RKA   TAQK+DE FEPVRQT++YKDVSEVIDDG+
Sbjct: 89  TLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVYKDVSEVIDDGE 148

Query: 156 STSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKE 215
           S+ YGGF T         + LASG+R +AVKSNDEAGTALVAT +E+KES  KK+EDFKE
Sbjct: 149 SSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKESFSKKIEDFKE 208

Query: 216 KTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSV 275
           KT  GR +H +K RLWDESENPLIV +R +  KVG  FAETES RV  QFK++DPNFN+ 
Sbjct: 209 KTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQFKMLDPNFNTE 268

Query: 276 TFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIR 335
           +FTKHLREY++PEILEAYV+GDE VLK+WFSEAPYNVYAAQQK F+++ LFADGRILDIR
Sbjct: 269 SFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQELFADGRILDIR 328

Query: 336 GVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPE 395
           GVEIVSAK            GCRAQEI+LY+K KTGEIAAG+ESNIL+SSYAMVFTRDPE
Sbjct: 329 GVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLSSYAMVFTRDPE 388

Query: 396 QVTDEETEGWKILEFVRGGSRQFT 419
            V D+ETEGW+ILEFVRGGSRQFT
Sbjct: 389 NVDDKETEGWRILEFVRGGSRQFT 412

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/404 (68%), Positives = 328/404 (81%), Gaps = 1/404 (0%)

Query: 17  VARAPLHTARVLLNG-GRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75
           V +    T R  LN  G   R+P+ IFRDTFKKEWEKSQELQ+NI+ L DASGK+ E+E 
Sbjct: 31  VGKVLFSTTRTTLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESET 90

Query: 76  YRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGF 135
           ++ A++A+L+A KGSTIV KTLKKTGETVE +ASKAWDSEI K +R AA KTA+ +D+ F
Sbjct: 91  FKMAKDAYLKAHKGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSF 150

Query: 136 EPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTAL 195
           EPVR+TQ+YKDVSEVIDDGDS+ YGGF T         + LASG+R RAVKSNDEAGTAL
Sbjct: 151 EPVRKTQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTAL 210

Query: 196 VATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAE 255
           VAT +E+KES GKK+EDFKEKT VG+++  +K +LWDESENPLIV +RK+S K+  FF E
Sbjct: 211 VATNIEAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDE 270

Query: 256 TESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAA 315
           TES +VYTQFKLMD  F +  FT+HLR+Y+VPEILEAY++GDEKVLKKWFSEAP+NVYAA
Sbjct: 271 TESAKVYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAA 330

Query: 316 QQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAA 375
           QQK+F+E+ LF+DGRILDIRGVEIVSAK            GCRAQEINLYKK K+GEIAA
Sbjct: 331 QQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAA 390

Query: 376 GSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           G ESNI+MSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSR F 
Sbjct: 391 GDESNIVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPFN 434

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/405 (68%), Positives = 334/405 (82%), Gaps = 2/405 (0%)

Query: 16  VVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEA 75
           VV +    T     NGG   R+P+ IFRDTFKKEW+KSQELQENI+ L DASGK+ E+E 
Sbjct: 29  VVNKGLFSTTTARSNGG-GGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESET 87

Query: 76  YRKAREAFLRAQKGS-TIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEG 134
           ++ A++A+L+A KGS TI+ KT++KTGETVE +ASKAWDSEIAK++R+AA KTA  LD+ 
Sbjct: 88  FKMAKDAYLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKS 147

Query: 135 FEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTA 194
           FEPVR+TQ+YKD+SEVIDDGDS+ YGGF T           LASG+R RA+KSN+EAGTA
Sbjct: 148 FEPVRKTQVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTA 207

Query: 195 LVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFA 254
           LVAT +E+K+S GKK+EDFKEKT VG+++  +K +LWDESENPLIVF+RK++ K+G FF 
Sbjct: 208 LVATDIEAKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFD 267

Query: 255 ETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYA 314
           ETES RVYTQFK+MD  F +  FT+HLREY+VPE+LEAY++GDEKVLKKWFSEAP+NVY+
Sbjct: 268 ETESARVYTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYS 327

Query: 315 AQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIA 374
           AQQK+F+E+ LF+DGRILDIRGVEIVSAK            GCRAQEINLY+KVKTGEIA
Sbjct: 328 AQQKVFREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIA 387

Query: 375 AGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           AG +SNILMSSYAMVFTRDPEQ+ D+ETEGWKILEFVRGGSRQFT
Sbjct: 388 AGDQSNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/415 (66%), Positives = 338/415 (81%), Gaps = 5/415 (1%)

Query: 5   KTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQ 64
           + VRP   G  V +R    T R       +PRSPL IFR+TFK+EW+KSQELQ+NI+ LQ
Sbjct: 3   RPVRPV--GNVVFSRKLSQTIRACQG---NPRSPLQIFRETFKQEWKKSQELQDNIKALQ 57

Query: 65  DASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAA 124
           DASGK+GE++AY+KAREA+L+AQKGSTIVGKT+KKTG++VE IA+KAW+SEI+K++RKA 
Sbjct: 58  DASGKLGESDAYKKAREAYLKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAV 117

Query: 125 VKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRA 184
            KTA KLDE FEPVR T++YKDVSEV++ G+S+ YGGF T         + +ASG+R +A
Sbjct: 118 NKTAAKLDESFEPVRHTRVYKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKA 177

Query: 185 VKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRK 244
           V+SNDEAGTALVAT +E+KES GKK++DFKEKT VGR LH  K +LWDESENPLIV +R 
Sbjct: 178 VRSNDEAGTALVATNIEAKESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRT 237

Query: 245 VSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKW 304
           +  K+G  FAETES RV  QFK+MD NFNS +F  HLREY++PE+LEAYV+GDEKVLK+W
Sbjct: 238 IGNKIGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQW 297

Query: 305 FSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINL 364
           FSEAPYNVYAAQQK+F+E+ LFADGRILDIRGV+IVSAK            GCRAQEI+L
Sbjct: 298 FSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHL 357

Query: 365 YKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           Y+ VKTGE+AAG++SNILMSSYAMVFTRDPE + ++ETEGWKILEFVRGGSRQFT
Sbjct: 358 YRDVKTGEVAAGTQSNILMSSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  575 bits (1483), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/416 (66%), Positives = 335/416 (80%), Gaps = 2/416 (0%)

Query: 4   YKTVRPASAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTL 63
           ++ +RP      VV R  L        G  +PRSPL IFR+TFK+EW+KSQELQ+NI+ L
Sbjct: 66  FRMLRPGRPLKSVVIRRNLAQTFKACQG--NPRSPLQIFRETFKQEWKKSQELQDNIKAL 123

Query: 64  QDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKA 123
           QDASGKIGE+EAY+KAREA+L AQKGSTIVGKTLKKTG++VE IA+KAW+SEI K++R+A
Sbjct: 124 QDASGKIGESEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQA 183

Query: 124 AVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVR 183
             KTA KLDE FEPVR T++YKDVSEV+D  +S+ YGGF +         + +ASG+R +
Sbjct: 184 VNKTAAKLDESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPK 243

Query: 184 AVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMR 243
           AVKSN+EAGTALVAT +E+KES GKK++DFKEKT VGR L  +K +LWDESENPLIV MR
Sbjct: 244 AVKSNEEAGTALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMR 303

Query: 244 KVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKK 303
            +  KVG  FAETES RV  QFK+MD NFNS +F  HLREY++PE+LEAYV+G+E+VLK+
Sbjct: 304 TIGNKVGGLFAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQ 363

Query: 304 WFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEIN 363
           WFSEAPYNVYAAQQK+F+E+ LFADGRILDIRGV+IVSAK            GCRAQEI+
Sbjct: 364 WFSEAPYNVYAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIH 423

Query: 364 LYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           LY+ VKTGE+AAG++SNILMSSYAMVFTRDPE + D+ETEGWKILEFVRGGSRQFT
Sbjct: 424 LYRDVKTGEVAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/384 (69%), Positives = 325/384 (84%)

Query: 36  RSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGK 95
           RSPL IFRDTFKKEWEKSQELQENI+TLQDASG++G++E  ++AREA+LRAQKGSTIVGK
Sbjct: 24  RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYLRAQKGSTIVGK 83

Query: 96  TLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGD 155
           TL+KTGETVEGIASKAW+SEIAK++R AA  TA+KLD+ FEPVR T++YKDVSEV++D D
Sbjct: 84  TLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLDKSFEPVRNTKIYKDVSEVMEDAD 143

Query: 156 STSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKE 215
           ++ YGGF T         + +ASG+R RA++SN+EAGTALVAT +E+KESLGKK+EDF+E
Sbjct: 144 TSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKESLGKKVEDFRE 203

Query: 216 KTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSV 275
           KT +GR++  LK RLW+E+ENPLIV +RK++ KVG FFAETE+ +V  QFKL+DP+F S 
Sbjct: 204 KTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQFKLLDPSFTSE 263

Query: 276 TFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIR 335
            FT+ LR+YV+PE+LEAY +GDEK LKKWFSEAP+NVYAAQQK F+++ LFAD RILDIR
Sbjct: 264 GFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQKLFADSRILDIR 323

Query: 336 GVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPE 395
           GV+IVSAK            GCRAQEI LY+ +K+GE+AAG ESNILMSSYAMVFTRDPE
Sbjct: 324 GVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMSSYAMVFTRDPE 383

Query: 396 QVTDEETEGWKILEFVRGGSRQFT 419
            V DEETEGW+I+EFVRGGSRQFT
Sbjct: 384 NVEDEETEGWRIIEFVRGGSRQFT 407

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  567 bits (1461), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/400 (66%), Positives = 329/400 (82%), Gaps = 2/400 (0%)

Query: 20  APLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKA 79
           A   T+ VL NGG   ++P+ IFR+TFKKEWEKSQELQ+NI+TLQDASG++G++EAY+KA
Sbjct: 19  AYFSTSTVLRNGG--GKTPIQIFRETFKKEWEKSQELQDNIKTLQDASGRLGQSEAYKKA 76

Query: 80  REAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVR 139
           +EA+++AQ+ STIV KTLKKTGETVE +A K WDSEI K++RK   + A+K+DE FEPVR
Sbjct: 77  KEAYVKAQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKVVSQGAKKIDESFEPVR 136

Query: 140 QTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTALVATG 199
           QTQ+YK+VSEVIDDG+S+ YGGF +           LASG+RVRA KSN+EAGTA+VAT 
Sbjct: 137 QTQVYKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVRATKSNEEAGTAIVATN 196

Query: 200 VESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESG 259
           VESKES GKK++DFKEKT VG+++   K R+WDE+ENPLIV +R +S K+  FFAETES 
Sbjct: 197 VESKESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLRTISNKISGFFAETESS 256

Query: 260 RVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKM 319
           RVY+QFKLMDP F++  FTKHLR+Y++PE+LEAYV+GDE VLKKWFSEAP+NVYAAQQK 
Sbjct: 257 RVYSQFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKKWFSEAPFNVYAAQQKE 316

Query: 320 FKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAAGSES 379
            +++ LF DGRILDIRGV+IVSAK            GCRAQE++LY+KVKTGE+ AG ES
Sbjct: 317 LRKQQLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELHLYRKVKTGELGAGDES 376

Query: 380 NILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           NI+MSSYAMVFTRDP+ + D+ETEGWKILEFVRGGSRQFT
Sbjct: 377 NIMMSSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  559 bits (1441), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/421 (63%), Positives = 325/421 (77%), Gaps = 5/421 (1%)

Query: 1   MLAYKTVRPA--SAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQE 58
           ML Y  ++ +  S   + V      T  +  NG    +SPL IFR+TFK EW+KSQELQ+
Sbjct: 1   MLKYAAIKQSRMSGIAKAVPARQFSTTGLSWNG---QKSPLQIFRETFKDEWKKSQELQD 57

Query: 59  NIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAK 118
           NI+ LQDASG++GE++AY+KAREA+L+AQ+GST+VGKTLKKTGET+E +  KAWDS+I K
Sbjct: 58  NIKALQDASGRLGESDAYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGK 117

Query: 119 ASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALAS 178
            +R+   KTAQKLDE FEPVR T++YKD+SE+IDDG+S+ YGGF             LAS
Sbjct: 118 NTREVVSKTAQKLDESFEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLAS 177

Query: 179 GERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPL 238
           G R  AV+SNDEAGTA+VAT  E KES GKK++DFKEKT +GR LH  K +LWDE+ENPL
Sbjct: 178 GRRTHAVRSNDEAGTAMVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPL 237

Query: 239 IVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDE 298
           I  +R +S K+G  FAETES RV+ QFKL+DP FNS  FTKHLREY++PE+LEAYV+GDE
Sbjct: 238 ISMLRTISNKIGGLFAETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDE 297

Query: 299 KVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCR 358
            VLK+W SEAPYNVYAAQQK F+E+ LF DGR+LDIRGVEIVSAK            GCR
Sbjct: 298 VVLKQWLSEAPYNVYAAQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCR 357

Query: 359 AQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQF 418
            QEI+LY+K KTGEIAAG ESNI+MSSYAMV TRDPE VTD+ETEGWK+LEF+RGGSRQF
Sbjct: 358 VQEIHLYRKAKTGEIAAGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQF 417

Query: 419 T 419
           T
Sbjct: 418 T 418

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  556 bits (1434), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/421 (64%), Positives = 331/421 (78%), Gaps = 5/421 (1%)

Query: 1   MLAYKTVRPA--SAGVRVVARAPLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQE 58
           M  Y  V+ A  S   RV+A       R   NG   P+SPL +FR+TFK+EW+KSQELQ+
Sbjct: 1   MHRYSAVKQAQKSQPQRVLAARGFSATRWAGNG---PKSPLQVFRETFKEEWKKSQELQD 57

Query: 59  NIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAK 118
           NI+ LQDA G++GE++AY+KAREA+L+AQKGSTIVGKTLK+TGET+E I  +AW+SEI K
Sbjct: 58  NIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGKTLKRTGETLEHITVQAWESEIGK 117

Query: 119 ASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGDSTSYGGFFTXXXXXXXXXKALAS 178
            +RK   KTAQKLDE FEPVRQT++YKD+SE+IDDG+S+ YGGF           + LA+
Sbjct: 118 TTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGESSRYGGFMEKERRREKRERDLAT 177

Query: 179 GERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPL 238
           G+R   V+SN+EAG+ALVAT  E+ ESLGKK++DFKEKT VGR LH +K RLWDE+ENPL
Sbjct: 178 GKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKEKTVVGRKLHEIKVRLWDENENPL 237

Query: 239 IVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDE 298
           I  +R +S KVG  FAETES RV+ QFKL+DP FN+  FTKHLREY++PE+LEAYV+GDE
Sbjct: 238 IGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTEEFTKHLREYIIPEVLEAYVKGDE 297

Query: 299 KVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCR 358
           +VLK+WFSEAPYNVY+AQQK  +++ LFADGRILDIRGVEI+SAK            GCR
Sbjct: 298 QVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIRGVEIISAKLLPPQDVPAIVVGCR 357

Query: 359 AQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQF 418
           AQEI+L++K  TGEIAAG ESNI++SSYAMV TRDPE+V D+ETEGWKILEFVRGGSR F
Sbjct: 358 AQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPEKVDDKETEGWKILEFVRGGSRSF 417

Query: 419 T 419
           T
Sbjct: 418 T 418

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/400 (65%), Positives = 324/400 (81%), Gaps = 5/400 (1%)

Query: 22  LHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKARE 81
           LHT+R   N G+  R+PL IFR+TFKKEWEKS ELQ +I+ LQDASGKI E+EAY+KAR+
Sbjct: 25  LHTSR---NLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARD 81

Query: 82  AFLRAQKGS-TIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQ 140
           A+L+A +GS TI+ KTLKKTG+T+E IA+KAW+SEI+K +R+ A +TA+KLDE FEPVR 
Sbjct: 82  AYLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRN 141

Query: 141 TQLYKDVSEVI-DDGDSTSYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTALVATG 199
           T++YKDVSEV+ DDGDS  YGGF            AL SG+RVRAVKSNDEAGTALVAT 
Sbjct: 142 TKIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATN 201

Query: 200 VESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESG 259
           V+S ES+G+K E+FKE+T VG+ LH  K   WDESENPLIV +RK++ K+  FF ETES 
Sbjct: 202 VQSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESS 261

Query: 260 RVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKM 319
           RVY+QFKL+D  FN+ +FT+HLREY+VPEILEAY++GDEKVLK WFSEAP+NVY+AQQK+
Sbjct: 262 RVYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKV 321

Query: 320 FKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKVKTGEIAAGSES 379
           F+++ LF DG ILDIR VEIVSAK             CRAQEIN+Y+K+KTGE+AAG+ S
Sbjct: 322 FRQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNAS 381

Query: 380 NILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           +ILMS+YAMVFTRDPE++ ++ETEGW+ILEFVRG SRQFT
Sbjct: 382 DILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  482 bits (1240), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 223/405 (55%), Positives = 307/405 (75%), Gaps = 9/405 (2%)

Query: 20  APLHTARVLLNGGRDPRSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKA 79
           +  H+  V+L      ++P+ IFR+TFK+EWEKS  LQ+ I+TL DAS +I +++A++KA
Sbjct: 21  SSFHSYPVVLQSNDSNKTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKA 80

Query: 80  REAFLRAQKGSTIVGKTLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVR 139
           ++A+      +TI+ KT+ KTG  +   A KAWDS++A+ ++ AA    +KLD+ FEPVR
Sbjct: 81  KDAYKNVSNQTTILSKTISKTGTKLNDAALKAWDSDLAQKTKLAA----KKLDDSFEPVR 136

Query: 140 QTQLYKDVSEVIDDGDST-SYGGFFTXXXXXXXXXKALASGERVRAVKSNDEAGTALVAT 198
            T++YKDVSEVIDD D++  YGGF +           L +G+R++ +KSNDEAGTAL+AT
Sbjct: 137 NTKIYKDVSEVIDDKDNSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIAT 196

Query: 199 GVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETES 258
            ++SKES+ +K+ DFKEKT VG+++  +K ++WDE++NPLIV MRKV+G   +FFAETES
Sbjct: 197 DLKSKESINEKLNDFKEKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETES 256

Query: 259 GRVYTQFKLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQK 318
            RV TQFKL+DPNFN+ +F + LREY++PE+LEAY++GDEK+LK WFSEAPYNVY+AQQK
Sbjct: 257 SRVLTQFKLIDPNFNNESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQK 316

Query: 319 MFKEKALFADGRILDIRGVEIVSAKXXXXXXXXXXXXGCRAQEINLYKKV----KTGEIA 374
             +++ +F+DGR+LDIRGV+IV+AK             CRAQEIN+YKK     +T +I 
Sbjct: 317 ELRKQKIFSDGRVLDIRGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIV 376

Query: 375 AGSESNILMSSYAMVFTRDPEQVTDEETEGWKILEFVRGGSRQFT 419
           AG +SNILMS+YAMVFTRDPEQ+ ++ETEGWKILEFVRGGSR+FT
Sbjct: 377 AGHDSNILMSTYAMVFTRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>Kpol_1024.18 s1024 (60564..63068) [2505 bp, 834 aa] {ON}
           (60564..63068) [2505 nt, 835 aa]
          Length = 834

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 266 KLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSE-APYNVYAAQQKMFKEK 323
           +L+DP+F+ V F K L   +  E +E  ++ + K++K+ F E AP+ +    Q++F +K
Sbjct: 291 RLLDPDFHGVNFEKSLVSLL--ENIETVIKNESKIVKRVFDESAPHVIQLFIQRIFVQK 347

>CAGL0L09669g Chr12 (1036568..1041556) [4989 bp, 1662 aa] {ON}
           similar to uniprot|P34241 Saccharomyces cerevisiae
           YKL014c
          Length = 1662

 Score = 31.2 bits (69), Expect = 6.3,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 23/68 (33%)

Query: 267 LMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKK----------------------- 303
           L++P+F  +T TK L E V+ ++   Y  GD+ + KK                       
Sbjct: 220 LLEPSFKKMTKTKVLNEMVLMKLHTLYYAGDKTLKKKVNEFFKIYGSDPVHSVAFTDDCV 279

Query: 304 WFSEAPYN 311
           WF  +PYN
Sbjct: 280 WFKTSPYN 287

>CAGL0K08404g Chr11 complement(846867..849335) [2469 bp, 822 aa]
           {ON} similar to uniprot|Q06245 Saccharomyces cerevisiae
           YLR166c Exocyst complex component
          Length = 822

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 36/59 (61%), Gaps = 3/59 (5%)

Query: 266 KLMDPNFNSVTFTKHLREYVVPEILEAYVRGDEKVLKKWFSE-APYNVYAAQQKMFKEK 323
           KLMDPN++ + +++ L + +  + +E  ++ + K++K+ F + A Y +    Q+ F +K
Sbjct: 284 KLMDPNYHIIVYSQELVDML--KNIEEVIKNESKIVKRVFEDSASYVLQLFIQRTFAQK 340

>KNAG0A06470 Chr1 (985023..986348) [1326 bp, 441 aa] {ON} Anc_2.475
           YKL106W
          Length = 441

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 36/66 (54%), Gaps = 2/66 (3%)

Query: 182 VRAVKSNDEAGTALVATGVESKESLGKKMEDFKEKTAVGRSLHGLKHRLWDESENPLIVF 241
           +R++ S+       VA  V S E+L  K + F++   + + LHG++H+L++  + P +V 
Sbjct: 325 IRSIYSSPPGYGCRVAKVVLSNEAL--KQQWFRDVQNMVQRLHGVRHKLYENLQWPDLVN 382

Query: 242 MRKVSG 247
             K  G
Sbjct: 383 FEKQHG 388

>TBLA0C01480 Chr3 complement(341677..342738) [1062 bp, 353 aa] {ON}
           Anc_1.398 YNL007C
          Length = 353

 Score = 30.8 bits (68), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 5/47 (10%)

Query: 106 GIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVID 152
           G++S A D+EI K  RKAA+K         +P   T+ +K++SE  +
Sbjct: 12  GVSSSASDAEIKKGYRKAALKYHPD-----KPTGDTEKFKEISEAFE 53

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,549,774
Number of extensions: 1518171
Number of successful extensions: 3791
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3915
Number of HSP's successfully gapped: 32
Length of query: 419
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 307
Effective length of database: 40,638,807
Effective search space: 12476113749
Effective search space used: 12476113749
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 67 (30.4 bits)